Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Colorful Dreamy Bubble PET Stickers Waterproof Transparent Decorative Decals For Phone Case Helmet Fridge Water Bottle
Colorful Dreamy Bubble PET Stickers Waterproof Transparent Decorative Decals For Phone Case Helmet Fridge Water Bottle
like
Find Similar
Macro view of 49 colorful dreamlike bubble stickers with vibrant watercolor gradients - Colorful Bubble Sticker Pack (SLP160)
Macro detail of colorful 3D dream bubble PET stickers with polished translucent texture - Colorful Bubble Sticker Pack (SLP158)
Colorful Dreamy Bubble PET Stickers Waterproof Transparent Decorative Decals For Phone Case Helmet Fridge Water Bottle
-9%
$0.93
No MOQ
Cute Animal Meme Stickers Waterproof PVC Vinyl Decals For Laptop Luggage Skateboard Phone Bottle Cartoon Animal Decoration
Cute Animal Meme Stickers Waterproof PVC Vinyl Decals For Laptop Luggage Skateboard Phone Bottle Cartoon Animal Decoration
like
Find Similar
Set of 50 cute cartoon animal stickers featuring cat, llama and sloth for DIY luggage - Cartoon Animal Meme (YCK053)
Cute Animal Meme Stickers Waterproof PVC Vinyl Decals For Laptop Luggage Skateboard Phone Bottle Cartoon Animal Decoration
$0.95
No MOQ
Cartoon Flower Fairy Laser Stickers Waterproof PVC Decals For Scrapbooking Laptop Suitcase Guitar DIY Decoration
Cartoon Flower Fairy Laser Stickers Waterproof PVC Decals For Scrapbooking Laptop Suitcase Guitar DIY Decoration
like
Find Similar
50pcs Cartoon Flower Fairy stickers with laser glitter finish for DIY laptop and guitar - Cartoon Flower Fairy (YCK358)
Cartoon Flower Fairy Laser Stickers Waterproof PVC Decals For Scrapbooking Laptop Suitcase Guitar DIY Decoration
$0.98
No MOQ
 · 
10 views
Cute Cartoon Siamese Cat Stickers Waterproof PVC DIY Journal Scrapbooking Stationery Decal For Water Bottle Laptop Phone Case
Cute Cartoon Siamese Cat Stickers Waterproof PVC DIY Journal Scrapbooking Stationery Decal For Water Bottle Laptop Phone Case
like
Find Similar
Cute Siamese cat sticker set for scrapbooking phone and water bottle decoration - Siamese Cat Mochi
Detailed grid layout of cute cartoon cat stickers for planners and waterproof phone decor - Siamese Cat Season Two
Cute Cartoon Siamese Cat Stickers Waterproof PVC DIY Journal Scrapbooking Stationery Decal For Water Bottle Laptop Phone Case
-4%
$0.69
No MOQ
Insulated Water Bottle 316 Stainless Steel Vacuum Flask Cute Cartoon Pattern Portable Lanyard School Travel Gift
Insulated Water Bottle 316 Stainless Steel Vacuum Flask Cute Cartoon Pattern Portable Lanyard School Travel Gift
like
Find Similar
Detail of cute white thermal bottle with cat and cherry patterns and a purple handle - 600ml / White (Black Cat & Cherry Print)
Detail of insulated water bottle featuring cute puppy pattern and portable carry strap - 600ml / Blue (Plaid & Puppy Print)
Close-up of cream stainless steel bottle with bear pattern and yellow carrying strap - 600ml / Yellow (Polka Dot & Bear Print)
Detail of cute strawberry cat graphic on white stainless steel portable thermos cup - 600ml / Pink (Strawberry Cat Print)
Insulated Water Bottle 316 Stainless Steel Vacuum Flask Cute Cartoon Pattern Portable Lanyard School Travel Gift
$5.71
No MOQ
 · 
21 views
Street Art Graffiti Stickers For Laptop Luggage PVC Waterproof Animal Decals DIY Decorative Aesthetic Sticker Set For Teens
Street Art Graffiti Stickers For Laptop Luggage PVC Waterproof Animal Decals DIY Decorative Aesthetic Sticker Set For Teens
like
Find Similar
50-piece Basquiat-style graffiti art stickers for DIY laptop and suitcase decoration - Graffiti Art Style
Street Art Graffiti Stickers For Laptop Luggage PVC Waterproof Animal Decals DIY Decorative Aesthetic Sticker Set For Teens
$0.95
No MOQ
 · 
15 views
Watercolor DIY Decorative Stickers PVC Waterproof For Laptop Phone Skateboard Water Bottle Cute Scrapbooking Supplies
Watercolor DIY Decorative Stickers PVC Waterproof For Laptop Phone Skateboard Water Bottle Cute Scrapbooking Supplies
like
Find Similar
Set of 50 vintage watercolor decorative stickers with travel and food themes on white background - 50 Sheets/Pack
Watercolor DIY Decorative Stickers PVC Waterproof For Laptop Phone Skateboard Water Bottle Cute Scrapbooking Supplies
$0.96
No MOQ
 · 
34 views
Insulated Mug With Straw And Handle 316 Stainless Steel Vacuum Flask Cartoon Graffiti Portable Water Bottle
Insulated Mug With Straw And Handle 316 Stainless Steel Vacuum Flask Cartoon Graffiti Portable Water Bottle
like
Find Similar
Cute striped 316 stainless steel cup with cat pattern, pink lid, and blue handle - Shaped Handle Style / Blue Stripe Cat
Pink insulated stainless steel mug with cute cat illustrations and large ring handle - Ring Handle Style / Pink Cute Cat
Insulated Mug With Straw And Handle 316 Stainless Steel Vacuum Flask Cartoon Graffiti Portable Water Bottle
$6.34
No MOQ
 · 
26 views
Traditional Lotus Petal Frosted Liuli Glass Teacup Gradient Color Personal Drinking Master Cup Chinese Style
Traditional Lotus Petal Frosted Liuli Glass Teacup Gradient Color Personal Drinking Master Cup Chinese Style
like
Find Similar
Pink gradient lotus flower frosted glass tea cup with 70ml capacity and 8cm diameter - Gradient Pink
Frosted lotus-shaped gradient yellow glass tea cup with 70ml capacity and unique design - Gradient Yellow
Frosted gradient lotus glass tea cup in blue and white, 70ml capacity handcrafted teaware - Gradient Blue
Frosted lotus-shaped glass tea cup with a delicate white to green gradient finish - Gradient Green
+2
Traditional Lotus Petal Frosted Liuli Glass Teacup Gradient Color Personal Drinking Master Cup Chinese Style
$1.44-1.73
No MOQ
 · 
12 sold recently
Cute Cartoon Penguin Stickers Waterproof PVC Vinyl Decals For Laptop Suitcase Car DIY Decorative Animals Art Supplies
Cute Cartoon Penguin Stickers Waterproof PVC Vinyl Decals For Laptop Suitcase Car DIY Decorative Animals Art Supplies
like
Find Similar
100-pack of cute cartoon penguin stickers in various creative styles for laptops - Penguin Sticker Assortment
Cute Cartoon Penguin Stickers Waterproof PVC Vinyl Decals For Laptop Suitcase Car DIY Decorative Animals Art Supplies
$1.91
No MOQ
304 Stainless Steel Soap Box Double Layer Drainage Soap Holder Modern Brushed Metal Soap Dish For Bathroom Kitchen Shower
304 Stainless Steel Soap Box Double Layer Drainage Soap Holder Modern Brushed Metal Soap Dish For Bathroom Kitchen Shower
like
Find Similar
Two-piece 304 stainless steel soap dish with oval drainage tray in brushed silver finish - Silver
Double-layer 304 stainless steel soap dish with gold brushed finish and drainage holes - Gold
Double-layer 304 stainless steel soap dish with rose gold brushed finish for bathroom - Rose Gold
Rainbow PVD coated 304 stainless steel double-layer oval soap dish with drain holes - AB Color
+1
304 Stainless Steel Soap Box Double Layer Drainage Soap Holder Modern Brushed Metal Soap Dish For Bathroom Kitchen Shower
$2.58-3.18
Mix MOQ : 2
 · 
30 sold recently
Portable Toothbrush Head Cover Case Clip On Travel Dustproof Protector Transparent Plastic Bathroom Accessories
Portable Toothbrush Head Cover Case Clip On Travel Dustproof Protector Transparent Plastic Bathroom Accessories
like
Find Similar
Compact clear acrylic hair claw clip with durable metal spring and glossy finish - Clear
Close-up of a translucent taupe plastic hair claw clip with round cutouts and smooth finish - Gray
Translucent cyan green plastic hair claw clip with durable metal spring and grip - Azure
Close-up of pink translucent hair claw clip showing internal spring and anti-slip teeth - Pink
+9
Portable Toothbrush Head Cover Case Clip On Travel Dustproof Protector Transparent Plastic Bathroom Accessories
$0.12
No MOQ
 · 
61 sold recently
Cartoon Blue Shark Graffiti Stickers Waterproof PVC Decals For Laptop Guitar Luggage DIY Decorative Stickers For Kids Teens
Cartoon Blue Shark Graffiti Stickers Waterproof PVC Decals For Laptop Guitar Luggage DIY Decorative Stickers For Kids Teens
like
Find Similar
Waterproof blue cartoon shark sticker set for decorating laptops and luggage cases - Blue Shark Style
Cartoon Blue Shark Graffiti Stickers Waterproof PVC Decals For Laptop Guitar Luggage DIY Decorative Stickers For Kids Teens
$0.98
No MOQ
Waterproof PVC Cartoon Cat Fox Drink Bottle Stickers For DIY Luggage Guitar Notebook Decorative Scrapbooking Journaling Decals
Waterproof PVC Cartoon Cat Fox Drink Bottle Stickers For DIY Luggage Guitar Notebook Decorative Scrapbooking Journaling Decals
like
Find Similar
Set of waterproof cartoon cat drink stickers for DIY decorating laptop and luggage - Cat And Fox In Bottle Style
Waterproof PVC Cartoon Cat Fox Drink Bottle Stickers For DIY Luggage Guitar Notebook Decorative Scrapbooking Journaling Decals
$0.98
No MOQ
Music Waterproof PVC Stickers Retro Hand Drawn Musical Instruments Decals For Laptop Suitcase Water Bottle Journal DIY Decor
Music Waterproof PVC Stickers Retro Hand Drawn Musical Instruments Decals For Laptop Suitcase Water Bottle Journal DIY Decor
like
Find Similar
50-piece colorful waterproof music theme stickers featuring guitars and headphones - Headphone Music Style
NewMusic Waterproof PVC Stickers Retro Hand Drawn Musical Instruments Decals For Laptop Suitcase Water Bottle Journal DIY Decor
$0.95
Mix MOQ : 2
Penguin Water Bottle Double Layer Insulated Heat Resistant Glass Cup Leak Proof Lid Cute Cartoon Travel Mug Students
Penguin Water Bottle Double Layer Insulated Heat Resistant Glass Cup Leak Proof Lid Cute Cartoon Travel Mug Students
like
Find Similar
Cute penguin double-walled glass water bottle 300ml with navy blue gift box packaging - Graphite Black
Close-up of cute red penguin-shaped stainless steel vacuum water bottle held by hand - China Red
Macro view of blue penguin cartoon vacuum insulated stainless steel water bottle outdoor - Sapphire Blue
Close-up of a cute penguin-shaped vacuum flask in dark grey and white for outdoor use - Leisure Gray
Penguin Water Bottle Double Layer Insulated Heat Resistant Glass Cup Leak Proof Lid Cute Cartoon Travel Mug Students
-4%
$2.96
Mix MOQ : 2
 · 
41 views
Cat Memes Stickers Funny Muscle Cat Cartoon Aesthetic Stickers PVC Waterproof Decal For Laptop Phone Bottle DIY Decoration
Cat Memes Stickers Funny Muscle Cat Cartoon Aesthetic Stickers PVC Waterproof Decal For Laptop Phone Bottle DIY Decoration
like
Find Similar
Funny cat meme sticker set featuring creative cartoon fitness and banana cat patterns - Funny Cat Collection (Default 8 Sheets Per Pack)
Cat Memes Stickers Funny Muscle Cat Cartoon Aesthetic Stickers PVC Waterproof Decal For Laptop Phone Bottle DIY Decoration
$0.86
No MOQ
Cartoon Speech Bubble Stickers DIY Waterproof PVC Comic Speech Balloon Decal For Journal Laptop Water Cup Decorative Labels
Cartoon Speech Bubble Stickers DIY Waterproof PVC Comic Speech Balloon Decal For Journal Laptop Water Cup Decorative Labels
like
Find Similar
50pcs black and white comic speech bubble stickers for DIY scrapbooking and laptops - 50 Sheets/Pack
Cartoon Speech Bubble Stickers DIY Waterproof PVC Comic Speech Balloon Decal For Journal Laptop Water Cup Decorative Labels
$0.86
No MOQ
Christmas Silicone Straw Cover Dustproof Reusable Straw Topper For Drinkware Accessories Gnome Penguin Santa Hat Design
Christmas Silicone Straw Cover Dustproof Reusable Straw Topper For Drinkware Accessories Gnome Penguin Santa Hat Design
like
Find Similar
Reusable red and white Christmas hat silicone straw topper cap for 10mm straws - Christmas Hat
Christmas penguin silicone straw cover with red hat and gift box design for 10mm straws - Christmas Penguin
Christmas gnome silicone straw cover with red polka dot hat and gingerbread tree charm - Christmas Gnome with Gingerbread Tree
Red Christmas gnome silicone straw topper 10mm with Merry Christmas sign on white background - Christmas Gnome - Merry Christmas
+2
Christmas Silicone Straw Cover Dustproof Reusable Straw Topper For Drinkware Accessories Gnome Penguin Santa Hat Design
$0.16
Mix MOQ : 100
S Shaped Hooks Stainless Steel Heavy Duty Multifunctional Hanging Hooks For Kitchen Bathroom Wardrobe Closet Organizers
S Shaped Hooks Stainless Steel Heavy Duty Multifunctional Hanging Hooks For Kitchen Bathroom Wardrobe Closet Organizers
like
Find Similar
Set of 4 stainless steel S-hooks for kitchen and bathroom, 5cm length and 2.8mm wire - 2.8mm Diameter/5cm Height
Silver stainless steel S-hook, 9cm height and 2.8mm diameter for versatile storage - 2.8mm Diameter/9cm Height
S-shaped 201 stainless steel utility hook with 2.8mm thickness and 11cm height - 2.8mm Diameter/11cm Height
2.8mm thick S-shaped 201 stainless steel hooks for kitchen and bathroom hanging - 2.8mm Diameter/14cm Height
+5
S Shaped Hooks Stainless Steel Heavy Duty Multifunctional Hanging Hooks For Kitchen Bathroom Wardrobe Closet Organizers
$0.03-0.10
No MOQ
 · 
2K+ sold recently
100 Waterproof PVC Succulent Plant Flower Graffiti Stickers For Luggage Laptop Fridge Water Cup Decorative Aesthetic Decals
100 Waterproof PVC Succulent Plant Flower Graffiti Stickers For Luggage Laptop Fridge Water Cup Decorative Aesthetic Decals
like
Find Similar
100pcs waterproof succulent and floral doodle stickers for suitcases and water bottles - Floral & Plant Series (JXZ-HT033+HT127)
100 Waterproof PVC Succulent Plant Flower Graffiti Stickers For Luggage Laptop Fridge Water Cup Decorative Aesthetic Decals
$1.91
No MOQ
Cartoon Fruit Vegetable Animal Stickers Waterproof PVC DIY Decals For Laptop Luggage Guitar Phone Case Decoration
Cartoon Fruit Vegetable Animal Stickers Waterproof PVC DIY Decals For Laptop Luggage Guitar Phone Case Decoration
like
Find Similar
Vibrant waterproof cartoon fruit animal graffiti stickers for DIY laptop and guitar decor - Cartoon Fruit Vegetable Animal Style
Cartoon Fruit Vegetable Animal Stickers Waterproof PVC DIY Decals For Laptop Luggage Guitar Phone Case Decoration
$0.92
No MOQ
Smart Vacuum Flask 304 Stainless Steel Water Bottle With LED Temperature Display Touch Screen Leak Proof Travel Mug
Smart Vacuum Flask 304 Stainless Steel Water Bottle With LED Temperature Display Touch Screen Leak Proof Travel Mug
like
Find Similar
Smart LED temperature display thermos in brushed natural steel finish with digital sensor - 16oz / Matte Steel Color / Smart Temp Display
Sleek matte black smart vacuum thermos flask with LED temperature touch display - 16oz / Straight Cup Black / No Display
Smart LED temperature display thermos bottle in rose gold with gift set accessories - 16oz / Matte Rose Gold / Smart Temp Display
Smart LED temperature display vacuum flask in matte gold finish with sleek cylinder shape - 16oz / Matte Intelligent Gold / No Display
+19
Smart Vacuum Flask 304 Stainless Steel Water Bottle With LED Temperature Display Touch Screen Leak Proof Travel Mug
$2.29-5.45
Mix MOQ : 2
 · 
56 sold recently
Cute Cartoon Bear Dessert Pattern Stickers For Scrapbooking Journal Waterproof Decorative Decals DIY Stationery Crafts Korean Style
Cute Cartoon Bear Dessert Pattern Stickers For Scrapbooking Journal Waterproof Decorative Decals DIY Stationery Crafts Korean Style
like
Find Similar
Set of 100 cute cartoon bear stickers for planners featuring cupcakes and milk boxes - Happy Joyful Bear
NewCute Cartoon Bear Dessert Pattern Stickers For Scrapbooking Journal Waterproof Decorative Decals DIY Stationery Crafts Korean Style
$0.72
No MOQ
Cute Pink Cartoon Animal Stickers Waterproof Vinyl Decals For Water Bottle Laptop Suitcase DIY Stationery Decoration Kids
Cute Pink Cartoon Animal Stickers Waterproof Vinyl Decals For Water Bottle Laptop Suitcase DIY Stationery Decoration Kids
like
Find Similar
Set of 50 cute pink 3D cartoon animal stickers for DIY luggage decoration and scrapbooking - Cute Pink Animal (T01041286)
Cute Pink Cartoon Animal Stickers Waterproof Vinyl Decals For Water Bottle Laptop Suitcase DIY Stationery Decoration Kids
$0.88
Mix MOQ : 2
100Pcs Cartoon Capybara Stickers Waterproof PVC Graffiti Decals For Suitcase Laptop Guitar Water Cup DIY Decoration
100Pcs Cartoon Capybara Stickers Waterproof PVC Graffiti Decals For Suitcase Laptop Guitar Water Cup DIY Decoration
like
Find Similar
Set of 100 cute cartoon capybara graffiti stickers for DIY decoration and creative crafts - 100 Pcs/Pack
100Pcs Cartoon Capybara Stickers Waterproof PVC Graffiti Decals For Suitcase Laptop Guitar Water Cup DIY Decoration
$1.91
No MOQ
Portable Sports Water Bottle PC Plastic Leakproof With Stainless Steel Tea Infuser Hidden Handle For Gym Outdoor Modern
Portable Sports Water Bottle PC Plastic Leakproof With Stainless Steel Tea Infuser Hidden Handle For Gym Outdoor Modern
like
Find Similar
12 options
Portable Sports Water Bottle PC Plastic Leakproof With Stainless Steel Tea Infuser Hidden Handle For Gym Outdoor Modern
-5%
$1.59-2.60
Mix MOQ : 2
 · 
32 views
Cartoon Black Cat Stickers Waterproof PVC DIY Decorative Doodle Decals For Laptop Phone Case Luggage Fridge Notebook Gift
Cartoon Black Cat Stickers Waterproof PVC DIY Decorative Doodle Decals For Laptop Phone Case Luggage Fridge Notebook Gift
like
Find Similar
50pcs waterproof black cat and flower doodle stickers for laptop and helmet decoration - Black Cat Plant Doodle Series (T01042344)
Cartoon Black Cat Stickers Waterproof PVC DIY Decorative Doodle Decals For Laptop Phone Case Luggage Fridge Notebook Gift
$0.86
Mix MOQ : 2
Vintage Illustration Cartoon Stickers For Laptop Luggage Waterproof PVC Decorative Decals For Scrapbooking Phone Case
Vintage Illustration Cartoon Stickers For Laptop Luggage Waterproof PVC Decorative Decals For Scrapbooking Phone Case
like
Find Similar
50pcs vintage cartoon stickers featuring animals and space for waterproof decoration - Vintage Illustration Patterns
Vintage Illustration Cartoon Stickers For Laptop Luggage Waterproof PVC Decorative Decals For Scrapbooking Phone Case
$0.96
No MOQ
Artistic World Famous Oil Paintings Waterproof PVC Vinyl Stickers For Laptop Luggage Phone Case Water Bottle Skateboard Guitar Stationery Decor
Artistic World Famous Oil Paintings Waterproof PVC Vinyl Stickers For Laptop Luggage Phone Case Water Bottle Skateboard Guitar Stationery Decor
like
Find Similar
50pcs Aesthetic World Famous Oil Painting Art Stickers for Laptop and Luggage - World Famous Painting Series Stickers
Artistic World Famous Oil Paintings Waterproof PVC Vinyl Stickers For Laptop Luggage Phone Case Water Bottle Skateboard Guitar Stationery Decor
$0.96
No MOQ
Waterproof PVC Decorative Stickers Moon Flower Black Cat Starry Sky Bohemian Mystery For Laptop Guitar Luggage DIY
Waterproof PVC Decorative Stickers Moon Flower Black Cat Starry Sky Bohemian Mystery For Laptop Guitar Luggage DIY
like
Find Similar
Pack of 50 moon flower and black cat graffiti stickers for DIY laptop and guitar decoration - 50Pcs Moon Flower and Cat
Waterproof PVC Decorative Stickers Moon Flower Black Cat Starry Sky Bohemian Mystery For Laptop Guitar Luggage DIY
$0.98
No MOQ
 · 
33 sold recently
Cute Cartoon Cat Stickers PVC Waterproof Aesthetic Animal Decals For Laptop Guitar Luggage DIY Decorative Stickers For Kids Adults
Cute Cartoon Cat Stickers PVC Waterproof Aesthetic Animal Decals For Laptop Guitar Luggage DIY Decorative Stickers For Kids Adults
like
Find Similar
Set of 50 waterproof cartoon cat stickers for laptop and guitar DIY decoration - Cartoon Cat (PMS156)
Cute Cartoon Cat Stickers PVC Waterproof Aesthetic Animal Decals For Laptop Guitar Luggage DIY Decorative Stickers For Kids Adults
$0.98
No MOQ
Cartoon Pink Sarcastic Meme Stickers Waterproof PVC Decals For Laptop Guitar Luggage DIY Personal Funny Quotes Stickers
Cartoon Pink Sarcastic Meme Stickers Waterproof PVC Decals For Laptop Guitar Luggage DIY Personal Funny Quotes Stickers
like
Find Similar
Flat lay of funny pink sarcastic cartoon stickers with humorus quotes for DIY decor - Sarcastic Quote Style
NewCartoon Pink Sarcastic Meme Stickers Waterproof PVC Decals For Laptop Guitar Luggage DIY Personal Funny Quotes Stickers
$0.86
No MOQ
INS Style Strawberry Waterproof PVC Stickers For Luggage Laptop Guitar DIY Decorative Decals For Teens Adults
INS Style Strawberry Waterproof PVC Stickers For Luggage Laptop Guitar DIY Decorative Decals For Teens Adults
like
Find Similar
50pcs set of strawberry stickers for laptops and journals with cute food and animal designs - Strawberry Theme
INS Style Strawberry Waterproof PVC Stickers For Luggage Laptop Guitar DIY Decorative Decals For Teens Adults
$0.86
No MOQ
Leopard Print Girl Aesthetic Stickers Waterproof PVC DIY Decals For Water Bottle Phone Skateboard Guitar Luggage Decor
Leopard Print Girl Aesthetic Stickers Waterproof PVC DIY Decals For Water Bottle Phone Skateboard Guitar Luggage Decor
like
Find Similar
50 pieces of leopard print girl stickers for waterproof creative graffiti decoration - Leopard Girl Style
Leopard Print Girl Aesthetic Stickers Waterproof PVC DIY Decals For Water Bottle Phone Skateboard Guitar Luggage Decor
$0.86
No MOQ
Original Hand Painted Cartoon Animal Stickers Waterproof PVC Aesthetic Watercolor Decals For Laptop Suitcase Journal DIY Decoration
Original Hand Painted Cartoon Animal Stickers Waterproof PVC Aesthetic Watercolor Decals For Laptop Suitcase Journal DIY Decoration
like
Find Similar
50 pieces of original hand-drawn animal stickers for DIY planners and waterproof decor - Hand-painted Cartoon Animal Style
Original Hand Painted Cartoon Animal Stickers Waterproof PVC Aesthetic Watercolor Decals For Laptop Suitcase Journal DIY Decoration
$0.96
No MOQ
Cow Coffee Mug Ceramic 3D Animal Shape Cute Cartoon Novelty Drinkware For Office Home Women Gift
Cow Coffee Mug Ceramic 3D Animal Shape Cute Cartoon Novelty Drinkware For Office Home Women Gift
like
Find Similar
Detailed size chart for 20oz cow shaped ceramic coffee mug with capacity and dimensions - Classic Cow Style
Cow Coffee Mug Ceramic 3D Animal Shape Cute Cartoon Novelty Drinkware For Office Home Women Gift
$8.07
No MOQ
 · 
59 views
Vacuum Insulated Water Bottle 316 Stainless Steel Portable Cute Thermos Cup With Cartoon Charm Lanyard For Kids Women
Vacuum Insulated Water Bottle 316 Stainless Steel Portable Cute Thermos Cup With Cartoon Charm Lanyard For Kids Women
like
Find Similar
Detail of 400ml vacuum cup with cute cat print, red spherical lid and gift box - 400ml / Red
Off-white 400ml stainless steel vacuum flask with bear camping print and blue ball cap - 400ml / Blue
Creamy white stainless steel 400ml vacuum flask with pink cherry patterns and floral charm - 400ml / Pink
Cream yellow vacuum flask with cute puppy print and flower pendant 400ml water bottle - 400ml / Yellow
+4
Vacuum Insulated Water Bottle 316 Stainless Steel Portable Cute Thermos Cup With Cartoon Charm Lanyard For Kids Women
$6.28
No MOQ
 · 
16 views
Large Capacity Straw Cup Plastic Water Bottle With Handle And Tea Filter Portable Outdoor Sports Coffee Mug Korean Style
Large Capacity Straw Cup Plastic Water Bottle With Handle And Tea Filter Portable Outdoor Sports Coffee Mug Korean Style
like
Find Similar
Pink large-capacity plastic straw cup with handle and Shak HANDS print on a wooden table - 40oz / Rose Red
Clear plastic straw water bottle with yellow handle and SHAKE HANDS print - 40oz / Bright Yellow
Large Capacity Straw Cup Plastic Water Bottle With Handle And Tea Filter Portable Outdoor Sports Coffee Mug Korean Style
$4.18
No MOQ
 · 
71 views
Mini Vacuum Insulated Bottle Stainless Steel Wood Grain Lid Portable Thermos With Tea Infuser Matte Finish Travel Office
Mini Vacuum Insulated Bottle Stainless Steel Wood Grain Lid Portable Thermos With Tea Infuser Matte Finish Travel Office
like
Find Similar
Mini 150ml wood-grain lid vacuum flask in creamy white matte finish held in a cafe - 150ML / White
Mini 150ml and 250ml matte black vacuum insulated flasks with dark wood grain lids - 150ML / Black
Mini 250ml red vacuum insulated water bottle with wood grain lid in two sizes - 150ML / Red
Mini 150ml dark cyan vacuum insulated water bottle held in hand showing compact pocket size - 150ML / Dark Blue
+8
Mini Vacuum Insulated Bottle Stainless Steel Wood Grain Lid Portable Thermos With Tea Infuser Matte Finish Travel Office
-6%
$2.68-2.95
Mix MOQ : 2
 · 
39 views
Soccer Stickers Waterproof PVC Decals Sports Football Graffiti Decoration For Laptop Luggage Skateboard Water Bottle Fans
Soccer Stickers Waterproof PVC Decals Sports Football Graffiti Decoration For Laptop Luggage Skateboard Water Bottle Fans
like
Find Similar
Set of 100 waterproof soccer stickers with motivational quotes for laptops and luggage - Soccer Series Style
Soccer Stickers Waterproof PVC Decals Sports Football Graffiti Decoration For Laptop Luggage Skateboard Water Bottle Fans
$2.48
No MOQ
Gothic Horror Skull Stickers Waterproof PVC Black And White Dark Aesthetic Decals For Laptop Skateboard Luggage Decoration
Gothic Horror Skull Stickers Waterproof PVC Black And White Dark Aesthetic Decals For Laptop Skateboard Luggage Decoration
like
Find Similar
50 Gothic skull stickers set with black and white horror vintage designs for skateboards - Retro Horror Black White Skull Sticker Set (YCK013)
Gothic Horror Skull Stickers Waterproof PVC Black And White Dark Aesthetic Decals For Laptop Skateboard Luggage Decoration
$0.95
No MOQ
 · 
14 views
Children Cartoon Straw Water Bottle Plastic Portable Large Capacity With Strap And Handle For School Students
Children Cartoon Straw Water Bottle Plastic Portable Large Capacity With Strap And Handle For School Students
like
Find Similar
Cute bear pattern plastic water bottle with beige lid, straw and adjustable strap - 650ml / Bear / Yellow
Cute red cartoon puppy plastic water bottle with adjustable strap and straw for kids - 650ml / Dog / Red
Cute panda cartoon plastic water bottle for kids with white strap and straw - 650ml / Panda / White
Cute beige capybara straw water bottle for students with adjustable crossbody strap - 650ml / Capybara / Brown
Children Cartoon Straw Water Bottle Plastic Portable Large Capacity With Strap And Handle For School Students
$4.01
No MOQ
 · 
29 views
Cute Bee Cartoon Stickers Waterproof PVC For DIY Scrapbook Laptop Guitar Luggage Kawaii Animal Decor Kids Gift
Cute Bee Cartoon Stickers Waterproof PVC For DIY Scrapbook Laptop Guitar Luggage Kawaii Animal Decor Kids Gift
like
Find Similar
50pcs cute cartoon bee stickers set for DIY scrapbooking and waterproof decoration - 50Pcs Little Bee
Cute Bee Cartoon Stickers Waterproof PVC For DIY Scrapbook Laptop Guitar Luggage Kawaii Animal Decor Kids Gift
$0.86
Mix MOQ : 5
 · 
12 sold recently
Silicone Stretch Lids Food Grade Reusable Heat Resistant Suction Seal Covers For Bowls Pots Pans Kitchen Spiral Design
Silicone Stretch Lids Food Grade Reusable Heat Resistant Suction Seal Covers For Bowls Pots Pans Kitchen Spiral Design
like
Find Similar
Beige silicone suction lid for bowls with spiral texture and easy-grip handles - 6 Inch (18CM)
Beige round silicone food cover with spiral texture and grey hexagonal handle - 11 Inch (32CM)
Off-white silicone stretch lid with spiral texture and grey hexagonal center handle - 9 Inch (27CM)
Round silicone freshness cover in off-white with grey hexagonal handle and spiral texture - 12 Inch (35.5CM)
+2
Silicone Stretch Lids Food Grade Reusable Heat Resistant Suction Seal Covers For Bowls Pots Pans Kitchen Spiral Design
$1.30-3.75
Mix MOQ : 2
 · 
20 views
Modern Art Aesthetic Stickers For Water Bottles Laptops Scrapbooking Waterproof Artistic Decal Pack Universal Gift
Modern Art Aesthetic Stickers For Water Bottles Laptops Scrapbooking Waterproof Artistic Decal Pack Universal Gift
like
Find Similar
50-piece mixed modern art stickers set with abstract botanical and geometric patterns - T01042553
Modern Art Aesthetic Stickers For Water Bottles Laptops Scrapbooking Waterproof Artistic Decal Pack Universal Gift
$0.86
Mix MOQ : 2
Stainless Steel Pet Bowl Anti-Slip Non-Tip Food Water Dish With Rubber Base Cat Face Pattern For Dogs And Cats
Stainless Steel Pet Bowl Anti-Slip Non-Tip Food Water Dish With Rubber Base Cat Face Pattern For Dogs And Cats
like
Find Similar
Purple stainless steel cat bowl with cute whiskers pattern and anti-slip rubber base - Purple
Non-slip stainless steel pet bowl with black exterior and minimalist white cat face print - Black
Blue stainless steel pet bowl with cute cat face print and non-slip rubber base - Sky Blue
Stainless Steel Pet Bowl Anti-Slip Non-Tip Food Water Dish With Rubber Base Cat Face Pattern For Dogs And Cats
$1.30
No MOQ
 · 
28 sold recently
Stainless Steel Vacuum Insulated Coffee Tumbler Ceramic Coating Portable Strap Cartoon Dog Pattern Straw Flip Lid
Stainless Steel Vacuum Insulated Coffee Tumbler Ceramic Coating Portable Strap Cartoon Dog Pattern Straw Flip Lid
like
Find Similar
Cute pink 550ml vacuum insulated coffee mug with 316 stainless steel and cartoon prints - Cartoon Animal Apple / Pink
550ml blue and white stainless steel vacuum coffee mug with cartoon dog print and lanyard - Cartoon Dog Blue White / Blue
Detail of insulated stainless steel coffee cup with cute cartoon dog print and gift box - Cartoon Dog Bear / Brown
Close-up of insulated stainless steel dog cup with green checkered pattern and box - Cartoon Dog Gingham / Green Checkerboard
+7
Stainless Steel Vacuum Insulated Coffee Tumbler Ceramic Coating Portable Strap Cartoon Dog Pattern Straw Flip Lid
$4.84-6.34
No MOQ
 · 
33 views
Stainless Steel Hook Clips Non-Slip Dipped Plastic Coated Multi-Functional Hanging Pegs For Laundry Closet Kitchen Storage
Stainless Steel Hook Clips Non-Slip Dipped Plastic Coated Multi-Functional Hanging Pegs For Laundry Closet Kitchen Storage
like
Find Similar
Blue rubber coated stainless steel hook clip with 10.5cm height for scarf storage - 5 Pcs/Pack / Blue
White non-slip coated stainless steel hook clips for scarves and home laundry storage - 5 Pcs/Pack / Off White
Stainless steel laundry hook clip with non-slip green PVC coating for scarves - 5 Pcs/Pack / Green
Pink rubber coated stainless steel hook clips for non-slip scarf and clothes storage - 5 Pcs/Pack / Pink
+2
Stainless Steel Hook Clips Non-Slip Dipped Plastic Coated Multi-Functional Hanging Pegs For Laundry Closet Kitchen Storage
$0.07
Mix MOQ : 5
 · 
4K+ sold recently
Secret Forest Theme Waterproof PET Decorative Stickers For DIY Projects Phone Guitar Suitcase Hand Account Journal Decoration
Secret Forest Theme Waterproof PET Decorative Stickers For DIY Projects Phone Guitar Suitcase Hand Account Journal Decoration
like
Find Similar
Detailed grid showing 49 watercolor forest magic stickers with elves and fantasy houses - Secret Realm Forest
Secret Forest Theme Waterproof PET Decorative Stickers For DIY Projects Phone Guitar Suitcase Hand Account Journal Decoration
$0.93
No MOQ
 · 
32 views
Plastic Protein Shaker Bottle With Mixing Ball Graduated Frosted Portable Mixer Cup For Fitness Gym Milkshake
Plastic Protein Shaker Bottle With Mixing Ball Graduated Frosted Portable Mixer Cup For Fitness Gym Milkshake
like
Find Similar
Pink and white protein shaker bottle with mixing ball for fitness and sports gym use - 500ml / Pink
Yellow protein shaker bottle set with mixing ball and scale on wooden table - 500ml / Yellow
Plastic Protein Shaker Bottle With Mixing Ball Graduated Frosted Portable Mixer Cup For Fitness Gym Milkshake
$1.15-1.30
No MOQ
Original Sweet Cool Cartoon Girl DIY Stickers Pink Black Y2K Journal Stickers For Scrapbooking Phone Case Decor Accessory
Original Sweet Cool Cartoon Girl DIY Stickers Pink Black Y2K Journal Stickers For Scrapbooking Phone Case Decor Accessory
like
Find Similar
Set of trendy Korean style cartoon girl stickers for phone case DIY and scrapbooking - Sweet Cool Girl Series
Original Sweet Cool Cartoon Girl DIY Stickers Pink Black Y2K Journal Stickers For Scrapbooking Phone Case Decor Accessory
$0.86
No MOQ
Waterproof PVC Cartoon Character Stickers For Laptop Guitar Luggage DIY Decorative Doodle Stickers Set For Kids Adults
Waterproof PVC Cartoon Character Stickers For Laptop Guitar Luggage DIY Decorative Doodle Stickers Set For Kids Adults
like
Find Similar
50 mixed cartoon stickers for guitar and laptop with colorful waterproof 2D anime designs - Cartoon Character Collection (YCK130)
Waterproof PVC Cartoon Character Stickers For Laptop Guitar Luggage DIY Decorative Doodle Stickers Set For Kids Adults
$0.98
No MOQ
Cute Orange Tabby Cat Stickers Waterproof PVC Decorative Decals For Water Bottles Laptop Luggage Guitar DIY Scrapbooking
Cute Orange Tabby Cat Stickers Waterproof PVC Decorative Decals For Water Bottles Laptop Luggage Guitar DIY Scrapbooking
like
Find Similar
50pcs waterproof orange tabby cat stickers for laptops, journals and water bottles - Orange Tabby Cat Series (PMS031)
Cute Orange Tabby Cat Stickers Waterproof PVC Decorative Decals For Water Bottles Laptop Luggage Guitar DIY Scrapbooking
$0.96
No MOQ
Planet Stickers Solar System Space Galaxy Waterproof Vinyl Decals For Laptop Phone Suitcase DIY Aesthetic Journaling Decoration
Planet Stickers Solar System Space Galaxy Waterproof Vinyl Decals For Laptop Phone Suitcase DIY Aesthetic Journaling Decoration
like
Find Similar
Set of 50 colorful solar system planet stickers for DIY journals and laptop decor - Planet Series Set (T01042660)
NewPlanet Stickers Solar System Space Galaxy Waterproof Vinyl Decals For Laptop Phone Suitcase DIY Aesthetic Journaling Decoration
$0.86
Mix MOQ : 2
Pink Black Halloween Stickers Waterproof Cartoon Vinyl Decals For Laptop Water Bottle Suitcase Guitar Skateboard Decoration Gift
Pink Black Halloween Stickers Waterproof Cartoon Vinyl Decals For Laptop Water Bottle Suitcase Guitar Skateboard Decoration Gift
like
Find Similar
1 option
Pink Black Halloween Stickers Waterproof Cartoon Vinyl Decals For Laptop Water Bottle Suitcase Guitar Skateboard Decoration Gift
$0.86
No MOQ
Cute Cartoon Cat Stickers Waterproof PVC Decals For Laptop Suitcase Guitar DIY Decoration Japanese Kawaii Animal Dress Up Vinyl Stickers
Cute Cartoon Cat Stickers Waterproof PVC Decals For Laptop Suitcase Guitar DIY Decoration Japanese Kawaii Animal Dress Up Vinyl Stickers
like
Find Similar
50 pieces of colorful cartoon cat stickers for DIY laptop luggage and guitar decoration - Cartoon Cat Dress-up Series
Cute Cartoon Cat Stickers Waterproof PVC Decals For Laptop Suitcase Guitar DIY Decoration Japanese Kawaii Animal Dress Up Vinyl Stickers
$0.70
No MOQ
Cartoon Oil Painting Bear Stickers Waterproof PVC DIY Decorative Decals For Laptop Suitcase iPad Phone Case Scrapbooking
Cartoon Oil Painting Bear Stickers Waterproof PVC DIY Decorative Decals For Laptop Suitcase iPad Phone Case Scrapbooking
like
Find Similar
50pcs set of cartoon oil painting bear graffiti stickers for laptops and journals - Oil Painting Bear Stickers / 4-6CM
Cartoon Oil Painting Bear Stickers Waterproof PVC DIY Decorative Decals For Laptop Suitcase iPad Phone Case Scrapbooking
$1.26
No MOQ
Psychedelic Frog Stickers Waterproof Cartoon Graffiti Decals For Laptop Water Bottle Luggage Guitar Phone DIY Decoration
Psychedelic Frog Stickers Waterproof Cartoon Graffiti Decals For Laptop Water Bottle Luggage Guitar Phone DIY Decoration
like
Find Similar
50 pieces of colorful trippy frog stickers for water bottles and luggage decoration - Psychedelic Frog Theme
Psychedelic Frog Stickers Waterproof Cartoon Graffiti Decals For Laptop Water Bottle Luggage Guitar Phone DIY Decoration
$0.96
No MOQ
Magic Witch PET Holographic Stickers Decorative Mystery Fantasy Wizard Water Bottle Laptop Scrapbooking DIY Stickers
Magic Witch PET Holographic Stickers Decorative Mystery Fantasy Wizard Water Bottle Laptop Scrapbooking DIY Stickers
like
Find Similar
Detailed close-up of 50 magic witch PET stickers featuring purple crystals and moon cats - Holographic Flash Film / Magic Witch Holographic Series
Magic Witch PET Holographic Stickers Decorative Mystery Fantasy Wizard Water Bottle Laptop Scrapbooking DIY Stickers
-9%
$0.93
No MOQ
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access