Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Iridescent Cloud Glass Cup With Handle Lid And Straw Kawaii Cute Cartoon Polka Dot High Borosilicate Glass Drinkware
Iridescent Cloud Glass Cup With Handle Lid And Straw Kawaii Cute Cartoon Polka Dot High Borosilicate Glass Drinkware
like
Find Similar
Iridescent glass cup with blue lid, yellow cloud straw cap and cute animal print - 750ml / Blue
Iridescent Cloud Glass Cup With Handle Lid And Straw Kawaii Cute Cartoon Polka Dot High Borosilicate Glass Drinkware
$5.71
No MOQ
 · 
17 views
Waterproof Pvc Stickers Pink Cartoon Graffiti Vsco Aesthetic Decals For Laptop Luggage Guitar Skateboard Decor Diy Art
Waterproof Pvc Stickers Pink Cartoon Graffiti Vsco Aesthetic Decals For Laptop Luggage Guitar Skateboard Decor Diy Art
like
Find Similar
100-piece VSCO style pink aesthetic waterproof vinyl stickers for luggage and laptops - Pink VSCO Style (100PCS)
Waterproof Pvc Stickers Pink Cartoon Graffiti Vsco Aesthetic Decals For Laptop Luggage Guitar Skateboard Decor Diy Art
-10%
$2.23
No MOQ
 · 
15 sold recently
Glass Mug With Straw And Lid Large Capacity Borosilicate Heat Resistant Transparent Water Cup Creative Print Office
Glass Mug With Straw And Lid Large Capacity Borosilicate Heat Resistant Transparent Water Cup Creative Print Office
like
Find Similar
1000ml high borosilicate glass mug with side handle and money themed black text prints - 1000ml / Salary Increase Slogan Mug
1000ml high borosilicate glass water bottle with handle and time scale reminders - 1000ml / Good Morning Slogan Mug
1000ml high borosilicate glass water bottle with dual drinking lid and straw - 1000ml / No Troubles Strawberry Theme Glass Straw Coaster Set
1000ml high borosilicate glass straw cup in lemon yellow with anti-slip base and lid - 1000ml / Retire Early Yellow Theme Glass Straw Coaster Set
+18
Glass Mug With Straw And Lid Large Capacity Borosilicate Heat Resistant Transparent Water Cup Creative Print Office
$1.50-3.11
No MOQ
 · 
94 views
Floral Tumbler Accessories Collection With Handle Straw Cover Protective Boot For Large Water Bottle Decoration Women Gift
Floral Tumbler Accessories Collection With Handle Straw Cover Protective Boot For Large Water Bottle Decoration Women Gift
like
Find Similar
Pink Stanley cup accessory set with floral handle, straw cover and heart charms - Pink Flower Style
Lavender purple 40oz tumbler set with silicone straw cover and floral accessories - Purple Floral Style
Pink 40oz floral tumbler set with daisy print, woven handle, and silicone accessories - White Daisy Style
Floral Tumbler Accessories Collection With Handle Straw Cover Protective Boot For Large Water Bottle Decoration Women Gift
$5.47
Mix MOQ : 3
Waterproof PVC Cartoon Animal Stickers For Laptop Guitar Luggage DIY Scrapbook Educational Cute Animal Decals For Kids Teens
Waterproof PVC Cartoon Animal Stickers For Laptop Guitar Luggage DIY Scrapbook Educational Cute Animal Decals For Kids Teens
like
Find Similar
Set of 50 colorful cartoon animal waterproof stickers with English names for DIY decor - 50 Sheets/Pack
Waterproof PVC Cartoon Animal Stickers For Laptop Guitar Luggage DIY Scrapbook Educational Cute Animal Decals For Kids Teens
$0.98
No MOQ
50Pcs Vintage Aesthetic Aesthetic Retro Stickers Waterproof PVC DIY Decals For Laptop Luggage Notebook Decoration
50Pcs Vintage Aesthetic Aesthetic Retro Stickers Waterproof PVC DIY Decals For Laptop Luggage Notebook Decoration
like
Find Similar
Set of 50 watercolor aesthetic inspirational stickers for laptops and iPads - 50 Sheets/Pack
New50Pcs Vintage Aesthetic Aesthetic Retro Stickers Waterproof PVC DIY Decals For Laptop Luggage Notebook Decoration
-10%
$0.86
No MOQ
8 Sheets Cute Anime Girl Stickers Waterproof PVC Decorative Decals for DIY Journaling Phone Case Stationery Stickers
8 Sheets Cute Anime Girl Stickers Waterproof PVC Decorative Decals for DIY Journaling Phone Case Stationery Stickers
like
Find Similar
Set of 6 cute cartoon girl stickers for DIY phone cases and laptops in varied colors - Cartoon Girl Series
8 Sheets Cute Anime Girl Stickers Waterproof PVC Decorative Decals for DIY Journaling Phone Case Stationery Stickers
$0.95
No MOQ
 · 
17 sold recently
DIY Cartoon Anime Make A Face Stickers Waterproof Reusable PVC Self Adhesive Stickers For Scrapbooking Kids Decoration
DIY Cartoon Anime Make A Face Stickers Waterproof Reusable PVC Self Adhesive Stickers For Scrapbooking Kids Decoration
like
Find Similar
DIY cartoon character puzzle stickers for kids with waterproof dress-up accessories - Mixed Color Style
DIY Cartoon Anime Make A Face Stickers Waterproof Reusable PVC Self Adhesive Stickers For Scrapbooking Kids Decoration
$0.10
Mix MOQ : 8
 · 
16 sold recently
Stacking Animal Stickers Cute Cartoon Waterproof PVC Decals For Laptop Guitar Luggage DIY Scrapbooking Doodle Stamping Supplies
Stacking Animal Stickers Cute Cartoon Waterproof PVC Decals For Laptop Guitar Luggage DIY Scrapbooking Doodle Stamping Supplies
like
Find Similar
Stackable cartoon animal stickers for laptops and luggage DIY waterproof 60-piece set - Animal Stacking (WES251)
Stacking Animal Stickers Cute Cartoon Waterproof PVC Decals For Laptop Guitar Luggage DIY Scrapbooking Doodle Stamping Supplies
$0.98
No MOQ
Gothic Purple Aesthetic Stickers Waterproof Vinyl Decal For Laptop Water Bottle Guitar Luggage Scrapbook Journal Dark Fantasy Decor
Gothic Purple Aesthetic Stickers Waterproof Vinyl Decal For Laptop Water Bottle Guitar Luggage Scrapbook Journal Dark Fantasy Decor
like
Find Similar
Gothic purple stickers set featuring fantasy skulls and dark aesthetic mystical patterns - Dark Fantasy Art Style (T01041844)
100pcs purple gothic graffiti stickers for laptop and luggage with dark artistic designs - Gothic Witchcraft Aesthetic (BP-240323-100)
Collection of purple Gothic graffiti stickers featuring skulls, magic balls, and black cats - Purple Mystical Illustration (T01041930)
Gothic Purple Aesthetic Stickers Waterproof Vinyl Decal For Laptop Water Bottle Guitar Luggage Scrapbook Journal Dark Fantasy Decor
$0.92-1.73
Mix MOQ : 5
 · 
11 views
Empty Lip Gloss Tubes Clear Refillable Liquid Lipstick Containers Large Wand Applicator Plastic Cosmetic Packaging
Empty Lip Gloss Tubes Clear Refillable Liquid Lipstick Containers Large Wand Applicator Plastic Cosmetic Packaging
like
Find Similar
Detail of 6ml clear lip gloss tube featuring a black cap and large soft doe foot applicator - 6ml / Black
Detail showing the large brush head and clear 6ml lip glaze tube with pink matte cap - 6ml / Pink
Macro detail of a 6ml clear cosmetic tube with a light blue cap and sponge brush applicator - 6ml / Blue
Macro shot of 6ml transparent lip gloss tube with wide applicator brush on stone stand - 6ml / White
+4
Empty Lip Gloss Tubes Clear Refillable Liquid Lipstick Containers Large Wand Applicator Plastic Cosmetic Packaging
-5%
$0.49
No MOQ
 · 
322 sold recently
Cute Cartoon Duck Stickers Waterproof PVC Decals For Journaling Scrapbooking Laptop Phone Case DIY Decorative Stickers
Cute Cartoon Duck Stickers Waterproof PVC Decals For Journaling Scrapbooking Laptop Phone Case DIY Decorative Stickers
like
Find Similar
100pcs cute cartoon fat duck stickers for DIY laptop phone case and water bottles - Fat Duck Series (100 Sheets/Pack)
Cute Cartoon Duck Stickers Waterproof PVC Decals For Journaling Scrapbooking Laptop Phone Case DIY Decorative Stickers
$0.95
No MOQ
Vintage Retro Antique Object PVC Waterproof Stickers For Laptop Guitar Luggage Water Bottle Scrapbook DIY Decals
Vintage Retro Antique Object PVC Waterproof Stickers For Laptop Guitar Luggage Water Bottle Scrapbook DIY Decals
like
Find Similar
50pcs vintage aesthetic stickers for DIY laptops luggage and water bottles deco - Vintage Western Objects (PMS120)
Vintage Retro Antique Object PVC Waterproof Stickers For Laptop Guitar Luggage Water Bottle Scrapbook DIY Decals
$0.95
No MOQ
Insulated Water Bottle Stainless Steel Vacuum Flask With Straw Lid Portable Handle For Sports Outdoor Gym Travel
Insulated Water Bottle Stainless Steel Vacuum Flask With Straw Lid Portable Handle For Sports Outdoor Gym Travel
like
Find Similar
Navy blue matte 1L insulated sports water bottle with gold metal straw and cleaning brush set - 1 L / 3-Piece Straw Set / Indigo Blue
1L vacuum insulated water bottle in matte yellow and pink with metal straw set - 1 L / 3-Piece Straw Set / Light Pink + Light Yellow
Blue-green gradient 1L stainless steel water bottle with golden straw and brush set - 1 L / 3-Piece Straw Set / Blue Green Gradient
Violet 1L stainless steel sports bottle with yellow lid and reusable gold straw - 1 L / 3-Piece Straw Set / Light Yellow + Purple
+39
Insulated Water Bottle Stainless Steel Vacuum Flask With Straw Lid Portable Handle For Sports Outdoor Gym Travel
$11.38
Mix MOQ : 2
 · 
10 sold recently
World Travel Landmark Stickers PVC Waterproof Retro Graffiti Decals For Suitcase Laptop Water Bottle Fridge Decorative Labels
World Travel Landmark Stickers PVC Waterproof Retro Graffiti Decals For Suitcase Laptop Water Bottle Fridge Decorative Labels
like
Find Similar
50pcs vintage world travel stickers for luggage featuring London, Egypt, and Tokyo designs - World Travel Landmark Style
World Travel Landmark Stickers PVC Waterproof Retro Graffiti Decals For Suitcase Laptop Water Bottle Fridge Decorative Labels
$0.96
No MOQ
Waterproof Cute Animal PVC Stickers For Laptop Luggage Skateboard Helmet Water Bottle Journaling Scrapbooking Decoration
Waterproof Cute Animal PVC Stickers For Laptop Luggage Skateboard Helmet Water Bottle Journaling Scrapbooking Decoration
like
Find Similar
Set of 50 cute cartoon animal and fruit waterproof stickers for laptop and luggage decor - Animal Series
Waterproof Cute Animal PVC Stickers For Laptop Luggage Skateboard Helmet Water Bottle Journaling Scrapbooking Decoration
$0.96
No MOQ
Cute Cartoon Pink Pig Waterproof Stickers For Laptop Luggage Water Bottle Scrapbooking Decoration Animal Stickers
Cute Cartoon Pink Pig Waterproof Stickers For Laptop Luggage Water Bottle Scrapbooking Decoration Animal Stickers
like
Find Similar
Cute pink cartoon pig stickers waterproof PVC decals for luggage and laptop bottles - Pink Pig
Cute Cartoon Pink Pig Waterproof Stickers For Laptop Luggage Water Bottle Scrapbooking Decoration Animal Stickers
-4%
$0.69
No MOQ
Natural Crystal Merkaba Star Wine Bottle Stopper Zinc Alloy Reusable Vacuum Sealer Decorative Champagne Plug Barware Accessory
Natural Crystal Merkaba Star Wine Bottle Stopper Zinc Alloy Reusable Vacuum Sealer Decorative Champagne Plug Barware Accessory
like
Find Similar
Red jasper Merkaba star wine stopper with zinc alloy base and silicone seal - Bloodstone
Ruby in Zoisite crystal star wine bottle stopper with stainless steel and silicone seal - Ruby Zoisite
Green crystal Merkaba star wine stopper with zinc alloy base and silicone seal - India Agate
Tiger eye stone Merkaba star wine bottle stopper with polished metal and silicone seal - Tiger's Eye
+12
Natural Crystal Merkaba Star Wine Bottle Stopper Zinc Alloy Reusable Vacuum Sealer Decorative Champagne Plug Barware Accessory
-4%
$1.84
No MOQ
Free Shipping
Plush Water Bottle Sleeve Sherpa Fleece Cup Carrier Bag With Portable Plaid Handle Cute Cartoon Rabbit Protective Pouch
Plush Water Bottle Sleeve Sherpa Fleece Cup Carrier Bag With Portable Plaid Handle Cute Cartoon Rabbit Protective Pouch
like
Find Similar
Close-up of fluffy yellow lamb wool water bottle bag with checkered strap and cute patch - Yellow
Detail of purple plush water bottle sleeve with red checkered handle and cartoon label - Purple
Brown fuzzy plush water bottle carrier bag with black and white checkered handles - Brown
Pink plush water bottle carrier with a checkered handle and cute cartoon rabbit label - Watermelon red
+3
Plush Water Bottle Sleeve Sherpa Fleece Cup Carrier Bag With Portable Plaid Handle Cute Cartoon Rabbit Protective Pouch
$2.28
No MOQ
Cute Cartoon Animal Stickers Waterproof PVC Stickers For Luggage Phone Case Laptop Helmet DIY Decoration Stationery Stickers
Cute Cartoon Animal Stickers Waterproof PVC Stickers For Luggage Phone Case Laptop Helmet DIY Decoration Stationery Stickers
like
Find Similar
60Pcs colorful cartoon animal stickers set for luggage and helmet with cute animal designs - Cartoon Animal Collection
Cute Cartoon Animal Stickers Waterproof PVC Stickers For Luggage Phone Case Laptop Helmet DIY Decoration Stationery Stickers
$0.95
No MOQ
Creative Wine Glass Lead Free Glass Goblet For Party Romantic Heart Shape Flamingo And Rose Design Unique Barware
Creative Wine Glass Lead Free Glass Goblet For Party Romantic Heart Shape Flamingo And Rose Design Unique Barware
like
Find Similar
200ML molecular cocktail glass with pink rose inner design and green stem detail - 200ml / Rose Wine Glass - Round Pink
Pink rose shape double wall glass with green stem in hexagonal outer frame - 200ml / Rose Wine Glass - Hexagon Pink
Elegant heart-shaped wine glass featuring an internal blue rose with green stem detail - 200ml / Rose Wine Glass - Hexagon Blue
Creative rose flower shaped double wall glass with green stem and red liquid cocktail interior - 200ml / Rose Wine Glass - Round Purple
+5
Creative Wine Glass Lead Free Glass Goblet For Party Romantic Heart Shape Flamingo And Rose Design Unique Barware
$3.60-13.83
No MOQ
 · 
100 views
Bohemian Camping Aesthetic Stickers Waterproof Outdoor Vinyl Graffiti Decals For Laptop Suitcase Fridge Decoration Multicolor Illustrative Art Stickers
Bohemian Camping Aesthetic Stickers Waterproof Outdoor Vinyl Graffiti Decals For Laptop Suitcase Fridge Decoration Multicolor Illustrative Art Stickers
like
Find Similar
50pcs waterproof outdoor camping aesthetic stickers with colorful artistic doodle designs - Fun Camping Aesthetic Graffiti (DD232)
Bohemian Camping Aesthetic Stickers Waterproof Outdoor Vinyl Graffiti Decals For Laptop Suitcase Fridge Decoration Multicolor Illustrative Art Stickers
$0.95
No MOQ
Gothic Mysterious Occult Stickers Waterproof PVC Matte Decorative Decals For Laptop Scrapbooking Journal Stationery DIY Crafts
Gothic Mysterious Occult Stickers Waterproof PVC Matte Decorative Decals For Laptop Scrapbooking Journal Stationery DIY Crafts
like
Find Similar
Gothic mystic journey stickers with gold foil moon phase and zodiac patterns for DIY decor - Waterproof Adhesive
Gothic Mysterious Occult Stickers Waterproof PVC Matte Decorative Decals For Laptop Scrapbooking Journal Stationery DIY Crafts
$0.86
No MOQ
 · 
30 views
Sports Shaker Bottle PP Plastic Leakproof Protein Powder Mixing Cup With Stirring Ball And Scale For Fitness Gym Workout Portable Drinking Vessel
Sports Shaker Bottle PP Plastic Leakproof Protein Powder Mixing Cup With Stirring Ball And Scale For Fitness Gym Workout Portable Drinking Vessel
like
Find Similar
Yellow protein shaker bottle set with mixing ball and scale on wooden table - 500ml / Yellow
Pink and white protein shaker bottle with mixing ball for fitness and sports gym use - 500ml / Pink
Sports Shaker Bottle PP Plastic Leakproof Protein Powder Mixing Cup With Stirring Ball And Scale For Fitness Gym Workout Portable Drinking Vessel
$1.21-1.38
No MOQ
Portable Insulated Soup Cup 304 Stainless Steel Thermal Breakfast Jar With Silicone Handle For Office School
Portable Insulated Soup Cup 304 Stainless Steel Thermal Breakfast Jar With Silicone Handle For Office School
like
Find Similar
Mint green 304 stainless steel soup cup with handle and delicious lettering design - 304 Stainless Steel / 430ml Stainless Steel Haze Blue
Pink portable 304 stainless steel insulated soup mug with handle and matte finish - 304 Stainless Steel / 430ml Stainless Steel Sakura Pink
Green 304 stainless steel insulated soup cup with handle and DELICIOUS lettering - 304 Stainless Steel / 430ml Stainless Steel Matcha Green
Portable blue 304 stainless steel breakfast soup cup with PP liner and handle - PP / 380ml Plastic Haze Blue
+2
Portable Insulated Soup Cup 304 Stainless Steel Thermal Breakfast Jar With Silicone Handle For Office School
$2.54-4.01
No MOQ
 · 
47 views
Waterproof PVC Astronaut Space Stickers Set For Laptop Water Bottle Skateboard Luggage Space Exploration Decor DIY Decorative Decals
Waterproof PVC Astronaut Space Stickers Set For Laptop Water Bottle Skateboard Luggage Space Exploration Decor DIY Decorative Decals
like
Find Similar
Cartoon astronaut space adventure waterproof sticker with NASA themed dream galaxy design - T01040342 50 Astronauts
Waterproof PVC Astronaut Space Stickers Set For Laptop Water Bottle Skateboard Luggage Space Exploration Decor DIY Decorative Decals
$0.88
Mix MOQ : 2
Insulated Tumbler Stainless Steel Vacuum Flask With Handle Straw Dual Drinking Lid Cute Cartoon Portable Travel Cup
Insulated Tumbler Stainless Steel Vacuum Flask With Handle Straw Dual Drinking Lid Cute Cartoon Portable Travel Cup
like
Find Similar
Large cream insulated tumbler with pink and blue stripes and a cute dog illustration - Off-White Pink Blue Stripes - Happy Day Dog
Pink and white checkered stainless steel travel tumbler with cute bunny and heart patterns - White Pink Grid - Cherry Rabbit
Large vacuum flask with red strawberry grid pattern, straw lid, and portable handle - Red White Grid - Happy Strawberry
Cream white insulated tumbler with blue lid, straw handle and cute black cat print - Blue White Grid - Good Luck Cat
+2
Insulated Tumbler Stainless Steel Vacuum Flask With Handle Straw Dual Drinking Lid Cute Cartoon Portable Travel Cup
$7.35
No MOQ
 · 
22 views
Portable Rectangular Flat Water Bottle Plastic Leakproof Lightning Bolt Design With Adjustable Shoulder Strap For Outdoor
Portable Rectangular Flat Water Bottle Plastic Leakproof Lightning Bolt Design With Adjustable Shoulder Strap For Outdoor
like
Find Similar
Pink rectangular plastic water bottle with lightning pattern and adjustable crossbody strap - 450ml / Girl Pink
Detail of blue rectangular plastic water bottle with lightning pattern and shoulder strap - 450ml / Ice Blue
Detail of purple square plastic water bottle with adjustable strap held outdoors - 450ml / Dreamy Purple
Detail of durable zinc alloy hooks and patterned strap on a yellow rectangular water bottle - 450ml / Light Orange Yellow
+1
Portable Rectangular Flat Water Bottle Plastic Leakproof Lightning Bolt Design With Adjustable Shoulder Strap For Outdoor
-5%
$3.97
Mix MOQ : 2
 · 
42 views
High Borosilicate Glass Cup Heat Resistant Stop Anxiety Print Cartoon Dog Cat Flared Rim Minimalist Aesthetic Water Drinkware
High Borosilicate Glass Cup Heat Resistant Stop Anxiety Print Cartoon Dog Cat Flared Rim Minimalist Aesthetic Water Drinkware
like
Find Similar
500ml high borosilicate glass cup featuring a sleeping puppy and Stop Anxiety print - 500ml / Single Cup / Black Letter Dog
500ML heat-resistant glass cup with straw featuring a sleepy puppy and milk inside - 500ml / With Glass Straw / Black Letter Dog
500ml high borosilicate glass cup with cat print and straw for cold coffee - 500ml / With Glass Straw / White Letter Cat
Minimalist 500ml glass cup with straw featuring cute cartoon dog and cat line art graphics - 500ml / Set of 2 with Straws / Black and White Set
+2
High Borosilicate Glass Cup Heat Resistant Stop Anxiety Print Cartoon Dog Cat Flared Rim Minimalist Aesthetic Water Drinkware
$1.96-4.09
No MOQ
 · 
35 views
Supercar Racing Stickers Waterproof PVC Vinyl Graffiti Decals For Laptop Skateboard Luggage Motorcycle DIY Decoration For Boys Kids
Supercar Racing Stickers Waterproof PVC Vinyl Graffiti Decals For Laptop Skateboard Luggage Motorcycle DIY Decoration For Boys Kids
like
Find Similar
Macro detail of waterproof PVC racing car graffiti stickers with colorful supercar designs - Supercar Racing Style (T01040450)
Supercar Racing Stickers Waterproof PVC Vinyl Graffiti Decals For Laptop Skateboard Luggage Motorcycle DIY Decoration For Boys Kids
$0.96
Mix MOQ : 2
Mineral Crystal Coffee Mug Synthetic Resin Stainless Steel Liner 3D Agate Pattern Tea Cup Geode Style Handmade Drinkware
Mineral Crystal Coffee Mug Synthetic Resin Stainless Steel Liner 3D Agate Pattern Tea Cup Geode Style Handmade Drinkware
like
Find Similar
Unique natural purple mineral crystal coffee mug on wooden table with warm bokeh lights - Dreamy Purple
Detail of green crystal mineral coffee mug with gold rim on a rustic wooden table - Dark Green
Close-up of mineral crystal coffee mug with colorful agate textures and rising steam - Volcanic Red
Creative 3D relief crystal coffee mug with blue gradient mountain texture and handle - Gradient Blue
+7
Mineral Crystal Coffee Mug Synthetic Resin Stainless Steel Liner 3D Agate Pattern Tea Cup Geode Style Handmade Drinkware
$5.48
No MOQ
 · 
51 sold recently
Creative Grape Bubble Textured Glass Mug High Borosilicate Heat Resistant Transparent Coffee Cup With Handle Ins Style
Creative Grape Bubble Textured Glass Mug High Borosilicate Heat Resistant Transparent Coffee Cup With Handle Ins Style
like
Find Similar
Grape-shaped heat resistant borosilicate glass coffee mug with round bubble design - 350ml / Grape Cup With Handle
Artistic bubble-textured heat-resistant glass cup with handle for coffee and latte - 350ml / Grape Cup (No Handle)
Creative Grape Bubble Textured Glass Mug High Borosilicate Heat Resistant Transparent Coffee Cup With Handle Ins Style
$0.86-1.15
Mix MOQ : 2
 · 
68 views
304 Stainless Steel Vacuum Insulated Bottle Rhinestone Encrusted Bling Thermos With Artificial Pearl Handle Portable Luxury Flask
304 Stainless Steel Vacuum Insulated Bottle Rhinestone Encrusted Bling Thermos With Artificial Pearl Handle Portable Luxury Flask
like
Find Similar
300ml sparkling diamond insulated stainless steel water bottle with pearl strap detail - Silver
300ml rhinestone diamond vacuum insulated bottle with stainless steel lid and pearl chain - Black
300ml gold rhinestone insulated tumbler with silver lid and white pearl handle strap - Gold
Close-up of 300ml leopard print rhinestone insulated bottle with a pearl handle strap - Leopard Pink
+5
304 Stainless Steel Vacuum Insulated Bottle Rhinestone Encrusted Bling Thermos With Artificial Pearl Handle Portable Luxury Flask
$5.19-6.34
No MOQ
 · 
14 sold recently
Colorful Letter Number Stickers Waterproof Vinyl Mini Alphabet Decals For DIY Scrapbooking Journaling Planner Decor Cards
Colorful Letter Number Stickers Waterproof Vinyl Mini Alphabet Decals For DIY Scrapbooking Journaling Planner Decor Cards
like
Find Similar
Black alphabet and number stickers for scrapbooking with 0.5 inch height dimensions - Black
Semi-transparent 0.5 inch alphabet and number sticker sheet for scrapbooking - White
0.5 inch alphabet and number stickers for scrapbooking with precise size measurements - Multicolor
0.5-inch pastel alphabet and number stickers in macaron colors for scrapbooking - Morandi Color
+11
Colorful Letter Number Stickers Waterproof Vinyl Mini Alphabet Decals For DIY Scrapbooking Journaling Planner Decor Cards
-9%
$0.10
Mix MOQ : 10
 · 
130 sold recently
Cute Cartoon Hawaii Style Waterproof Stickers For DIY Scrapbook Skateboard Luggage Cup Waterproof PVC Decoration Decals
Cute Cartoon Hawaii Style Waterproof Stickers For DIY Scrapbook Skateboard Luggage Cup Waterproof PVC Decoration Decals
like
Find Similar
Set of 49 cartoon Hawaii style waterproof stickers with cute animal and flower designs - 49 Sheets Per Pack (WES076)
Cute Cartoon Hawaii Style Waterproof Stickers For DIY Scrapbook Skateboard Luggage Cup Waterproof PVC Decoration Decals
$0.96
No MOQ
Airtight Food Storage Containers Transparent Plastic Kitchen Sealed Jars For Grains Cereal Snacks Stackable Refrigerator Organizer
Airtight Food Storage Containers Transparent Plastic Kitchen Sealed Jars For Grains Cereal Snacks Stackable Refrigerator Organizer
like
Find Similar
350ml square transparent plastic food storage container with white lid for cereal - 350ml / White Flap
350ml square transparent plastic airtight food storage container for grains and seeds - 350ml / Transparent Lid
650ml square plastic food storage container with white airtight lid for dry grains - 650ml / White Flap
650ml square transparent plastic food storage container for grains and snacks - 650ml / Transparent Lid
+3
Airtight Food Storage Containers Transparent Plastic Kitchen Sealed Jars For Grains Cereal Snacks Stackable Refrigerator Organizer
$0.13-0.35
No MOQ
 · 
735 sold recently
Korean INS Style Quilted Cotton Water Bottle Sleeve Bag With Adjustable Strap Embroidered Animal Bear Rabbit For Kids
Korean INS Style Quilted Cotton Water Bottle Sleeve Bag With Adjustable Strap Embroidered Animal Bear Rabbit For Kids
like
Find Similar
Quilted white canvas bottle bag with bear embroidery and adjustable beige shoulder strap - White/Black Bear
Grey quilted water bottle bag with embroidered white bear face and adjustable strap - Grey/White Bear
Detail of white quilted cotton bottle holder with cute brown teddy bear embroidery - White/Brown Bear
Quilted white cotton bottle bag with cute teddy bear embroidery and adjustable strap - White/Beige Bear
+15
Korean INS Style Quilted Cotton Water Bottle Sleeve Bag With Adjustable Strap Embroidered Animal Bear Rabbit For Kids
$5.19
No MOQ
 · 
27 views
Stainless Steel Vacuum Insulated Tumbler With Tritan Boba Straw Magnetic Handle Leak Proof Travel Water Bottle Mug
Stainless Steel Vacuum Insulated Tumbler With Tritan Boba Straw Magnetic Handle Leak Proof Travel Water Bottle Mug
like
Find Similar
Detail of 830ml tumbler featuring a 1.2cm wide Tritan straw and magnetic handle - 830ml / Milk Tea
Detail of 830ml burgundy flask with 1.2cm Tritan straw and magnetic handle - 830ml / Smoky Pink
Detail of 1.2cm wide Tritan straw and magnetic handle for 830ml insulated tumbler - 830ml / Dark Gray
Detailed view of 830ml bottle with 1.2cm wide straw and cleaning brush set - 830ml / Indigo Blue
+24
Stainless Steel Vacuum Insulated Tumbler With Tritan Boba Straw Magnetic Handle Leak Proof Travel Water Bottle Mug
$12.39
Mix MOQ : 2
Waterproof Cartoon Candy Dessert Stationery Stickers PVC Decals For Water Bottle Laptop Suitcase Scrapbook DIY Decoration
Waterproof Cartoon Candy Dessert Stationery Stickers PVC Decals For Water Bottle Laptop Suitcase Scrapbook DIY Decoration
like
Find Similar
Detail showing dimension and cupcake design of these waterproof cartoon candy stickers - Cartoon Candy Dessert Theme (T01043202)
Waterproof Cartoon Candy Dessert Stationery Stickers PVC Decals For Water Bottle Laptop Suitcase Scrapbook DIY Decoration
$0.86
Mix MOQ : 5
Cartoon Reptile Amphibian Waterproof PVC Stickers For Water Bottle Laptop Luggage DIY Scrapbook Graffiti Decals For Kids Teens
Cartoon Reptile Amphibian Waterproof PVC Stickers For Water Bottle Laptop Luggage DIY Scrapbook Graffiti Decals For Kids Teens
like
Find Similar
50-piece set of colorful waterproof cartoon reptile and amphibian stickers for DIY decoration - Reptile Collection (TT296)
Cartoon Reptile Amphibian Waterproof PVC Stickers For Water Bottle Laptop Luggage DIY Scrapbook Graffiti Decals For Kids Teens
$0.95
No MOQ
Shell Shaped Silicone Soap Dish Self Draining Non-Slip Holder For Bathroom Shower And Kitchen Sink Flexible Tray
Shell Shaped Silicone Soap Dish Self Draining Non-Slip Holder For Bathroom Shower And Kitchen Sink Flexible Tray
like
Find Similar
Shell-shaped ivory silicone soap dish with non-slip drainage texture for bathroom - Shell Style / Creamy White
Light yellow scallop-shaped silicone soap dish with radial drainage grooves - Shell Style / Milky Yellow
Detail of light green shell shaped silicone soap dish with non-slip drainage ridges - Shell Style / Milky Green
Sky blue shell-shaped silicone soap dish with a minimalist self-draining design for bathroom - Shell Style / Milky Blue
+3
Shell Shaped Silicone Soap Dish Self Draining Non-Slip Holder For Bathroom Shower And Kitchen Sink Flexible Tray
$0.86-1.73
No MOQ
 · 
405 sold recently
Vintage Stamp Stickers PVC Matte Waterproof Floral Butterfly Bird Nature Aesthetic Decals For Laptop Luggage Decoration
Vintage Stamp Stickers PVC Matte Waterproof Floral Butterfly Bird Nature Aesthetic Decals For Laptop Luggage Decoration
like
Find Similar
50pcs vintage botanical and butterfly stamp stickers for laptops and journals - Vintage Stamps (50 Sheets)
Vintage Stamp Stickers PVC Matte Waterproof Floral Butterfly Bird Nature Aesthetic Decals For Laptop Luggage Decoration
$0.96
No MOQ
 · 
18 views
Waterproof Cartoon Stickers Variety For Kids Baby Cognition Learning PVC Matte DIY Decals For Laptop Luggage Fridge Decor
Waterproof Cartoon Stickers Variety For Kids Baby Cognition Learning PVC Matte DIY Decals For Laptop Luggage Fridge Decor
like
Find Similar
90pcs waterproof cartoon stickers set for baby cognition laptops and luggage decoration - Cartoon Cognition Series
Waterproof Cartoon Stickers Variety For Kids Baby Cognition Learning PVC Matte DIY Decals For Laptop Luggage Fridge Decor
$1.27
No MOQ
Waterproof Pvc Sticker Decals For Laptop Luggage Water Bottle Retro Cartoon Aesthetic Decorative Accessory For Daily Use
Waterproof Pvc Sticker Decals For Laptop Luggage Water Bottle Retro Cartoon Aesthetic Decorative Accessory For Daily Use
like
Find Similar
Vibrant set of 50 vintage-style waterproof stickers for luggage and laptops with pop art designs - Default
Waterproof Pvc Sticker Decals For Laptop Luggage Water Bottle Retro Cartoon Aesthetic Decorative Accessory For Daily Use
$1.30
No MOQ
Wall Mounted Flip Lid Storage Box Plastic Transparent Makeup Cotton Swab Organizer For Bathroom Office No Drill Minimalist
Wall Mounted Flip Lid Storage Box Plastic Transparent Makeup Cotton Swab Organizer For Bathroom Office No Drill Minimalist
like
Find Similar
Detail of wall-mounted flip-top storage boxes with clear panels for cotton pads and swabs - Simple White
Wall Mounted Flip Lid Storage Box Plastic Transparent Makeup Cotton Swab Organizer For Bathroom Office No Drill Minimalist
-5%
$0.34
No MOQ
 · 
22 sold recently
Realistic Animal Waterproof PVC Stickers For Kids Skateboard Laptop Scrapbooking Decorative DIY Animal Decals
Realistic Animal Waterproof PVC Stickers For Kids Skateboard Laptop Scrapbooking Decorative DIY Animal Decals
like
Find Similar
Set of 50 realistic animal stickers with waterproof PVC material for kids' skateboards - List T01040603-1: 50 Watercolor Animal Prints
Realistic Animal Waterproof PVC Stickers For Kids Skateboard Laptop Scrapbooking Decorative DIY Animal Decals
$0.95
Mix MOQ : 2
 · 
15 views
Creative White Ceramic Mug Irregular Wave Rim Coffee Cup With Handle Microwave Safe Porcelain Water Cup 430ml Modern Drinkware
Creative White Ceramic Mug Irregular Wave Rim Coffee Cup With Handle Microwave Safe Porcelain Water Cup 430ml Modern Drinkware
like
Find Similar
Minimalist white ceramic mug with unique wavy rim and curved handle for coffee - 430ml Smile Mug
Creative White Ceramic Mug Irregular Wave Rim Coffee Cup With Handle Microwave Safe Porcelain Water Cup 430ml Modern Drinkware
-4%
$2.90
Mix MOQ : 2
50Pcs Cute Ghost Food Drink Stickers Waterproof PVC Cartoon Doodle Decals For Luggage Laptop Skateboard Fridge Halloween Decoration
50Pcs Cute Ghost Food Drink Stickers Waterproof PVC Cartoon Doodle Decals For Luggage Laptop Skateboard Fridge Halloween Decoration
like
Find Similar
Detailed collection of creative cute ghost food and drink stickers in grid layout - 50 Sheets/Pack
50Pcs Cute Ghost Food Drink Stickers Waterproof PVC Cartoon Doodle Decals For Luggage Laptop Skateboard Fridge Halloween Decoration
-10%
$0.86
No MOQ
Cute Cartoon Animal Big Eyes Stickers Waterproof DIY Decorative Decals For Water Bottle Laptop Suitcase Scrapbook Kids
Cute Cartoon Animal Big Eyes Stickers Waterproof DIY Decorative Decals For Water Bottle Laptop Suitcase Scrapbook Kids
like
Find Similar
Set of 50 cute cartoon animal stickers for water bottles, laptops and luggage rewards - Cartoon Big Eyes Style (T01040527-1)
NewCute Cartoon Animal Big Eyes Stickers Waterproof DIY Decorative Decals For Water Bottle Laptop Suitcase Scrapbook Kids
$0.95
Mix MOQ : 2
Short Stemmed Cocktail Glass Frosted Crystal Glass Flower Base Gradient Ribbed Cup For Ice Cream Dessert Drinkware
Short Stemmed Cocktail Glass Frosted Crystal Glass Flower Base Gradient Ribbed Cup For Ice Cream Dessert Drinkware
like
Find Similar
Green ribbed glass goblet with pink petal base, 225ml capacity for cocktails - Bright Green
Pink fluted cocktail glass with green flower base, 225ml handmade glass goblet - Bright Pink
Frosted gradient pink petal glass cup with floral base for cocktails and desserts - White Peach
Frosted mint green glass goblet with white flower shaped base and 225ml capacity - Mint Green
+4
Short Stemmed Cocktail Glass Frosted Crystal Glass Flower Base Gradient Ribbed Cup For Ice Cream Dessert Drinkware
$2.77-3.46
No MOQ
 · 
53 views
Aesthetic Western Cartoon Graffiti Stickers For Laptop Suitcase Skateboard Water Cup Waterproof PVC Printed Decals Psychedelic Art Y2K Style
Aesthetic Western Cartoon Graffiti Stickers For Laptop Suitcase Skateboard Water Cup Waterproof PVC Printed Decals Psychedelic Art Y2K Style
like
Find Similar
50pcs Psychedelic Y2K Aesthetic PVC Stickers for Luggage and Laptop in Vivid Purple Tones - 50 Different Pieces (JXZ-DD188)
Aesthetic Western Cartoon Graffiti Stickers For Laptop Suitcase Skateboard Water Cup Waterproof PVC Printed Decals Psychedelic Art Y2K Style
$0.96
No MOQ
Kawaii Cartoon Candy Small Items Stickers Waterproof PVC Aesthetic Decals For Laptop Guitar Luggage DIY Journaling Stationery Stickers
Kawaii Cartoon Candy Small Items Stickers Waterproof PVC Aesthetic Decals For Laptop Guitar Luggage DIY Journaling Stationery Stickers
like
Find Similar
50 pieces of waterproof Kawaii candy cartoon stickers for laptops and DIY decoration - Cartoon Candy Items
Kawaii Cartoon Candy Small Items Stickers Waterproof PVC Aesthetic Decals For Laptop Guitar Luggage DIY Journaling Stationery Stickers
$0.98
No MOQ
Cute Cartoon Animal Stickers 3D Style Waterproof Vinyl Decals For Laptop Luggage Water Bottle Scrapbook DIY Journaling Stickers
Cute Cartoon Animal Stickers 3D Style Waterproof Vinyl Decals For Laptop Luggage Water Bottle Scrapbook DIY Journaling Stickers
like
Find Similar
Close-up of cute 3D tiger sticker showing precise 5cm dimensions for DIY laptop decor - Animal Mixed Style (BP-1493+1286)
Set of 49 cute 3D cartoon animal stickers for DIY luggage and laptop decoration - Cute Animal Style (T01041493)
Collection of 100 cute 3D cartoon animal stickers for DIY luggage and laptop decoration - Q-Version Animal Style (T01041286)
Cute Cartoon Animal Stickers 3D Style Waterproof Vinyl Decals For Laptop Luggage Water Bottle Scrapbook DIY Journaling Stickers
$0.95-1.73
Mix MOQ : 5
Cartoon Penguin Stickers Waterproof Vinyl Decals For Water Bottle Laptop Phone Skateboard Guitar Cute Animal DIY Decoration Pack
Cartoon Penguin Stickers Waterproof Vinyl Decals For Water Bottle Laptop Phone Skateboard Guitar Cute Animal DIY Decoration Pack
like
Find Similar
50 pieces of cute waterproof cartoon penguin stickers for kids laptop and water bottle decor - Cute Penguin (T01041402)
Cartoon Penguin Stickers Waterproof Vinyl Decals For Water Bottle Laptop Phone Skateboard Guitar Cute Animal DIY Decoration Pack
$0.95
Mix MOQ : 2
Transparent Iridescent Bubble Stickers Waterproof PET Watercolor Aesthetic Decals For Scrapbooking Laptop DIY Decor
Transparent Iridescent Bubble Stickers Waterproof PET Watercolor Aesthetic Decals For Scrapbooking Laptop DIY Decor
like
Find Similar
50 pieces of iridescent clear bubble stickers made of waterproof PET for journal decorating - Transparent Watercolor Bubbles
NewTransparent Iridescent Bubble Stickers Waterproof PET Watercolor Aesthetic Decals For Scrapbooking Laptop DIY Decor
$1.04
No MOQ
Alphabet Number Stickers DIY Decorative Self Adhesive Labels Colorful Large Letter Decals For Scrapbooking Mailbox Door
Alphabet Number Stickers DIY Decorative Self Adhesive Labels Colorful Large Letter Decals For Scrapbooking Mailbox Door
like
Find Similar
Multiple sheets of DIY alphabet and number stencils featuring uppercase letters and symbols - 29*21cm / White
Alphabet Number Stickers DIY Decorative Self Adhesive Labels Colorful Large Letter Decals For Scrapbooking Mailbox Door
$0.14
Mix MOQ : 10
 · 
67 sold recently
Cute Cartoon Capybara Waterproof Stickers Set For Laptop Luggage Guitar Water Bottle Phone DIY Graffiti Decals Gift For Kids
Cute Cartoon Capybara Waterproof Stickers Set For Laptop Luggage Guitar Water Bottle Phone DIY Graffiti Decals Gift For Kids
like
Find Similar
Pack of 50 waterproof cartoon capybara stickers in diverse fun poses for luggage and laptop - Cartoon Capybara Series (T01042670)
Cute Cartoon Capybara Waterproof Stickers Set For Laptop Luggage Guitar Water Bottle Phone DIY Graffiti Decals Gift For Kids
$0.86
Mix MOQ : 2
Disposable Drinking Straws Plastic Individually Wrapped Flexible Bendable Food Grade For Milk Juice Drinks
Disposable Drinking Straws Plastic Individually Wrapped Flexible Bendable Food Grade For Milk Juice Drinks
like
Find Similar
50-piece pack of individually wrapped colorful striped flexible plastic straws for kids - Mixed Colored Straight Straws (50 Pcs)
Pack of 100 milky white flexible plastic straws, 20cm length and 0.5cm diameter size - Milky White Flexible Straws (100 Pcs Bag)
Pack of 100 flexible disposable plastic straws, 20cm long with clear bendable design - Transparent Flexible Straws (100 Pcs Bag)
Pack of 300 individually wrapped clear flexible plastic straws in 20cm length - Transparent Flexible Straws (300 Pcs Box)
Disposable Drinking Straws Plastic Individually Wrapped Flexible Bendable Food Grade For Milk Juice Drinks
$0.15-1.87
No MOQ
 · 
23 views
Hand-painted Ceramic Mug Irregular Shape Cute Cartoon Strawberry Tiger Fruit Pattern Heat Resistant Breakfast Coffee Cup
Hand-painted Ceramic Mug Irregular Shape Cute Cartoon Strawberry Tiger Fruit Pattern Heat Resistant Breakfast Coffee Cup
like
Find Similar
Close-up of hand-held stackable ceramic mugs with hand-painted yellow floral and black stripes - Yellow Floral
Detail of hand-painted strawberry ceramic mug with wavy rim and chunky handle - Strawberry Small Flower
Cute hand-pinched orange ceramic mug with cartoon tiger pattern and large round handle - Orange Tiger
Detail showing the blue checkered pattern and red smiley flower on a white ceramic mug - Plaid Tulip
+2
Hand-painted Ceramic Mug Irregular Shape Cute Cartoon Strawberry Tiger Fruit Pattern Heat Resistant Breakfast Coffee Cup
-4%
$5.48
Mix MOQ : 2
 · 
45 sold recently
Summer Fresh Pink Blue Coastal Cowgirl DIY Stickers Waterproof PVC Vinyl Aesthetic Decals For Laptop Phone Skateboard Journal Scrapbooking
Summer Fresh Pink Blue Coastal Cowgirl DIY Stickers Waterproof PVC Vinyl Aesthetic Decals For Laptop Phone Skateboard Journal Scrapbooking
like
Find Similar
Flat lay of pink and blue coastal cowgirl stickers featuring shells and cowboy boots - Ocean Coastal Theme / 100 Sheets
Summer Fresh Pink Blue Coastal Cowgirl DIY Stickers Waterproof PVC Vinyl Aesthetic Decals For Laptop Phone Skateboard Journal Scrapbooking
$1.72
No MOQ
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access