Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Women Striped Seersucker Tote Bag Large Capacity Shoulder Handbag With Lace Bow Decoration Sweet Korean Style Daily Bag
Women Striped Seersucker Tote Bag Large Capacity Shoulder Handbag With Lace Bow Decoration Sweet Korean Style Daily Bag
like
Find Similar
Blue and white seersucker tote bag with white lace bow detail worn by a model - Light Blue Stripe
Green and white striped canvas tote bag with delicate lace bow for women - Green Stripe
Blue checkered canvas tote bag with a white lace bow detail for casual commuting wear - Black Fine Stripes
Sweet pink and white striped canvas tote bag with lace trim and bow knot detail - Pink Fine Stripe
+1
Women Striped Seersucker Tote Bag Large Capacity Shoulder Handbag With Lace Bow Decoration Sweet Korean Style Daily Bag
$3.69
No MOQ
Funny Data Analyst Acrylic Retractable Badge Reel Alligator Clip ID Holder For Nurse Office Worker Creative Swivel Design
Funny Data Analyst Acrylic Retractable Badge Reel Alligator Clip ID Holder For Nurse Office Worker Creative Swivel Design
like
Find Similar
Macro detail of acrylic badge reel with coffee graphic and retractable cord mechanism - Coffee And Analytics (1)
Detail of retractable badge reel with spreadsheet design and acrylic inspirational panel - Excelling Spreadsheets (2)
Handheld acrylic retractable badge reel with CY-HER SECURITY print and crocodile clip - Cy-Her Security (3)
Detail showing retractable badge reel with acrylic quote plate and alligator clip - Men Lie Numbers Don't (4)
Funny Data Analyst Acrylic Retractable Badge Reel Alligator Clip ID Holder For Nurse Office Worker Creative Swivel Design
$1.01
Mix MOQ : 2
 · 
16 views
Quilted Tote Bag PU Leather Large Capacity With Small Pouch Flower Pattern Commute Shoulder Handbag For Women
Quilted Tote Bag PU Leather Large Capacity With Small Pouch Flower Pattern Commute Shoulder Handbag For Women
like
Find Similar
Black quilted tote bag with floral embroidery and matching mini coin purse detail - Large Tote + Matching Pouch / Black
Quilted tote bag set in coffee brown faux leather with embossed floral patterns - Large Tote + Matching Pouch / Brown
Chic quilted cream tote bag with floral embossing and matching mini zipper pouch - Large Tote + Matching Pouch / Light Pink
Beige quilted tote bag with floral patterns and matching small pouch for daily commute - Large Tote + Matching Pouch / Khaki
Quilted Tote Bag PU Leather Large Capacity With Small Pouch Flower Pattern Commute Shoulder Handbag For Women
$9.80
No MOQ
Camellia Flower Phone Grip Holder Elegant Faux Artificial Pearl Rhinestone Expandable Kickstand Luxury Metal Socket For Smartphones
Camellia Flower Phone Grip Holder Elegant Faux Artificial Pearl Rhinestone Expandable Kickstand Luxury Metal Socket For Smartphones
like
Find Similar
Detailed view of luxury metal pearl flower phone grip stand on a white smartphone - White
Detailed close-up of a pink floral phone grip with elegant pearls and enamel petals - Pink
Elegant black enamel flower phone socket with gold edges and pearl center on magazine - Black
Camellia Flower Phone Grip Holder Elegant Faux Artificial Pearl Rhinestone Expandable Kickstand Luxury Metal Socket For Smartphones
-8%
$1.23
No MOQ
Minimalist Large Capacity Tote Bag PU Leather Lychee Pattern With Satin Scarf Decor Shoulder Handbag For Women
Minimalist Large Capacity Tote Bag PU Leather Lychee Pattern With Satin Scarf Decor Shoulder Handbag For Women
like
Find Similar
Classic black leather tote bag with printed silk scarf handle and spacious design - Black
Minimalist beige tote bag in lychee leather texture with a blue and white decorative scarf - White
Brown faux leather tote bag with vintage printed silk scarf and fine pebble texture - Brown
Deep brown large tote bag with lychee texture and blue floral scarf decoration - Brown
Minimalist Large Capacity Tote Bag PU Leather Lychee Pattern With Satin Scarf Decor Shoulder Handbag For Women
$4.18
No MOQ
Cartoon Bear Donut Resin Decor Phone Case With Black Silicone Wristband Anti Fall TPU Full Coverage Shell Cute Cream Style
Cartoon Bear Donut Resin Decor Phone Case With Black Silicone Wristband Anti Fall TPU Full Coverage Shell Cute Cream Style
like
Find Similar
Detail of soft pink silicone phone case featuring 3D bear, donut charms and black wrist strap - iPhone 7/8/SE 2020 / Honey Bear (Khaki)
Close-up of beige iPhone case with 3D resin bear and donut charms and silicone wrist strap - iPhone 7/8/SE 2020 / Bread Bear (Khaki)
+30
Cartoon Bear Donut Resin Decor Phone Case With Black Silicone Wristband Anti Fall TPU Full Coverage Shell Cute Cream Style
-9%
$1.57
No MOQ
Foldable Phone Case For Samsung Galaxy Z Flip With 3D Bear Coffee Charm Large Bead Hand Chain Strap Textured PC Shell
Foldable Phone Case For Samsung Galaxy Z Flip With 3D Bear Coffee Charm Large Bead Hand Chain Strap Textured PC Shell
like
Find Similar
Detail of Galaxy Z Flip case with black bead chain, 3D bear charm and coffee cup motif - White / Samsung ZFlip3
Detail of Samsung Z Flip case with 3D teddy bear charm and black beaded handle strap - Black / Samsung ZFlip3
+28
Foldable Phone Case For Samsung Galaxy Z Flip With 3D Bear Coffee Charm Large Bead Hand Chain Strap Textured PC Shell
-9%
$2.88
No MOQ
Sweet Colorful Zircon Stud Earrings With Stainless Steel Earring Post Cute Fruit Strawberry Grape Piercing Jewelry For Women
Sweet Colorful Zircon Stud Earrings With Stainless Steel Earring Post Cute Fruit Strawberry Grape Piercing Jewelry For Women
like
Find Similar
Screw back heart fruit ear stud with red heart crystal and green leaf gemstones - Strawberry (EGD0003)
Grape shape stud earring with purple cubic zirconia and gold ball back closure - Grape (EGD0008)
Golden cherry stud earring with pink zircon fruits and green leaf stone and ball screw back - Cherry (EGD0012)
Detailed macro of gold cloud tassel earring with purple and blue zircon crystals - Cloud Tassel (EGD0064)
+11
Sweet Colorful Zircon Stud Earrings With Stainless Steel Earring Post Cute Fruit Strawberry Grape Piercing Jewelry For Women
-5%
$0.75-1.29
No MOQ
 · 
118 sold recently
Free Shipping
Kawaii Stereoscopic Cartoon Bear Folding Phone Case Faux Leather Litchi Texture With Braided Lanyard And Stand For Women
Kawaii Stereoscopic Cartoon Bear Folding Phone Case Faux Leather Litchi Texture With Braided Lanyard And Stand For Women
like
Find Similar
Detail of lychee leather phone case with mirror, cute bear pendant and woven lanyard - Black (Coffee XX Bear Bracket - Smiley Rope) / Samsung ZFlip3
Close-up of brown litchi leather phone case with bear charms and braided wrist strap - Khaki (Coffee XX Bear Bracket - Smiley Rope) / Samsung ZFlip3
Close-up of black leather flip phone case with cute 3D charms and woven lanyard strap - Black (Coffee Bear Head Bracket - Smiley Rope) / Samsung ZFlip3
Detail of folding phone case featuring 3D coffee bear ornaments and a woven lanyard - Beige (Coffee Bear Head Bracket - Smiley Rope) / Samsung ZFlip3
+56
Kawaii Stereoscopic Cartoon Bear Folding Phone Case Faux Leather Litchi Texture With Braided Lanyard And Stand For Women
-9%
$3.62
No MOQ
3D Plush Bear Head Phone Case With Hand Strap Faux Leather Shockproof Protective Cover For Women Cute Korean Style
3D Plush Bear Head Phone Case With Hand Strap Faux Leather Shockproof Protective Cover For Women Cute Korean Style
like
Find Similar
Detail of iPhone case with 3D plush bear head and leather strap on metal tray - Black / iPhone 7/8/SE 2020
Detail of bear plush phone case with lanyard and metal buckle for iPhone 16 Pro Max - Off White / iPhone 7/8/SE 2020
Detail of iPhone 16 Pro Max brown leather case with plush bear and hand strap - Brown / iPhone 7/8/SE 2020
+84
3D Plush Bear Head Phone Case With Hand Strap Faux Leather Shockproof Protective Cover For Women Cute Korean Style
-8%
$2.23
No MOQ
Magnetic Phone Grip Holder Retractable Satin Rose Flower Rhinestone Artificial Pearl Decoration Elegant Mobile Phone Accessories
Magnetic Phone Grip Holder Retractable Satin Rose Flower Rhinestone Artificial Pearl Decoration Elegant Mobile Phone Accessories
like
Find Similar
Detailed view of pink fabric rose phone grip with sparkling rhinestones and pearls - (4 Rhinestones) Magnetic Small Fabric Rose / Pink
Detailed close-up of a black fabric camellia phone socket with crystal rhinestones - (4 Rhinestones) Magnetic Small Fabric Rose / Black
Close-up of red fabric camellia phone socket with sparkling rhinestones on desktop - (4 Rhinestones) Magnetic Small Fabric Rose / Red
Detail of fabric camellia phone socket with champagne satin rose and rhinestones - (4 Rhinestones) Magnetic Small Fabric Rose / Khaki
+5
Magnetic Phone Grip Holder Retractable Satin Rose Flower Rhinestone Artificial Pearl Decoration Elegant Mobile Phone Accessories
-9%
$1.96
No MOQ
Rhinestone Jewelry Copper Shiny Double Layer Necklace Earrings Bracelet For Wedding Bridal Banquet Elegant Women
Rhinestone Jewelry Copper Shiny Double Layer Necklace Earrings Bracelet For Wedding Bridal Banquet Elegant Women
like
Find Similar
Sparkling silver double-layer rhinestone necklace, bracelet, and earrings jewelry set for women - 619+782 Silver Necklace Earrings Bracelet Set
Macro shot of silver bridal necklace and long tassel earrings with sparkling crystals - 619 Silver Necklace Earrings Set
Luxurious silver bridal jewelry set with sparkling rhinestones for wedding and evening galas - 619+799 Silver Necklace Earrings Bracelet Set
Sparkling full diamond rhinestone bracelet with adjustable extension chain for women's gala - 799 Silver Bracelet
+3
Rhinestone Jewelry Copper Shiny Double Layer Necklace Earrings Bracelet For Wedding Bridal Banquet Elegant Women
-5%
$1.24-3.73
No MOQ
 · 
49 views
Free Shipping
Pink Zircon Tennis Bracelet For Women Elegant Round Cut Claw Chain Copper Jewelry With Adjustable Extension Sweet Style
Pink Zircon Tennis Bracelet For Women Elegant Round Cut Claw Chain Copper Jewelry With Adjustable Extension Sweet Style
like
Find Similar
1 option
Pink Zircon Tennis Bracelet For Women Elegant Round Cut Claw Chain Copper Jewelry With Adjustable Extension Sweet Style
-4%
$2.37
No MOQ
 · 
38 views
Free Shipping
Woven Bag Strap Wide Adjustable Replacement Shoulder Strap Jacquard Ethnic Geometric Pattern Metal Buckle For Handbags
Woven Bag Strap Wide Adjustable Replacement Shoulder Strap Jacquard Ethnic Geometric Pattern Metal Buckle For Handbags
like
Find Similar
Adjustable black knit shoulder strap with grey geometric patterns and gold metal buckles - Gold Buckle / Graphite Black Small V Pattern
Detail of adjustable black and gray herringbone bag strap with gold metal lobster clasps - Gold Buckle / Graphite Black Large V Pattern
Detail of woven geometric replacement strap with gold metal hooks and slider - Gold Buckle / Dark Grey Small V Pattern
Close-up of woven ethnic bag strap with geometric jacquard and gold metal buckles - Gold Buckle / Dark Grey Large V Pattern
+50
Woven Bag Strap Wide Adjustable Replacement Shoulder Strap Jacquard Ethnic Geometric Pattern Metal Buckle For Handbags
$1.87
No MOQ
Bag Strap Replacement Adjustable Nylon Woven Shoulder Crossbody Belt With Rotating Hooks Solid Color Versatile
Bag Strap Replacement Adjustable Nylon Woven Shoulder Crossbody Belt With Rotating Hooks Solid Color Versatile
like
Find Similar
Close-up of black adjustable canvas bag strap with swivel hooks and durable plastic buckle - Black
Adjustable white woven cotton strap with black metal hooks and slider for bags - White
Close-up of beige woven shoulder strap with black plastic swivel hooks and adjuster - 3 Off-white
Adjustable khaki cotton canvas bag strap with black rotating buckles and floral accent - 4 Khaki
+14
NewBag Strap Replacement Adjustable Nylon Woven Shoulder Crossbody Belt With Rotating Hooks Solid Color Versatile
$1.30
No MOQ
Colorful Rainbow Striped Bag Strap Adjustable Wide Polyester Replacement Shoulder Belt With Metal Swivel Hooks
Colorful Rainbow Striped Bag Strap Adjustable Wide Polyester Replacement Shoulder Belt With Metal Swivel Hooks
like
Find Similar
2.5cm colorful rainbow nylon bag strap with gold metal hooks on a white background - 2.5cm + Gold Buckle / Rainbow Style 1
2.5cm colorful rainbow striped replacement bag strap with golden metal swivel hooks - 2.5cm + Gold Buckle / Rainbow Style 2
Close-up of rainbow striped 2.5cm shoulder strap with gold clips and star patterns - 2.5cm + Gold Buckle / Style 3 Five-star Rainbow
Adjustable light green and white striped nylon shoulder strap with gold metal hardware - 2.5cm + Gold Buckle / Light Green Striped
+29
Colorful Rainbow Striped Bag Strap Adjustable Wide Polyester Replacement Shoulder Belt With Metal Swivel Hooks
$1.44
No MOQ
Adjustable Replacement Shoulder Strap Jacquard Webbing Geometric Chevron Pattern Metal Buckle For Handbags Crossbody Bags
Adjustable Replacement Shoulder Strap Jacquard Webbing Geometric Chevron Pattern Metal Buckle For Handbags Crossbody Bags
like
Find Similar
Adjustable geometric jacquard replacement shoulder strap with gold metal lobster clasps - Silver Clasp / Black Brown
Adjustable 2.5cm jacquard bag strap with beige and black geometric wave patterns - Silver Clasp / Beige Khaki
2.5cm wide jacquard weave bag strap with chevron pattern and gold metal hardware - Silver Clasp / Black Khaki
Detail of jacquard woven geometric strap with adjustable gold lobster clasp - Silver Clasp / Black Blue Burgundy
+11
Adjustable Replacement Shoulder Strap Jacquard Webbing Geometric Chevron Pattern Metal Buckle For Handbags Crossbody Bags
$1.73
No MOQ
Kids Backpack 3D Cartoon Rabbit Strawberry Milk Tea Shape EVA Hard Shell Breathable Schoolbag For Toddler Girls Boys
Kids Backpack 3D Cartoon Rabbit Strawberry Milk Tea Shape EVA Hard Shell Breathable Schoolbag For Toddler Girls Boys
like
Find Similar
Close-up of pink rabbit backpack with 3D strawberry details and ice cream topper - Pink
Close-up of the durable EVA hard shell and 3D strawberry detail on kids rabbit backpack - Red
Detail of cute rabbit hard shell cupcake backpack with durable purple straps and accessories - Purple
Detail view of the durable hardshell 3D bunny and strawberry relief on the kids backpack - Blue
+1
Kids Backpack 3D Cartoon Rabbit Strawberry Milk Tea Shape EVA Hard Shell Breathable Schoolbag For Toddler Girls Boys
$6.30
No MOQ
Canvas Mug Shaped Pencil Case Cute Embroidery Cookie Apple Cartoon Stationery Storage Pouch With Handle For Students
Canvas Mug Shaped Pencil Case Cute Embroidery Cookie Apple Cartoon Stationery Storage Pouch With Handle For Students
like
Find Similar
Close-up of a yellow mug-shaped canvas pencil case with cute biscuit embroidery and a handle - Cookie
Detail of creative mug-shaped canvas pencil case with apple embroidery and red handle - Apple
Canvas Mug Shaped Pencil Case Cute Embroidery Cookie Apple Cartoon Stationery Storage Pouch With Handle For Students
$3.75
No MOQ
Press On Nails Long Coffin Coffee Brown Matte Hazelnut Autumn Plaid Pattern Artificial False Fingernails For Women
Press On Nails Long Coffin Coffee Brown Matte Hazelnut Autumn Plaid Pattern Artificial False Fingernails For Women
like
Find Similar
Brown hazelnut coffee matte press-on nails set with plaid patterns and latte art designs - Hazelnut Coffee (Includes Jelly Glue + File)
Press On Nails Long Coffin Coffee Brown Matte Hazelnut Autumn Plaid Pattern Artificial False Fingernails For Women
$1.10
Mix MOQ : 3
Cat Eye Magnetic Press On Nails Cute Cartoon Cat Pattern Glossy Round Head Short False Nails For Women Daily Wear
Cat Eye Magnetic Press On Nails Cute Cartoon Cat Pattern Glossy Round Head Short False Nails For Women Daily Wear
like
Find Similar
Cat eye press-on nails with cute cartoon cat patterns on a nude pink glitter base - Cat Theme Cat Eye Style (3XD3-13195)
Cat Eye Magnetic Press On Nails Cute Cartoon Cat Pattern Glossy Round Head Short False Nails For Women Daily Wear
-5%
$1.51
No MOQ
5D Embossed Nail Art Stickers Pineapple Fruit Ice Cream Summer Theme 3D Relief Waterproof Self Adhesive DIY Manicure For Women
5D Embossed Nail Art Stickers Pineapple Fruit Ice Cream Summer Theme 3D Relief Waterproof Self Adhesive DIY Manicure For Women
like
Find Similar
Close-up of 3D embossed pineapple nail art stickers with sweet summer dessert patterns - 3D Embossed Pineapple Fruit Series (CO-486)
5D Embossed Nail Art Stickers Pineapple Fruit Ice Cream Summer Theme 3D Relief Waterproof Self Adhesive DIY Manicure For Women
$0.81
Mix MOQ : 2
Bridal Jewelry Necklace Earrings Bracelet Elegant Rhinestone Crystal Sparkling Wedding Evening Party Prom Women Accessory
Bridal Jewelry Necklace Earrings Bracelet Elegant Rhinestone Crystal Sparkling Wedding Evening Party Prom Women Accessory
like
Find Similar
Detail of silver bridal jewelry set with sparkling blue and red rhinestones on black - Necklace + Earrings / Multicolor (2-Piece Set)
Detail of silver-tone tennis bracelet with pavé square cubic zirconia on a wrist - Square Rhinestone Bracelet
Elegant silver Y-shaped necklace and drop earring set with sparkling rhinestones on a model - Y-Necklace + Dangle Earrings / Style 748 White (2-Piece Set)
Close-up of sparkling silver bridal jewelry set with crystal necklace and earrings - Necklace + Earrings / White/Clear (2-Piece Set)
+8
Bridal Jewelry Necklace Earrings Bracelet Elegant Rhinestone Crystal Sparkling Wedding Evening Party Prom Women Accessory
-5%
$1.19-3.36
No MOQ
 · 
10 sold recently
Free Shipping
Aurora Cat Eye Gel Nail Polish Magnetic Spar Glitter Soak Off UV LED Cured Professional Manicure Art
Aurora Cat Eye Gel Nail Polish Magnetic Spar Glitter Soak Off UV LED Cured Professional Manicure Art
like
Find Similar
Macro detail of Aurora Cat's Eye nail gel polish with blue holographic shimmer effect - Aurora Cat's Eye Colorful 01
Detail of aurora cat eye nail polish bottle with magenta color gel and glitter swatches - Aurora Cat's Eye Colorful 02
Detail of aurora cat eye nail polish in shade 003 with silver magnetic sparkle effect - Aurora Cat's Eye Colorful 03
Macro view of green gold aurora cat's eye nail gel polish effect with 7.5ml bottle - Aurora Cat's Eye Colorful 04
+4
Aurora Cat Eye Gel Nail Polish Magnetic Spar Glitter Soak Off UV LED Cured Professional Manicure Art
$1.41
Mix MOQ : 3
Black Cat Eye Nail Gel Polish Magnetic Silver Sparkle Crystal Dark Shiny UV LED Soak Off Professional Manicure
Black Cat Eye Nail Gel Polish Magnetic Silver Sparkle Crystal Dark Shiny UV LED Soak Off Professional Manicure
like
Find Similar
Sparkling dark black cat eye gel nail polish with silver magnetic shimmer effect 7.5ml - Extreme Black Cat Eye Gel
Black Cat Eye Nail Gel Polish Magnetic Silver Sparkle Crystal Dark Shiny UV LED Soak Off Professional Manicure
$1.35
Mix MOQ : 3
Nail Powder 5D Cat Eye Chameleon Magnetic Glitter Manicure Chrome Mirror Effect Multi Color With Sponge Brush
Nail Powder 5D Cat Eye Chameleon Magnetic Glitter Manicure Chrome Mirror Effect Multi Color With Sponge Brush
like
Find Similar
Green 5D chameleon magnetic cat eye nail powder No. 01 with sponge applicator tool - 5D Chameleon Cat Eye Powder 01-Emerald Green
5D cat eye nail powder set NO.02 with applicator and vibrant turquoise magnetic effect - 5D Chameleon Cat Eye Powder 02-Blue Green
Misscheering 5D Cat Eye Nail Powder NO.03 with magnetic purple shimmer effect - 5D Chameleon Cat Eye Powder 03-Purple
5D chameleon magnetic cat eye nail powder in shade NO. 04 with sponge applicator - 5D Chameleon Cat Eye Powder 04-Deep Purple
+8
Nail Powder 5D Cat Eye Chameleon Magnetic Glitter Manicure Chrome Mirror Effect Multi Color With Sponge Brush
$1.53
Mix MOQ : 3
 · 
10 views
Nail Dappen Dish Iridescent Glass With Lid Aurora Colorful Crystal Heart Shape Manicure Liquid Powder Container Tool
Nail Dappen Dish Iridescent Glass With Lid Aurora Colorful Crystal Heart Shape Manicure Liquid Powder Container Tool
like
Find Similar
Macro detail of heart-shaped iridescent glass nail art cup with dimensions and weight - Transparent Heart Crystal Cup 01
Detailed view of 4cm pink heart-shaped glass jar with lid and vertical ribbed texture - Pink Heart Crystal Cup 02
Detailed view of iridescent heart-shaped glass nail crystal cup with dimensions 4x3.5cm - Iridescent Heart Crystal Cup 03
Rainbow glass dappen dish with lid for nail art showing size 4cm diameter and 3.5cm height - Aurora Heart Crystal Cup 04
+4
Nail Dappen Dish Iridescent Glass With Lid Aurora Colorful Crystal Heart Shape Manicure Liquid Powder Container Tool
$0.75-0.86
Mix MOQ : 3
Realistic Stuffed Horse Plush Toy Simulation Animal Doll Faux Mink Fur Soft PP Cotton Filling Birthday Gift Home Decor Kids
Realistic Stuffed Horse Plush Toy Simulation Animal Doll Faux Mink Fur Soft PP Cotton Filling Birthday Gift Home Decor Kids
like
Find Similar
Brown horse plush toy with realistic reddish mane and soft velvet fabric for kids - 20cm With Sucker / Tan
Brown horse plush toy with soft fur and black bridle with silver studs for kids - 20cm With Sucker / Dark Brown
Cute white plush pony with pink mane and golden red harness decorative toy doll - 20cm With Sucker / White
+9
Realistic Stuffed Horse Plush Toy Simulation Animal Doll Faux Mink Fur Soft PP Cotton Filling Birthday Gift Home Decor Kids
$3.17-8.07
No MOQ
Blue Cat Eye Magnetic Press On Nails Oval Short False Nails With Glitter Star Pattern For Women
Blue Cat Eye Magnetic Press On Nails Oval Short False Nails With Glitter Star Pattern For Women
like
Find Similar
Short oval fake nails with deep blue cat eye finish and metallic shimmer effect - Black Jelly Glue (Shein Platform)
Blue Cat Eye Magnetic Press On Nails Oval Short False Nails With Glitter Star Pattern For Women
$0.84
No MOQ
Dark Red Cat Eye Press On Nails Magnetic Long Coffin Trapezoidal Artificial Detachable Fake Nails Elegant Manicure For Women
Dark Red Cat Eye Press On Nails Magnetic Long Coffin Trapezoidal Artificial Detachable Fake Nails Elegant Manicure For Women
like
Find Similar
Red cat eye press-on nails with luxury silver snake ring featuring a green gemstone - Oxblood Red 30 Pieces
Dark Red Cat Eye Press On Nails Magnetic Long Coffin Trapezoidal Artificial Detachable Fake Nails Elegant Manicure For Women
$0.46-1.12
No MOQ
Cat Eye Magnetic Press On Nails Long Almond Shape Black Ice Transparent Shimmering Glossy False Nails For Women
Cat Eye Magnetic Press On Nails Long Almond Shape Black Ice Transparent Shimmering Glossy False Nails For Women
like
Find Similar
Detail of long almond press-on nails with black cat eye effect and magnetic silver shimmer - Black Cat Eye Almond Style with Yellow Jelly Glue and File (AW438)
NewCat Eye Magnetic Press On Nails Long Almond Shape Black Ice Transparent Shimmering Glossy False Nails For Women
$1.04
No MOQ
Press On Nails Long Coffin Cat Eye Magnetic French Smile Sunset Bubble Gradient Glitter Glossy Elegant False Nails
Press On Nails Long Coffin Cat Eye Magnetic French Smile Sunset Bubble Gradient Glitter Glossy Elegant False Nails
like
Find Similar
Classic French cat eye press-on nails in long trapezoid shape with nude gold shimmer - Sunset Bubble W106 - Boxed Tool Kit
Press On Nails Long Coffin Cat Eye Magnetic French Smile Sunset Bubble Gradient Glitter Glossy Elegant False Nails
$1.58-1.70
No MOQ
Press On Nails Long Coffin Matte Coffee Brown Plaid Design Coffee Art Artificial Fake Nails Fashionable Manicure For Women
Press On Nails Long Coffin Matte Coffee Brown Plaid Design Coffee Art Artificial Fake Nails Fashionable Manicure For Women
like
Find Similar
Long coffin press-on nails featuring autumn brown matte finish and coffee latte art designs - Coffee Theme Matte Plaid (AW527)
Press On Nails Long Coffin Matte Coffee Brown Plaid Design Coffee Art Artificial Fake Nails Fashionable Manicure For Women
$1.10
No MOQ
Cat Eye Pink Glossy Press On Nails Medium Square Round Glitter Artificial Finger Nails For Women
Cat Eye Pink Glossy Press On Nails Medium Square Round Glitter Artificial Finger Nails For Women
like
Find Similar
Pink cat eye press-on nails in medium square shape with glitter finish on white background - Medium Square (CW118) / Pinkish Purple Cat Eye (CW118)
Cat Eye Pink Glossy Press On Nails Medium Square Round Glitter Artificial Finger Nails For Women
$1.21
No MOQ
Handmade Press On Nails Cat Eye Caramel Coffee Galaxy Magnetic Glitter Short Square Glossy ABS For Women
Handmade Press On Nails Cat Eye Caramel Coffee Galaxy Magnetic Glitter Short Square Glossy ABS For Women
like
Find Similar
Brown cat eye galaxy press-on nails with shimmering magnetic glitter on display card - XS / Coffee Caramel Cat Eye Style (FMD018)
NewHandmade Press On Nails Cat Eye Caramel Coffee Galaxy Magnetic Glitter Short Square Glossy ABS For Women
$0.81
No MOQ
Free Shipping
Handmade Cat Eye Press On Nails Glossy Nude Champagne Square Style Elegant Daily Wear Manicure
Handmade Cat Eye Press On Nails Glossy Nude Champagne Square Style Elegant Daily Wear Manicure
like
Find Similar
Handmade champagne cat-eye press-on nails set displayed on a professional size card - XS / Nude Champagne Cat Eye Style (FMD034)
Handmade Cat Eye Press On Nails Glossy Nude Champagne Square Style Elegant Daily Wear Manicure
-4%
$0.77
No MOQ
Free Shipping
Stainless Steel Zircon Stud Earrings Lollipop Ice Cream Fruit Shape Helix Piercing Jewelry For Women Screw Back
Stainless Steel Zircon Stud Earrings Lollipop Ice Cream Fruit Shape Helix Piercing Jewelry For Women Screw Back
like
Find Similar
Macro detail of 18K gold stainless steel ice cream stud earring with colorful zircon stones - 60065-1 Gold - Ice Cream Cone
Macro detail of butterfly ear stud with pink marquise zircon and gold screw ball back - 60078 Large - Gold - Pink Butterfly
Macro shot of silver butterfly stud earring with pink zircon stones and screw ball back - 60078 Large - Silver - Pink Butterfly
Macro view of cherry studs with pink stones and gold base on a white ceramic bowl edge - 60075-1 Gold - Pink Cherry
+40
Stainless Steel Zircon Stud Earrings Lollipop Ice Cream Fruit Shape Helix Piercing Jewelry For Women Screw Back
-5%
$0.83-1.62
No MOQ
 · 
36 sold recently
Free Shipping
Silicone Makeup Brush Cleaning Mat Multi Textured Portable Scrubber Pad For Cosmetic Brushes Washing Tool Round Shape Durable Soft
Silicone Makeup Brush Cleaning Mat Multi Textured Portable Scrubber Pad For Cosmetic Brushes Washing Tool Round Shape Durable Soft
like
Find Similar
Pink silicone makeup brush cleaning mat with suction cups and multiple washing textures - Pink
Three-leaf red silicone makeup brush cleaning mat with suction cups and textures - Red
Purple clover-shaped silicone makeup brush cleaning mat with textured suction cup surface - Purple
Mint green silicone makeup brush cleaning mat with textured suction pad for deep cleansing - Green
+2
Silicone Makeup Brush Cleaning Mat Multi Textured Portable Scrubber Pad For Cosmetic Brushes Washing Tool Round Shape Durable Soft
$0.81
Mix MOQ : 3
Nail Art Stickers 5D Embossed French Style Rose Floral Design Retro Blue Border Manicure Decorations DIY Beauty
Nail Art Stickers 5D Embossed French Style Rose Floral Design Retro Blue Border Manicure Decorations DIY Beauty
like
Find Similar
French style nail stickers Co-399 with blue frames and red roses for DIY manicure art - Retro Rose Border Style (CO-399)
Nail Art Stickers 5D Embossed French Style Rose Floral Design Retro Blue Border Manicure Decorations DIY Beauty
$0.58
No MOQ
5D 3D Embossed Nail Art Stickers Ginkgo Leaves Autumn Winter Plaid Pattern Self Adhesive French Style Elegant Manicure Decals Women
5D 3D Embossed Nail Art Stickers Ginkgo Leaves Autumn Winter Plaid Pattern Self Adhesive French Style Elegant Manicure Decals Women
like
Find Similar
French style autumn nail stickers with ginkgo leaf and plaid designs in caramel tones - Autumn Ginkgo Leaf Argyle Style (CO-189)
5D 3D Embossed Nail Art Stickers Ginkgo Leaves Autumn Winter Plaid Pattern Self Adhesive French Style Elegant Manicure Decals Women
$0.72
No MOQ
5D Embossed Nail Art Stickers Waterproof Self Adhesive Cartoon Rabbit Duck Heart Pattern DIY Manicure Decoration
5D Embossed Nail Art Stickers Waterproof Self Adhesive Cartoon Rabbit Duck Heart Pattern DIY Manicure Decoration
like
Find Similar
5D embossed cartoon nail stickers with 3D rabbit and duck patterns in macalon colors - 3D Cartoon Rabbit Duck Style (FEB-757)
5D Embossed Nail Art Stickers Waterproof Self Adhesive Cartoon Rabbit Duck Heart Pattern DIY Manicure Decoration
$0.58
No MOQ
Almond Shape Press On Nails Pink White Red Lip Heart Pattern With 3D Bow Rhinestones Sweet Cool French Style
Almond Shape Press On Nails Pink White Red Lip Heart Pattern With 3D Bow Rhinestones Sweet Cool French Style
like
Find Similar
Close-up of pink press-on nails with red lips, bows and rhinestones in gift box - Pink White Red Lip Heart Bow Style (WY015) / 24 Pieces Per Box
Almond Shape Press On Nails Pink White Red Lip Heart Pattern With 3D Bow Rhinestones Sweet Cool French Style
$1.30
Mix MOQ : 2
Canvas Tote Bag Aesthetic Printed Large Capacity Shoulder Handbag For Women Casual Travel Shopping Eco Friendly
Canvas Tote Bag Aesthetic Printed Large Capacity Shoulder Handbag For Women Casual Travel Shopping Eco Friendly
like
Find Similar
Detail of white canvas tote bag featuring Stars Hollow colorful mug illustrations - Stars Hollow Market Cups Print
Close-up of a canvas tote bag featuring cute cartoon cats illustration on model shoulder - Three Cats On Sofa Print
Detail of white canvas tote bag with Love Fall maple leaf heart graphic worn by a model - Love Fall Maple Heart Print
Close-up of a white canvas tote bag featuring a vintage Italian Spritz citrus graphic print - Spritz Veneto Cocktail Print
+6
Canvas Tote Bag Aesthetic Printed Large Capacity Shoulder Handbag For Women Casual Travel Shopping Eco Friendly
$1.73
No MOQ
Sunflower Print Cosmetic Bag Cotton Linen Waterproof Zipper Makeup Pouch With Wristlet Portable Travel Organizer For Women
Sunflower Print Cosmetic Bag Cotton Linen Waterproof Zipper Makeup Pouch With Wristlet Portable Travel Organizer For Women
like
Find Similar
White linen makeup bag with sunflower tea cup print and black zipper wristlet - Sunflower Tea Cup Style 1 (xy-007-01) / With Wristlet Strap
Waterproof linen makeup bag with vibrant sunflower print and black wristlet strap - Sunflower Field Style (xy-007-02) / With Wristlet Strap
Waterproof linen makeup bag with sunflower print and black wristlet strap handle - Sunflower Tea Cup Style 2 (xy-007-03) / With Wristlet Strap
Waterproof linen makeup bag featuring yellow sunflower prints and a black wristlet strap - Single Sunflower Style (xy-007-04) / With Wristlet Strap
+4
Sunflower Print Cosmetic Bag Cotton Linen Waterproof Zipper Makeup Pouch With Wristlet Portable Travel Organizer For Women
-5%
$1.26-1.31
No MOQ
Coffee Theme Makeup Bag Zipper Pouch With Wristlet Strap Portable Polyester Linen Cosmetic Bag Travel Organizer
Coffee Theme Makeup Bag Zipper Pouch With Wristlet Strap Portable Polyester Linen Cosmetic Bag Travel Organizer
like
Find Similar
Brown coffee gnome makeup bag with wooden texture and Coffee Time print and zipper - Retro Wood Grain Coffee Time
Canvas makeup bag with vintage coffee print, zip closure, and black hand strap - Multiple Coffee Icons
Gnome coffee themed makeup bag in vintage brown canvas with secure black zipper - Nordic Coffee Gnomes
Canvas makeup bag with coffee prints and black handle in cream white finish - Retro Coffee Quotes
Coffee Theme Makeup Bag Zipper Pouch With Wristlet Strap Portable Polyester Linen Cosmetic Bag Travel Organizer
-4%
$1.37
No MOQ
Teacher Appreciation Gift Cosmetic Bag Linen Zipper Pouch Travel Makeup Organizer For Teachers School Education Theme
Teacher Appreciation Gift Cosmetic Bag Linen Zipper Pouch Travel Makeup Organizer For Teachers School Education Theme
like
Find Similar
Linen makeup bag for teachers with 'Teachers Change The World' print and wristlet strap - Pattern 1 (BOOKS/GLOBE/APPLE) / With Wrist Strap
Linen makeup bag with Teachers Change the World print and convenient hand strap - Pattern 2 (GLOBE/CALCULATOR) / With Wrist Strap
Linen makeup bag for teachers with colorful educational icons and world change slogan - Pattern 3 (BOOKS/PEN HOLDER) / With Wrist Strap
Linen teacher gift pouch with Teacher Change the World print and wrist strap - Pattern 4 (GLOBE/APPLE/COFFEE) / With Wrist Strap
+4
Teacher Appreciation Gift Cosmetic Bag Linen Zipper Pouch Travel Makeup Organizer For Teachers School Education Theme
$1.15-1.30
No MOQ
 · 
14 sold recently
Valentine Rose Floral Print Cosmetic Bag Fine Linen Zipper Makeup Pouch Travel Toiletry Organizer Portable Wristlet Handle
Valentine Rose Floral Print Cosmetic Bag Fine Linen Zipper Makeup Pouch Travel Toiletry Organizer Portable Wristlet Handle
like
Find Similar
Pink rose floral print makeup bag with Love decorative card and black zipper - Rose Tea Cup Heart Style With Wrist Strap (xy-050-1)
Pink Valentine's Day cosmetic bag with rose and heart patterns and black hand strap - Holiday Gift Box Rose Style With Wrist Strap (xy-050-2)
Portable Valentine's Day floral cosmetic bag with rose prints and black wrist strap - Heart Balloon Chocolate Style With Wrist Strap (xy-050-3)
Pink rose pattern Valentine's Day makeup bag with zipper and handle on white background - Romantic Heart Rose Style With Wrist Strap (xy-050-4)
+4
Valentine Rose Floral Print Cosmetic Bag Fine Linen Zipper Makeup Pouch Travel Toiletry Organizer Portable Wristlet Handle
-5%
$1.26-1.31
No MOQ
Fireworks Pattern Press On Nails Cat Eye Gradient Glitter Short Round Square Artificial Fingernails For Women DIY Manicure
Fireworks Pattern Press On Nails Cat Eye Gradient Glitter Short Round Square Artificial Fingernails For Women DIY Manicure
like
Find Similar
Short firework press-on nails with red-green lines and cat eye magnetic gradient finish - Glue Type / Fireworks Gradient Style (Y-313)
Fireworks Pattern Press On Nails Cat Eye Gradient Glitter Short Round Square Artificial Fingernails For Women DIY Manicure
$1.79-1.87
No MOQ
Free Shipping
Bread Dog Pattern Quilted Cotton Cosmetic Bag Portable Large Capacity Makeup Organizer Pouch Travel Toiletry Wash Bag
Bread Dog Pattern Quilted Cotton Cosmetic Bag Portable Large Capacity Makeup Organizer Pouch Travel Toiletry Wash Bag
like
Find Similar
Detailed view of white quilted bread dog makeup bag with top handle and zipper closure - Bread Dog - [Makeup Bag]
Detail of cream quilted makeup bag featuring cartoon puppy patterns and zipper closure - Bread Dog - [Clutch Bag]
White quilted cosmetic bag with cute cartoon bread dog print and pink floral charm - Bread Dog - [Octagon Storage Bag]
NewBread Dog Pattern Quilted Cotton Cosmetic Bag Portable Large Capacity Makeup Organizer Pouch Travel Toiletry Wash Bag
-5%
$2.05-3.42
No MOQ
Retro British Plaid Tote Bag Cotton Canvas Handbag Large Capacity With Faux Leather Handle For Women Daily Work School
Retro British Plaid Tote Bag Cotton Canvas Handbag Large Capacity With Faux Leather Handle For Women Daily Work School
like
Find Similar
Close-up of vintage plaid tote bag featuring red and black checks with leather handles - Red Grey Plaid
Detail view of vintage British style plaid tote bag with sturdy leather handles and rivets - Green and White Plaid
Detail of vintage plaid tote bag featuring leather handles and metal rivets on soft fabric - Yellow Coffee Plaid
Close-up of retro plaid tote bag with leather handles and gold rivets on soft bedding - Blue Purple Check
Retro British Plaid Tote Bag Cotton Canvas Handbag Large Capacity With Faux Leather Handle For Women Daily Work School
$9.60
Mix MOQ : 3
Women Vintage Striped Knitted Handbag Small Tote Underarm Bag Retro Aesthetic Sueded Fabric Simple Style Daily Carry
Women Vintage Striped Knitted Handbag Small Tote Underarm Bag Retro Aesthetic Sueded Fabric Simple Style Daily Carry
like
Find Similar
Top-down view of retro woven shoulder bag with brown and black stripes on a wooden table - Brown
Detail of tweed woven handbag with simple wish label and matching accessories - Black
Women Vintage Striped Knitted Handbag Small Tote Underarm Bag Retro Aesthetic Sueded Fabric Simple Style Daily Carry
$8.13
No MOQ
Silicone TPR Chair Leg Floor Protectors Non Slip Noise Reduction Flexible Furniture Feet Caps Protection
Silicone TPR Chair Leg Floor Protectors Non Slip Noise Reduction Flexible Furniture Feet Caps Protection
like
Find Similar
2 options
Silicone TPR Chair Leg Floor Protectors Non Slip Noise Reduction Flexible Furniture Feet Caps Protection
$0.01
No MOQ
Wall Mounted Hair Dryer Holder Bathroom Storage Rack No Drill PP Plastic Organizer With Comb Bucket Hooks For Haircare Tools
Wall Mounted Hair Dryer Holder Bathroom Storage Rack No Drill PP Plastic Organizer With Comb Bucket Hooks For Haircare Tools
like
Find Similar
3 options
Wall Mounted Hair Dryer Holder Bathroom Storage Rack No Drill PP Plastic Organizer With Comb Bucket Hooks For Haircare Tools
$0.49
Mix MOQ : 2
Canvas Tote Bag Large Capacity Letter Embroidery Shoulder Crossbody Handbag Casual School Shopping Trendy Women
Canvas Tote Bag Large Capacity Letter Embroidery Shoulder Crossbody Handbag Casual School Shopping Trendy Women
like
Find Similar
Detail of off-white canvas tote with brown embroidery and adjustable shoulder strap - Beige
Detail of light blue canvas tote bag featuring white embroidery and adjustable strap - Light Blue
Lavender canvas tote bag detail featuring white inspirational text and dual strap design - Purple
Detail of light green canvas tote bag with white inspirational text on white display stand - Mustard Green
+1
Canvas Tote Bag Large Capacity Letter Embroidery Shoulder Crossbody Handbag Casual School Shopping Trendy Women
-4%
$4.63
No MOQ
Cute Cartoon Duck Penguin Nail Art Stickers 5D Self Adhesive Ultra Thin Transparent PET DIY Manicure Decoration
Cute Cartoon Duck Penguin Nail Art Stickers 5D Self Adhesive Ultra Thin Transparent PET DIY Manicure Decoration
like
Find Similar
Cute Japanese cartoon duck nail art stickers for students featuring school themes - Study Duck (to1823)
Close-up of cute cartoon penguin nail art stickers on a thin adhesive sheet to-1825 - Working Professional Duck (to1825)
Cute Cartoon Duck Penguin Nail Art Stickers 5D Self Adhesive Ultra Thin Transparent PET DIY Manicure Decoration
-9%
$1.17
No MOQ
Free Shipping
Cute Cartoon Bear Dog Nail Art Stickers Ultra Thin Adhesive Embossed DIY Manicure Decoration For Women Girls
Cute Cartoon Bear Dog Nail Art Stickers Ultra Thin Adhesive Embossed DIY Manicure Decoration For Women Girls
like
Find Similar
Cute cartoon nail art stickers featuring girls and pets in soft pastel colors, model MC-25 - Cartoon Bear Dessert Style (MC25)
Cute Japanese dog and bear nail stickers set with hand-drawn floral patterns, MC-29 - Dog Family & Flowers Style (MC29)
NewCute Cartoon Bear Dog Nail Art Stickers Ultra Thin Adhesive Embossed DIY Manicure Decoration For Women Girls
-9%
$1.30
No MOQ
Free Shipping
Halloween 3D Embossed Nail Art Stickers Cartoon Dog Pumpkin Ghost Design DIY Manicure Decoration For Women Girls
Halloween 3D Embossed Nail Art Stickers Cartoon Dog Pumpkin Ghost Design DIY Manicure Decoration For Women Girls
like
Find Similar
3D embossed Halloween dog nail stickers featuring pumpkin and ghost puppy designs - MC49-Embossed Style
3D embossed Halloween nail stickers featuring cartoon dogs, pumpkins, and ghosts - MC51-Embossed Style
Halloween 3D Embossed Nail Art Stickers Cartoon Dog Pumpkin Ghost Design DIY Manicure Decoration For Women Girls
$1.73
No MOQ
Free Shipping
Cute Cartoon Bear Coffee 3D Relief Nail Stickers Embossed Strawberry Cake Manicure Decorations DIY Decals For Kids Women
Cute Cartoon Bear Coffee 3D Relief Nail Stickers Embossed Strawberry Cake Manicure Decorations DIY Decals For Kids Women
like
Find Similar
Embossed coffee bear nail art stickers with cute dessert patterns and checkered designs - Coffee Bear (to4554-Embossed)
Cute Cartoon Bear Coffee 3D Relief Nail Stickers Embossed Strawberry Cake Manicure Decorations DIY Decals For Kids Women
$1.43
No MOQ
Free Shipping
Kawaii Stereo Embossed Nail Art Stickers Cute Cartoon Dog Bear Pattern Self Adhesive Manicure Decals For DIY Decoration
Kawaii Stereo Embossed Nail Art Stickers Cute Cartoon Dog Bear Pattern Self Adhesive Manicure Decals For DIY Decoration
like
Find Similar
3D embossed cartoon dog nail art stickers MC-61 with retro hand-drawn girl designs - Wangwang Family Embossed Style (MC61)
Kawaii Stereo Embossed Nail Art Stickers Cute Cartoon Dog Bear Pattern Self Adhesive Manicure Decals For DIY Decoration
-9%
$1.56
No MOQ
Free Shipping
Handmade Ruby Red Cat Eye Press On Nails With Rhinestone Decoration Short Coffin Square Shape For Women
Handmade Ruby Red Cat Eye Press On Nails With Rhinestone Decoration Short Coffin Square Shape For Women
like
Find Similar
Deep red cat eye press-on nails set with luxury ruby rhinestone accents for festive look - 589 Ruby Cat-eye Short Coffin / Large (L)
Handmade wine red cat-eye press-on nails with ruby-like gems and 3D crystal accents - 588 Ruby Cat-eye Short Square / Large (L)
+6
Handmade Ruby Red Cat Eye Press On Nails With Rhinestone Decoration Short Coffin Square Shape For Women
$4.03
No MOQ
Free Shipping
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access