Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Soccer Tournament Party Backdrop National Flags Football Silhouettes Trophy Medals Decorations Polyester Background Fan Party Banner
Soccer Tournament Party Backdrop National Flags Football Silhouettes Trophy Medals Decorations Polyester Background Fan Party Banner
like
Find Similar
2026 Soccer World Cup party backdrop with national flags, trophies and player silhouettes - Soccer Tournament Backdrop (J-0585)
Soccer Tournament Party Backdrop National Flags Football Silhouettes Trophy Medals Decorations Polyester Background Fan Party Banner
-4%
$2.93
Mix MOQ : 3
Football Theme Party Backdrop Curtain PET Plastic Print Sports Event Celebration Door Streamer Hanging Decoration
Football Theme Party Backdrop Curtain PET Plastic Print Sports Event Celebration Door Streamer Hanging Decoration
like
Find Similar
Fringe curtain with football pattern, 100x200cm size specifications for party decor - Soccer Printed Style
Football Theme Party Backdrop Curtain PET Plastic Print Sports Event Celebration Door Streamer Hanging Decoration
$2.10
Mix MOQ : 2
Soccer Birthday Party Photo Frame Cardboard DIY Photography Props With Trophy Ball Scoreboard Fan Decorations
Soccer Birthday Party Photo Frame Cardboard DIY Photography Props With Trophy Ball Scoreboard Fan Decorations
like
Find Similar
Soccer birthday party photo booth frame set with trophies and themed photography props - Football Party Photo Booth Frame (J-0558)
Soccer Birthday Party Photo Frame Cardboard DIY Photography Props With Trophy Ball Scoreboard Fan Decorations
-4%
$3.15
Mix MOQ : 5
Racing Car Temporary Tattoo Stickers Waterproof Cartoon Sports Trophies Flags Birthday Party Favors For Kids Boys
Racing Car Temporary Tattoo Stickers Waterproof Cartoon Sports Trophies Flags Birthday Party Favors For Kids Boys
like
Find Similar
Detail view of 10 colorful waterproof racing car cartoon tattoo stickers for children - Racing KSA Series
Racing car themed waterproof temporary tattoo stickers for kids featuring colorful sports cars - Racing SCA Series
Racing Car Temporary Tattoo Stickers Waterproof Cartoon Sports Trophies Flags Birthday Party Favors For Kids Boys
$0.10
Mix MOQ : 10
Cartoon Temporary Tattoo Stickers Afternoon Tea Dessert Theme Waterproof Sweatproof Colorful Cute Body Art For Children
Cartoon Temporary Tattoo Stickers Afternoon Tea Dessert Theme Waterproof Sweatproof Colorful Cute Body Art For Children
like
Find Similar
Detailed tea time theme waterproof temporary tattoo set with cupcakes and macarons - Afternoon Tea Series
Cartoon Temporary Tattoo Stickers Afternoon Tea Dessert Theme Waterproof Sweatproof Colorful Cute Body Art For Children
$0.10
Mix MOQ : 10
Cartoon Sports Temporary Tattoo Stickers Waterproof Sweatproof For Kids Basketball Soccer Baseball Football Party
Cartoon Sports Temporary Tattoo Stickers Waterproof Sweatproof For Kids Basketball Soccer Baseball Football Party
like
Find Similar
Cartoon basketball temporary tattoos for kids featuring sports slogans and players set of 10 - Basketball Series
Set of 10 soccer theme temporary tattoos with colorful football and player silhouette - Soccer Series
Set of 10 cartoon baseball temporary tattoos for kids featuring balls, gloves and trophies - Baseball Series
Set of 10 temporary cartoon American football tattoos for kids sports themed parties - American Football Series
Cartoon Sports Temporary Tattoo Stickers Waterproof Sweatproof For Kids Basketball Soccer Baseball Football Party
$0.10
Mix MOQ : 10
10 Sheets Kids Soccer Temporary Tattoos Waterproof Football Theme Birthday Party Favors Sports Fans Club Activity Body Stickers
10 Sheets Kids Soccer Temporary Tattoos Waterproof Football Theme Birthday Party Favors Sports Fans Club Activity Body Stickers
like
Find Similar
Set of 10 colorful cartoon soccer temporary tattoos for kids featuring goals and trophies - Soccer ZQB Series (ZQB-01-10)
Set of 10 soccer theme temporary tattoos with colorful football and player silhouette - Soccer Z Series (Z-01-10)
10 Sheets Kids Soccer Temporary Tattoos Waterproof Football Theme Birthday Party Favors Sports Fans Club Activity Body Stickers
$0.10
Mix MOQ : 10
3D Soccer Wall Stickers Broken Effect Decorative PVC Decals For Window Glass Fridge Sport Theme
3D Soccer Wall Stickers Broken Effect Decorative PVC Decals For Window Glass Fridge Sport Theme
like
Find Similar
Detailed 30x30cm sticker showing 3D cracked glass football effect on a window - 3D Visual Broken Soccer (ZQ2601) / 30cm*30cm*1 Sheet (opp bag)
Three-piece soccer wall stickers set with goal lettering and splat art effect - Soccer Beer Sneakers 3-Piece Set (ZQ2609ABC) / 30cm*30cm*3Sheets (OPP Bag)
Detailed 3D watercolor football and champagne wall stickers with layout dimensions - Soccer Champagne Goal 3-Piece Set (ZQ2610ABC) / 30cm*30cm*3Sheets (OPP Bag)
Detailed view of 3D soccer wall stickers showing dimensions for bedroom glass decoration - Soccer Field Player Silhouette 3-Piece Set (ZQ2611ABC) / 30cm*30cm*3Sheets (OPP Bag)
+10
3D Soccer Wall Stickers Broken Effect Decorative PVC Decals For Window Glass Fridge Sport Theme
-5%
$0.69-1.92
No MOQ
3D Soccer Wall Sticker PVC Broken Wall Flame Football Decal For Kids Boys Room Sports Theme Home Decor Removable
3D Soccer Wall Sticker PVC Broken Wall Flame Football Decal For Kids Boys Room Sports Theme Home Decor Removable
like
Find Similar
Detailed 3D soccer wall sticker dimensions showing a flaming ball breaking through the wall - World Cup Soccer Sticker (ZQ2605) / 40cm*60cm*1pc
3D Soccer Wall Sticker PVC Broken Wall Flame Football Decal For Kids Boys Room Sports Theme Home Decor Removable
-4%
$1.92
No MOQ
3D Soccer Football Wall Sticker Fire Flame Broken Brick Wall Visual PVC Removable Self Adhesive Sporty Room Decor
3D Soccer Football Wall Sticker Fire Flame Broken Brick Wall Visual PVC Removable Self Adhesive Sporty Room Decor
like
Find Similar
3D soccer wall sticker with flaming ball and red brick crack effect, 40x60cm size detail - 3D Football Broken Wall Style (ZQ2607)
3D Soccer Football Wall Sticker Fire Flame Broken Brick Wall Visual PVC Removable Self Adhesive Sporty Room Decor
-4%
$1.92
No MOQ
Football Tournament Wall Stickers PVC Adhesive Decorative Door Window Decals For Fans Bedroom Watercolor Splatter Style
Football Tournament Wall Stickers PVC Adhesive Decorative Door Window Decals For Fans Bedroom Watercolor Splatter Style
like
Find Similar
Detailed 3D watercolor football wall decals with GOAL text and beer mug designs - 30cm*30cm*3 Sheets / Colorful Soccer Splatter Set (ZQ2609ABC)
Football Tournament Wall Stickers PVC Adhesive Decorative Door Window Decals For Fans Bedroom Watercolor Splatter Style
$1.96
No MOQ
Cartilage Studs 316L Stainless Steel Copper Gold Plated Colorful Cubic Zirconia Butterfly Star Piercing Jewelry Women
Cartilage Studs 316L Stainless Steel Copper Gold Plated Colorful Cubic Zirconia Butterfly Star Piercing Jewelry Women
like
Find Similar
Gold plated titanium steel ear stud with ice cream cone design and colorful zircons - (1 PC) 2# Ice Cream - Silver
316L steel butterfly cartilage earring with pink and purple zircon in silver finish - (1 PC) 4# Butterfly - Silver
316L butterfly stud earring with colorful zircon stones and detailed dimensions - (1 PC) 5# Butterfly - Silver
316L titanium steel butterfly stud earring with colorful zircon pavé stones - (1 PC) 3# Butterfly - Silver
+12
Cartilage Studs 316L Stainless Steel Copper Gold Plated Colorful Cubic Zirconia Butterfly Star Piercing Jewelry Women
$0.92-1.43
Mix MOQ : 2
 · 
178 sold recently
Free Shipping
Liquid Floating Quicksand Keychain Acrylic Transparent Cartoon Animal Character Bag Charm With Bell Metal Ring Gift
Liquid Floating Quicksand Keychain Acrylic Transparent Cartoon Animal Character Bag Charm With Bell Metal Ring Gift
like
Find Similar
Star-shaped liquid keychain with pink fluid, cute white rabbit, and strawberry charm - Lollipop Star
Detail shot of a liquid quicksand keychain featuring a Hello Kitty figure and stars - Cartoon Cat Bear Head
Pink liquid bottle keychain with cartoon white bear and golden bell hanging accessory - Soda Bottle Bunny
Detail of pink liquid glitter keychain featuring cherry blossom sequins and a bell charm - Cartoon Cat Heart Cup
+34
Liquid Floating Quicksand Keychain Acrylic Transparent Cartoon Animal Character Bag Charm With Bell Metal Ring Gift
-16%
$0.84-0.96
No MOQ
 · 
15 views
Football Soccer 3D Ball Keychain With PVC Wrist Strap And Athlete Silhouette Pendant For Backpack Sports Style Accessory
Football Soccer 3D Ball Keychain With PVC Wrist Strap And Athlete Silhouette Pendant For Backpack Sports Style Accessory
like
Find Similar
Detail of a soccer keychain with yellow ball, GOOOOAL wristlet, and athlete charm - Lanyard Style / Lemon Yellow
Gate Buckle Style / Purple
Mini classic black and white football keychain with silver metal lobster clasp for bags - Gate Buckle Style / White
Miniature soccer ball keychain with GOAL wrist strap and football player silhouette charm - Lanyard Style / White
+6
Football Soccer 3D Ball Keychain With PVC Wrist Strap And Athlete Silhouette Pendant For Backpack Sports Style Accessory
-9%
$0.50-0.73
No MOQ
 · 
41 sold recently
Faux Fur Pom-pom Keychain With Heart Metal Clasp And Mini Drink Bottle Charm Cute Bag Pendant For Women Girls
Faux Fur Pom-pom Keychain With Heart Metal Clasp And Mini Drink Bottle Charm Cute Bag Pendant For Women Girls
like
Find Similar
Detail of fluffy white fur pompom keychain with purple bead and heart-shaped gold clasp - White
Detailed shot of pink faux fur pompom keychain with gold heart clasp and sequin bottle - Pink
Detail of yellow faux fur pom pom keychain with gold heart clasp and mini drink charm - Yellow
Faux rabbit fur keychain with red pompom, mini bottle, and golden heart clasp - Red
+4
Faux Fur Pom-pom Keychain With Heart Metal Clasp And Mini Drink Bottle Charm Cute Bag Pendant For Women Girls
-9%
$0.60
No MOQ
 · 
10 sold recently
Creative Liquid Quicksand Keychain Cartoon Puppy Acrylic Bag Charm Cute Floating Animal Key Ring For Girls Women Backpack Decor Gift Accessories
Creative Liquid Quicksand Keychain Cartoon Puppy Acrylic Bag Charm Cute Floating Animal Key Ring For Girls Women Backpack Decor Gift Accessories
like
Find Similar
Pink space capsule keychain with cute cat doll and gold hardware for bag decoration - Mini Fan (Pink)
Creative liquid quicksand keychain with cute blue bear and gold lobster clasp - Mini Fan (Blue)
Sanrio Hello Kitty liquid quicksand keychain with pink character and yellow glitter - Bottle Style (Lemon Yellow)
Creative Cinnamoroll liquid keychain with floating dog in purple cup and sequins - Bottle
+37
Creative Liquid Quicksand Keychain Cartoon Puppy Acrylic Bag Charm Cute Floating Animal Key Ring For Girls Women Backpack Decor Gift Accessories
-90%
$0.84-1.21
No MOQ
 · 
365 sold recently
Top 3% Best Sellers
in Keychains
Floating Sailboat Keychain Acrylic Liquid Quicksand Moving Blue Sea Glitter Bag Car Charm Nautical Style Cute Gift Kids
Floating Sailboat Keychain Acrylic Liquid Quicksand Moving Blue Sea Glitter Bag Car Charm Nautical Style Cute Gift Kids
like
Find Similar
Floating boat liquid keychain with blue quicksand and small bell in acrylic radio frame - Television
Creative floating sailboat keychain in clock-shaped liquid bottle with blue sand and bell - Alarm Clock
Detailed macro view of acrylic sailboat keychain cup with blue liquid and star sequins - Heart Cup
Detailed shot of cat paw keychain with blue liquid glitter and cartoon character - Cat Paw
+2
Floating Sailboat Keychain Acrylic Liquid Quicksand Moving Blue Sea Glitter Bag Car Charm Nautical Style Cute Gift Kids
-8%
$1.13
No MOQ
 · 
13 sold recently
Cute Cartoon Rabbit Keychain Astronaut Space Pendant Acrylic Clear Head With Artificial Pearls Lucky Backpack Accessory For Kids Girls
Cute Cartoon Rabbit Keychain Astronaut Space Pendant Acrylic Clear Head With Artificial Pearls Lucky Backpack Accessory For Kids Girls
like
Find Similar
Cute pink and white acrylic bunny keychain with shaker pearls and beaded strap detail - Chain Style / Pink
Blue acrylic rabbit keychain featuring liquid oil heart and lucky pearl bead strap - Chain Style / Blue
Detail of bunny acrylic keychain with pink beads, gold ring and Lucky text engraving - Rabbit Style / Pink
Detail of bunny acrylic keychain featuring purple liquid oil pearls and Lucky inscription - Rabbit Style / Purple
+19
Cute Cartoon Rabbit Keychain Astronaut Space Pendant Acrylic Clear Head With Artificial Pearls Lucky Backpack Accessory For Kids Girls
-9%
$0.89-1.21
No MOQ
Cartoon Rabbit Strawberry Liquid Quicksand Keychain Acrylic Bottle Bag Charm Pink Silicone Strap
Cartoon Rabbit Strawberry Liquid Quicksand Keychain Acrylic Bottle Bag Charm Pink Silicone Strap
like
Find Similar
Pink liquid bottle keychain with bunny and strawberry inside, including a matching strap - Tea Cup
Detail of pink liquid shaker keychain featuring a cute rabbit figurine and glitter bottle - Soda Bottle
Detailed close-up of pink liquid quicksand keychain with rabbit and strawberry charm - Planet
Pink liquid strawberry bunny keychain with silicone hand strap and gold keyring bell - Milk Tea Cup
+1
Cartoon Rabbit Strawberry Liquid Quicksand Keychain Acrylic Bottle Bag Charm Pink Silicone Strap
-9%
$1.31
No MOQ
Cartoon Bear Liquid Quicksand Keychain Acrylic Floating Bottle Bag Charm With Bell Creative Cute Gift
Cartoon Bear Liquid Quicksand Keychain Acrylic Floating Bottle Bag Charm With Bell Creative Cute Gift
like
Find Similar
Cartoon white bear liquid quicksand keychain in a transparent backpack bottle with golden bell - School Bag
Star-shaped liquid sand keychain with a cute white bear and blue sequins inside - Pentagram
Close-up of liquid quicksand keychain with cute white bear and gold bell attachment - Bottle
Close-up of creative liquid milk tea keychain with white bear and blue floating glitter - Milk Tea Cup
+1
Cartoon Bear Liquid Quicksand Keychain Acrylic Floating Bottle Bag Charm With Bell Creative Cute Gift
-8%
$1.24
No MOQ
Capybara Keychain Cartoon Animal Acrylic Liquid Quicksand Bottle Pendant Bag Ornament With Gradient Strap Charm
Capybara Keychain Cartoon Animal Acrylic Liquid Quicksand Bottle Pendant Bag Ornament With Gradient Strap Charm
like
Find Similar
Creative Capybara liquid quicksand keychain with blue liquid and bubble silicone strap - Egg Style / Gradient Strap + Oil Infused Bottle
Cute Capybara liquid quicksand keychain with gradient strap and mini bottle charm - Soda Bottle Style / Gradient Strap + Oil Infused Bottle
Cute Capybara liquid quicksand keychain with blue sequins and soft gradient wrist strap - Milk Tea Cup Style / Gradient Strap + Oil Infused Bottle
Detail of Capybara bubble tea keychain with blue liquid glitter and a small bear inside - Iceberg Cup Style / Gradient Strap + Oil Infused Bottle
+1
Capybara Keychain Cartoon Animal Acrylic Liquid Quicksand Bottle Pendant Bag Ornament With Gradient Strap Charm
-9%
$1.31
No MOQ
Capybara Liquid Quicksand Keychain Acrylic Cartoon Animal Bag Charm Pendant With Sunglasses Strawberry Cute Accessory Gift
Capybara Liquid Quicksand Keychain Acrylic Cartoon Animal Bag Charm Pendant With Sunglasses Strawberry Cute Accessory Gift
like
Find Similar
Cute Capybara liquid quicksand keychain with strawberry doll in transparent acrylic cup - Light Gold Clasp + Oil Infused Bottle / Milk Tea Cup Style
Capybara quicksand liquid keychain with blue bottle and cute cartoon hamster pendant - Light Gold Clasp + Oil Infused Bottle / Cylindrical Bottle Style
Macro view of Capybara liquid keychain featuring glitter sequins and small strawberry - Light Gold Clasp + Oil Infused Bottle / Capsule Bottle Style
Creative Capybara liquid sand keychain with strawberry and blue glitter in a ball - Light Gold Clasp + Oil Infused Bottle / Peach Sphere Style
+1
Capybara Liquid Quicksand Keychain Acrylic Cartoon Animal Bag Charm Pendant With Sunglasses Strawberry Cute Accessory Gift
-9%
$1.15
No MOQ
Creative Cartoon Yellow Duck Liquid Quicksand Keychain With Bell Acrylic Resin Floating Sequins Bag Pendant Charm Gift
Creative Cartoon Yellow Duck Liquid Quicksand Keychain With Bell Acrylic Resin Floating Sequins Bag Pendant Charm Gift
like
Find Similar
Detail of liquid-filled star charm with yellow cartoon duck and golden bell keychain - Big Belly Cup Style
Close-up of yellow duck keychain with liquid, gold stars and large metal bell - Pressure Cooker Style
Close-up of yellow duck charm with purple bubble tea cup, gold bell and keychain - Milk Tea Cup Shape
Detailed close-up of cartoon yellow duck keychain with golden bell and ring - Bathtub Style
+2
Creative Cartoon Yellow Duck Liquid Quicksand Keychain With Bell Acrylic Resin Floating Sequins Bag Pendant Charm Gift
-9%
$0.96
No MOQ
 · 
14 views
Cute Little Yellow Duck Keychain Luminous Quicksand Oil Pendant Floating Bubble Beads Acrylic Silicone Strap Bag Charm
Cute Little Yellow Duck Keychain Luminous Quicksand Oil Pendant Floating Bubble Beads Acrylic Silicone Strap Bag Charm
like
Find Similar
Cute luminous little yellow duck keychain with pink glitter oil for backpack pendant charm - Fish Tank (Duck Ball)
Detail of yellow duck charm keychain with purple liquid bottle and silicone wrist strap - Purple Milk Tea Cup
Luminous rubber duck keychain with liquid sand bottle and BE PLAYFUL silicone wristlet strap - Orange Bathtub
Detail of cute yellow duck liquid quicksand keychain with pink wristband and fruit slices - Rose Red Big Belly Cup
+2
Cute Little Yellow Duck Keychain Luminous Quicksand Oil Pendant Floating Bubble Beads Acrylic Silicone Strap Bag Charm
-8%
$1.22
No MOQ
Cute Piggy Liquid Quicksand Keychain Acrylic Moving Star Sequins Bag Charm With Faux Artificial Pearl Strap And Bell For Girls
Cute Piggy Liquid Quicksand Keychain Acrylic Moving Star Sequins Bag Charm With Faux Artificial Pearl Strap And Bell For Girls
like
Find Similar
Creative milk box keychain with cute pig doll, pink liquid sand and golden star glitters - Milk Box
Detail of pink pig doll inside acrylic glitter cube with elegant pearl wrist strap - Square Bottle
Cartoon pig liquid quicksand bottle keychain with gold star sequins and pearl strap - Soda Bottle
Macro view of cloud-shaped liquid oil keychain with cute pig and pearl bead strap - Cloud
+6
Cute Piggy Liquid Quicksand Keychain Acrylic Moving Star Sequins Bag Charm With Faux Artificial Pearl Strap And Bell For Girls
-9%
$1.13-1.28
No MOQ
Astronaut Rabbit Floating Liquid Keychain Acrylic Quicksand Bag Pendant With Faux Artificial Pearl Wrist Strap
Astronaut Rabbit Floating Liquid Keychain Acrylic Quicksand Bag Pendant With Faux Artificial Pearl Wrist Strap
like
Find Similar
Floating milk bottle keychain with astronaut rabbit, liquid glitter and pearl beads - Milk Bottle Astronaut
Astronaut keychain in UFO capsule with blue floating oil and white pearl wrist strap - UFO Astronaut
Detail of floating liquid milk carton keychain with astronaut bunny and pearl chain - Milk Carton Astronaut
Detail of creative rabbit drifting bottle keychain with pearls and purple liquid charms - Square Bottle Astronaut
+1
Astronaut Rabbit Floating Liquid Keychain Acrylic Quicksand Bag Pendant With Faux Artificial Pearl Wrist Strap
-8%
$1.13
No MOQ
Dolphin Ocean Liquid Quicksand Keychain Floating Acrylic Resin Bag Charm With Faux Artificial Pearl Chain Glitter Stars
Dolphin Ocean Liquid Quicksand Keychain Floating Acrylic Resin Bag Charm With Faux Artificial Pearl Chain Glitter Stars
like
Find Similar
Ice Cream Shape - Single Buckle Style
Detail of fishbowl keychain featuring pink fish, blue base, and gold lobster clasp - Fish Tank Shape - Single Buckle Style
Detailed macro view of acrylic liquid keychain with floating fish and glitter stars - Square Shape - Single Buckle Style
Handheld ocean floating bottle acrylic keychain with red fish inside and blue bow - Lollipop Shape - Single Buckle Style
+11
Dolphin Ocean Liquid Quicksand Keychain Floating Acrylic Resin Bag Charm With Faux Artificial Pearl Chain Glitter Stars
-9%
$0.78-1.10
No MOQ
 · 
26 sold recently
Cute Cartoon Floating Liquid Quicksand Keychain Bag Pendant Acrylic Clear Glitter Keyring With Resin Animal For Women
Cute Cartoon Floating Liquid Quicksand Keychain Bag Pendant Acrylic Clear Glitter Keyring With Resin Animal For Women
like
Find Similar
Creative liquid quicksand keychain featuring floating cartoon puppy and rabbit in blue fluid - TV Shape / Silver Ring + Oil Injection Series
Blue liquid quicksand coffee cup keychain with cute white cartoon dolls and glitters - Heart Cup Shape / Silver Ring + Oil Injection Series
Blue heart-shaped liquid sand keychain with floating bunnies and cherry blossom sequins - Heart Shape / Silver Ring + Oil Injection Series
Cute liquid quicksand bottle keychain featuring floating cartoon dolls and blue glitters - Backpack Style / Silver Ring + Oil Injection Series
Cute Cartoon Floating Liquid Quicksand Keychain Bag Pendant Acrylic Clear Glitter Keyring With Resin Animal For Women
-13%
$0.92
Mix MOQ : 2
National Flag Bow Headband Polyester Large Hair Hoop For Football Soccer Match Party Fans Cheering Props Decoration
National Flag Bow Headband Polyester Large Hair Hoop For Football Soccer Match Party Fans Cheering Props Decoration
like
Find Similar
2026 World Cup US flag bow headband with stars and stripes for patriotic soccer fan support - USA (Y-00655-1)
Mexico national flag bow headband for soccer fans party and match cheering accessories - Mexico (Y-00655-2)
Canada flag bow headband with red maple leaf design for soccer fan party decorations - Canada (Y-00655-3)
Blue white and red striped bow headband accessory for 2026 World Cup soccer fans - France (Y-00655-4)
+5
National Flag Bow Headband Polyester Large Hair Hoop For Football Soccer Match Party Fans Cheering Props Decoration
-5%
$0.71
Mix MOQ : 3
 · 
50 sold recently
Soccer Theme Hanging Spiral Decorations Cardboard PVC International Tournament Style National Flags Party Ceiling Ornaments
Soccer Theme Hanging Spiral Decorations Cardboard PVC International Tournament Style National Flags Party Ceiling Ornaments
like
Find Similar
44-piece soccer party swirl decorations with national flags and golden medal cards - Set of 30 (14 Single Swirls with Cards + 16 Double Swirls)
Soccer theme party hanging swirls with world flags and gold medal football cards - Set of 15 (7 Single Swirls with Cards + 8 Double Swirls)
Soccer Theme Hanging Spiral Decorations Cardboard PVC International Tournament Style National Flags Party Ceiling Ornaments
-5%
$1.75-3.42
Mix MOQ : 5
Football Party Glasses Paper Photo Props Soccer Tournament Fan Cheering Supplies National Flag Design Novelty Fun
Football Party Glasses Paper Photo Props Soccer Tournament Fan Cheering Supplies National Flag Design Novelty Fun
like
Find Similar
Set of 6 Brazil themed football party paper glasses with soccer ball and flag designs - Brazil Style
Set of 6 Denmark flag football party glasses for world cup theme celebration - Denmark Style
Set of 6 Argentina football theme party glasses with blue and white soccer designs - Argentina Style
Pack of 6 Spain soccer party glasses with football frames for World Cup fans - Spain Style
+4
Football Party Glasses Paper Photo Props Soccer Tournament Fan Cheering Supplies National Flag Design Novelty Fun
-5%
$1.45
Mix MOQ : 30
Soccer Football Cupcake Toppers And Wrappers Paper Party Decorations For Sports Birthday Theme Tournament Celebration
Soccer Football Cupcake Toppers And Wrappers Paper Party Decorations For Sports Birthday Theme Tournament Celebration
like
Find Similar
Soccer theme cupcake toppers set with Goal text, trophy, and scoreboard for parties - Football Theme Round Cupcake Toppers
Football theme cupcake wrappers featuring GOAL text and green soccer ball patterns - Football Theme Wavy Cupcake Wrappers
Soccer Football Cupcake Toppers And Wrappers Paper Party Decorations For Sports Birthday Theme Tournament Celebration
-5%
$0.80-1.26
Mix MOQ : 50
Mother's Day Hanging Decorations Floral Heart Cardboard Tags Jute Ropes Party Ornaments Best Mom Gift Decor
Mother's Day Hanging Decorations Floral Heart Cardboard Tags Jute Ropes Party Ornaments Best Mom Gift Decor
like
Find Similar
Set of 10 pastel Happy Mother's Day hanging ornaments with rustic twine strings - Mother's Day Floral Shaped Tags And Hemp Ropes (L-00114-1)
Mother's Day Hanging Decorations Floral Heart Cardboard Tags Jute Ropes Party Ornaments Best Mom Gift Decor
-4%
$0.82
Mix MOQ : 2
Wine Glass Decoration Cards New Year Party Paper Ornaments Black Gold Happy New Year Best Wishes Festive Decor
Wine Glass Decoration Cards New Year Party Paper Ornaments Black Gold Happy New Year Best Wishes Festive Decor
like
Find Similar
12-piece black and gold New Year party wine glass cards and festive table decorations - New Year Decorative Card Set (L-00204)
Wine Glass Decoration Cards New Year Party Paper Ornaments Black Gold Happy New Year Best Wishes Festive Decor
-5%
$0.55
Mix MOQ : 5
Halloween Party Water Bottle Labels Waterproof Self Adhesive Pumpkin Witch Ghost Decorative Stickers Novelty
Halloween Party Water Bottle Labels Waterproof Self Adhesive Pumpkin Witch Ghost Decorative Stickers Novelty
like
Find Similar
12-piece Halloween water bottle sticker set with blackboard style spooky designs - Halloween Creative Multi-Style Collection (J-0361)
Halloween Party Water Bottle Labels Waterproof Self Adhesive Pumpkin Witch Ghost Decorative Stickers Novelty
-4%
$1.34
Mix MOQ : 5
Free Shipping
Christmas Spiral Hanging Decorations Double Sided Paper Gingerbread Man Santa Claus Party Ceiling Decor Festive Ornaments
Christmas Spiral Hanging Decorations Double Sided Paper Gingerbread Man Santa Claus Party Ceiling Decor Festive Ornaments
like
Find Similar
Christmas spiral hanging ornaments featuring gingerbread man and Santa Claus designs - Spiral Set (9 Cards + 9 Spirals + Hooks)
NewChristmas Spiral Hanging Decorations Double Sided Paper Gingerbread Man Santa Claus Party Ceiling Decor Festive Ornaments
-5%
$1.86
Mix MOQ : 5
Happy Retirement Hanging Swirl Decorations Black Gold Cardstock Ceiling Ornaments For Party Supplies
Happy Retirement Hanging Swirl Decorations Black Gold Cardstock Ceiling Ornaments For Party Supplies
like
Find Similar
Gold and black spiral hanging decorations set for Happy Retirement party atmosphere - Cards, Single Swirls and Double Swirls(Y-00036)
Happy Retirement Hanging Swirl Decorations Black Gold Cardstock Ceiling Ornaments For Party Supplies
-4%
$2.00
Mix MOQ : 5
Happy Retirement Party Decorative Paper Glasses Black Gold Glitter Funny Photo Props Novelty Eye Wear For Adults Farewell Celebration
Happy Retirement Party Decorative Paper Glasses Black Gold Glitter Funny Photo Props Novelty Eye Wear For Adults Farewell Celebration
like
Find Similar
8-piece black and gold paper retirement party photo booth eyewear with various designs - Retirement Party Style (J-0517)
Happy Retirement Party Decorative Paper Glasses Black Gold Glitter Funny Photo Props Novelty Eye Wear For Adults Farewell Celebration
-5%
$1.70
Mix MOQ : 5
Retirement Party Honeycomb Centerpieces Black Gold Paper Desktop Decorations For Farewell Celebration Office Home Event
Retirement Party Honeycomb Centerpieces Black Gold Paper Desktop Decorations For Farewell Celebration Office Home Event
like
Find Similar
9-piece black and gold retirement honeycomb centerpieces featuring Happy Retirement slogans - 9Pcs Retirement Honeycomb (Y-00563)
Retirement Party Honeycomb Centerpieces Black Gold Paper Desktop Decorations For Farewell Celebration Office Home Event
-4%
$3.92
Mix MOQ : 5
Baguette Cut Cubic Zirconia Tennis Necklace Copper 18K Gold Plated Elegant Rainbow Choker Jewelry Accessory For Women
Baguette Cut Cubic Zirconia Tennis Necklace Copper 18K Gold Plated Elegant Rainbow Choker Jewelry Accessory For Women
like
Find Similar
Rainbow claw chain choker necklace with black rectangular zirconia and gold finish - 18K Gold 2.5*5mm Horizontal Black
Tennis style golden necklace with emerald green rectangular cut crystals on white background - 18K Gold 2.5*5mm Horizontal Green
Golden tennis necklace featuring rectangle cut dark red rubies in a claw setting design - 18K Gold 2.5*5mm Horizontal Rose Red
Elegant gold-tone choker featuring rectangular pink crystals with adjustable lobster clasp - 18K Gold 2.5*5mm Horizontal Pink
+4
Baguette Cut Cubic Zirconia Tennis Necklace Copper 18K Gold Plated Elegant Rainbow Choker Jewelry Accessory For Women
$3.69-4.93
No MOQ
 · 
258 sold recently
Free Shipping
Women Large Capacity Tote Bag Pebbled PU Leather Retro Flap Design Commuter Handbag Solid Color
Women Large Capacity Tote Bag Pebbled PU Leather Retro Flap Design Commuter Handbag Solid Color
like
Find Similar
Minimalist dark brown lychee leather tote bag with unique cutout flap handle design - Brown
Brown lychee-grain leather tote bag with unique flap-over top handle design - Khaki
Large black tote bag in litchi grain leather with flap closure and sturdy handles - Black
Women Large Capacity Tote Bag Pebbled PU Leather Retro Flap Design Commuter Handbag Solid Color
$7.49
No MOQ
Women Canvas Tote Bag Large Capacity Shoulder Crossbody Bag With Faux Leather Straps French Retro Style Commute Handbag
Women Canvas Tote Bag Large Capacity Shoulder Crossbody Bag With Faux Leather Straps French Retro Style Commute Handbag
like
Find Similar
Minimalist large black canvas tote bag with leather trim and silver metal buckle details - Black
Retro canvas tote bag in cream with dark brown faux leather trim and silver buckles - White
French style dark blue denim tote bag with brown leather straps and vintage buckle design - Dark Blue
Blue canvas tote bag with brown leather straps and metal buckles for casual daily commuting - Light Blue
+1
Women Canvas Tote Bag Large Capacity Shoulder Crossbody Bag With Faux Leather Straps French Retro Style Commute Handbag
$8.36
No MOQ
Retro Matte PU Leather Underarm Bag Vintage Large Capacity Tote Commuter Handbag With Belt Buckle And Detachable Strap
Retro Matte PU Leather Underarm Bag Vintage Large Capacity Tote Commuter Handbag With Belt Buckle And Detachable Strap
like
Find Similar
Retro black matte leather shoulder bag with decorative silver buckle straps for women - Black
Retro dark red underarm bag in matte suede leather with decorative buckles and crossbody strap - Burgundy
Retro dark brown matte shoulder bag with silver buckles and adjustable crossbody strap - Brown
Retro brown suede underarm bag with vintage texture and adjustable decorative buckles - Brown
Retro Matte PU Leather Underarm Bag Vintage Large Capacity Tote Commuter Handbag With Belt Buckle And Detachable Strap
$10.37
No MOQ
Woven Texture Underarm Bag For Women Retro PU Leather Shoulder Bag Large Capacity Elegant Fashion Commuter Handbag
Woven Texture Underarm Bag For Women Retro PU Leather Shoulder Bag Large Capacity Elegant Fashion Commuter Handbag
like
Find Similar
Chic 2025 large capacity shoulder bags in six earthy tones with woven texture details - Green
Brown woven texture large capacity shoulder bag for women on a stylish leather chair - Brown
Brown woven texture bowling bag with dark leather straps and gold zipper detail - Brown
Retro black woven handbag with brown leather straps and gold metal clasp decoration - Black
+2
Woven Texture Underarm Bag For Women Retro PU Leather Shoulder Bag Large Capacity Elegant Fashion Commuter Handbag
$10.09
No MOQ
Brass 18K Gold Plated Zircon Dessert Candy Ice Cream Lollipop Heart Stud Earrings For Women Girls Cute Jewelry Accessory
Brass 18K Gold Plated Zircon Dessert Candy Ice Cream Lollipop Heart Stud Earrings For Women Girls Cute Jewelry Accessory
like
Find Similar
Detailed view of 5-piece summer dessert earring set with ice cream and cocktail designs - Dessert Style (18K Gold Plated) / Gold/Pink
Brass 18K Gold Plated Zircon Dessert Candy Ice Cream Lollipop Heart Stud Earrings For Women Girls Cute Jewelry Accessory
$3.62
No MOQ
 · 
19 views
Free Shipping
Rhinestone Necklace And Earrings Copper Acrylic Silver Plated Bridal Wedding Elegant Water Drop Pendant Women
Rhinestone Necklace And Earrings Copper Acrylic Silver Plated Bridal Wedding Elegant Water Drop Pendant Women
like
Find Similar
Sparkling bridal jewelry set with silver teardrop crystal necklace and earrings - White
Sparkling bridal jewelry set featuring a blue gemstone necklace and drop earrings on a bust - Sapphire Blue
Sparkling bridal jewelry set featuring red teardrop rhinestones on necklace and earrings - Red
Silver bridal jewelry set with sparkling black teardrop rhinestones and V-neck necklace - Black
+3
Rhinestone Necklace And Earrings Copper Acrylic Silver Plated Bridal Wedding Elegant Water Drop Pendant Women
$1.44-3.80
No MOQ
 · 
12 views
Free Shipping
Elegant Bowknot Choker Necklace Rhinestone Tassel Alloy Multilayer Sparkling French Style Jewelry For Women
Elegant Bowknot Choker Necklace Rhinestone Tassel Alloy Multilayer Sparkling French Style Jewelry For Women
like
Find Similar
Sparkling multi-layer rhinestone bow necklace with silver tassels and choker style - Silver
Elegant Bowknot Choker Necklace Rhinestone Tassel Alloy Multilayer Sparkling French Style Jewelry For Women
$2.57
No MOQ
Free Shipping
Women Ruched PU Leather Hobo Bag Retro Large Capacity Croissant Shoulder Bag With Knot Strap Vintage Commuter Purse
Women Ruched PU Leather Hobo Bag Retro Large Capacity Croissant Shoulder Bag With Knot Strap Vintage Commuter Purse
like
Find Similar
Dark brown slouchy croissant shoulder bag with signature knotted strap detail - Brown
Brown croissant shoulder bag with pleated texture and stylish knotted strap for women - Khaki
Minimalist black croissant bag featuring pleated vegan leather and knotted shoulder strap - Black
Vintage dark brown crescent shoulder bag with pleated leather texture and knotted strap detail - Brown
Women Ruched PU Leather Hobo Bag Retro Large Capacity Croissant Shoulder Bag With Knot Strap Vintage Commuter Purse
$8.65
No MOQ
Vintage Glossy PU Leather Shoulder Bag For Women Large Capacity Multi Pocket Metal Turn Lock Retro Tote Handbag
Vintage Glossy PU Leather Shoulder Bag For Women Large Capacity Multi Pocket Metal Turn Lock Retro Tote Handbag
like
Find Similar
Detail of vintage brown satchel bag with multiple front pockets and metal twist locks - With Pendant / Brown
Retro black glossy tote bag with silver metal locks and decorative tassel on cream chair - With Pendant / Black
Retro chocolate brown glossy leather tote bag with multi-pockets and silver hardware - With Pendant / Brown
Close-up of a vintage dark brown leather shoulder bag with sleek silver metal twist locks - No Pendant / Brown
+2
Vintage Glossy PU Leather Shoulder Bag For Women Large Capacity Multi Pocket Metal Turn Lock Retro Tote Handbag
$12.10-12.68
No MOQ
Crocodile Embossed PU Leather Tote Bag Large Capacity Retro Minimalist Commute Women Underarm Shoulder Bag
Crocodile Embossed PU Leather Tote Bag Large Capacity Retro Minimalist Commute Women Underarm Shoulder Bag
like
Find Similar
Dark brown tote bag with crocodile texture and long shoulder straps in a minimalist style - Brown
Khaki large-capacity tote bag with crocodile pattern and long shoulder strap - Green
Minimalist black crocodile pattern faux leather tote bag with long shoulder straps - Black
Classic caramel brown crocodile embossed large tote bag for daily commute and casual style - Yellow Brown
Crocodile Embossed PU Leather Tote Bag Large Capacity Retro Minimalist Commute Women Underarm Shoulder Bag
$9.51
No MOQ
Vintage Octopus Tentacle Dragon Snake Open Adjustable Rings Alloy Gothic Punk Rock Jewelry For Men Women
Vintage Octopus Tentacle Dragon Snake Open Adjustable Rings Alloy Gothic Punk Rock Jewelry For Men Women
like
Find Similar
Close-up of vintage silver ring with engraved auspicious cloud patterns and open band - Golden Hoop Staff
Vintage silver octopus tentacle open ring with detailed suckers in steampunk style - Octopus
Detailed close-up of retro silver dragon claw ring showing scale texture and open band - Eagle Claw
Vintage punk dragon claw ring in silver finish with adjustable open band for men - Four Prong
+14
Vintage Octopus Tentacle Dragon Snake Open Adjustable Rings Alloy Gothic Punk Rock Jewelry For Men Women
$0.05-0.58
No MOQ
 · 
407 sold recently
Top 10% Best Sellers
in Rings
Cute Plush Tablet Sleeve Kawaii Cartoon Bear Bunny Embroidery Protective Bag Korean Style Soft Electronics Case
Cute Plush Tablet Sleeve Kawaii Cartoon Bear Bunny Embroidery Protective Bag Korean Style Soft Electronics Case
like
Find Similar
Detail of white plush rabbit 11 inch iPad bag featuring cute embroidery and soft ears - 9.7/10.5/11 Inch Universal / White Rabbit Donut Style / White
Cute brown plush 11-inch iPad sleeve featuring embroidered bear face and orange motif - 9.7/10.5/11 Inch Universal / Brown Curly Bear Orange Style / Brown
Cute Plush Tablet Sleeve Kawaii Cartoon Bear Bunny Embroidery Protective Bag Korean Style Soft Electronics Case
-9%
$4.06
Mix MOQ : 2
Elegant Rhinestone Necklace And Earrings Round Zircon Flower Pendant Wedding Party Bridal For Women Silver White
Elegant Rhinestone Necklace And Earrings Round Zircon Flower Pendant Wedding Party Bridal For Women Silver White
like
Find Similar
Elegant silver jewelry set with crystal necklace and earrings on model for evening wear - Silver
Elegant Rhinestone Necklace And Earrings Round Zircon Flower Pendant Wedding Party Bridal For Women Silver White
$1.75
No MOQ
 · 
23 views
Free Shipping
Teardrop Necklace Earrings Bracelet Alloy Rhinestone Zircon Elegant Bridal Wedding Party Luxury Fashion Accessories For Women
Teardrop Necklace Earrings Bracelet Alloy Rhinestone Zircon Elegant Bridal Wedding Party Luxury Fashion Accessories For Women
like
Find Similar
Sparkling crystal necklace, earrings and bracelet set in silver finish for brides - Silver Rhinestone Three-Piece Set (446+Single Row)
Detailed view of silver bridal jewelry set with V-pendant necklace and sparkly crystals - Silver Double-Row Rhinestone Three-Piece Set (446+Double Row)
Silver water drop necklace and earrings bridal jewelry set with sparkling rhinestones - Silver Double-Row Rhinestone Water Drop Set (463+Double Row)
Elegant silver-tone jewelry set featuring teardrop crystal necklace and long drop earrings - Silver Triple-Row Rhinestone Three-Piece Set (446+Triple Row)
+13
Teardrop Necklace Earrings Bracelet Alloy Rhinestone Zircon Elegant Bridal Wedding Party Luxury Fashion Accessories For Women
-5%
$1.49-4.61
No MOQ
 · 
148 sold recently
Women Round Neck T-shirt Cotton Short Sleeve Loose Fit Books Coffee Graphic Print Casual Summer Commuter Slogan Tee
Women Round Neck T-shirt Cotton Short Sleeve Loose Fit Books Coffee Graphic Print Casual Summer Commuter Slogan Tee
like
Find Similar
Close-up of beige cotton T-shirt featuring 'no such thing as too many books' print - S / Sand (Black Text)
Detail of grey cotton T-shirt featuring white book stack and coffee cup graphic print - S / Dark Grey (White Text)
Detail of grey cotton T-shirt featuring artistic coffee cup and book stack graphic print - S / Dark Grey (Black Text)
Detail of yellow cotton T-shirt featuring 'there is no such thing as too many books' print - S / Mustard Yellow (Black Text)
+158
Women Round Neck T-shirt Cotton Short Sleeve Loose Fit Books Coffee Graphic Print Casual Summer Commuter Slogan Tee
-4%
$5.75
No MOQ
Kitchen Wall Stickers Waterproof PVC Bohemian Hand Drawn Kitchenware Decals Heart Of The Home Quote Removable Decorative
Kitchen Wall Stickers Waterproof PVC Bohemian Hand Drawn Kitchenware Decals Heart Of The Home Quote Removable Decorative
like
Find Similar
Detail view of Kitchen Heart of Home wall sticker dimensions and layout size - Kitchen Utensils & Quote Style (MS3098-YL)
Kitchen Wall Stickers Waterproof PVC Bohemian Hand Drawn Kitchenware Decals Heart Of The Home Quote Removable Decorative
$1.24
Mix MOQ : 2
Cotton Blend Crew Socks Funny Fried Egg Pattern Creative Streetwear Casual Breathable Soft For Men Women
Cotton Blend Crew Socks Funny Fried Egg Pattern Creative Streetwear Casual Breathable Soft For Men Women
like
Find Similar
Classic black and white checkered crew socks with ribbed cuffs and white cotton heels - EU 39-46 / Black White Grid
Mid-calf cotton socks featuring 3D geometric block pattern in purple and orange - EU 39-46 / Purple 3D Geometric Blocks
Funny mid-calf cotton socks with fried egg print and yellow contrast heel and toe - EU 39-46 / Poached Egg Pattern
Men's crew socks with black white and grey geometric chevron patterns and stripes - EU 39-46 / Black and White Chevron Stripes
+2
Cotton Blend Crew Socks Funny Fried Egg Pattern Creative Streetwear Casual Breathable Soft For Men Women
-5%
$1.23
No MOQ
Bridal Jewelry Necklace Bracelet And Earrings Alloy Silver Plated Rhinestone Zircon Teardrop Wedding Evening Party Women
Bridal Jewelry Necklace Bracelet And Earrings Alloy Silver Plated Rhinestone Zircon Teardrop Wedding Evening Party Women
like
Find Similar
Elegant silver bridal jewelry set with sparkling teardrop crystals on a dark background - 501+600 Stud Earrings 3-Piece Set / Silver
Elegant silver bridal jewelry set with sparkling rhinestones necklace bracelet and earrings - 776+446 Clip-on Earrings 3-Piece Set / Silver
Elegant bridal jewelry set with silver necklace, bracelet, and earrings featuring sparkling crystals - 463+600 Stud Earrings 3-Piece Set / Silver
Elegant gold-plated jewelry set with sparkling crystals for bridal or wedding events - 446 Gold 2-Piece Set
+11
Bridal Jewelry Necklace Bracelet And Earrings Alloy Silver Plated Rhinestone Zircon Teardrop Wedding Evening Party Women
-5%
$1.19-3.98
No MOQ
 · 
22 views
Canvas Tote Bag Women Large Capacity Hand Drawn Cartoon Doodle Print Korean Style Shoulder Handbag For School Casual
Canvas Tote Bag Women Large Capacity Hand Drawn Cartoon Doodle Print Korean Style Shoulder Handbag For School Casual
like
Find Similar
Minimalist canvas tote bag with black grid graffiti patterns and wide shoulder straps - Large / Beige (Printed)
Canvas Tote Bag Women Large Capacity Hand Drawn Cartoon Doodle Print Korean Style Shoulder Handbag For School Casual
-4%
$3.43
No MOQ
Canvas Tote Bag Women Shoulder Shopping Bag With Zipper Inner Pocket Lemon Flower Vase Print Casual Eco Friendly
Canvas Tote Bag Women Shoulder Shopping Bag With Zipper Inner Pocket Lemon Flower Vase Print Casual Eco Friendly
like
Find Similar
White canvas tote bag featuring hand-drawn sunflower and blue vase illustration - Vase Pattern (White)
White canvas tote bag featuring fresh lemon soda illustration for daily styling - Lemon Cup Pattern (White)
Canvas Tote Bag Women Shoulder Shopping Bag With Zipper Inner Pocket Lemon Flower Vase Print Casual Eco Friendly
-4%
$2.68
No MOQ
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access