Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Cute Cartoon Rabbit Keychain Astronaut Space Pendant Acrylic Clear Head With Artificial Pearls Lucky Backpack Accessory For Kids Girls
Cute Cartoon Rabbit Keychain Astronaut Space Pendant Acrylic Clear Head With Artificial Pearls Lucky Backpack Accessory For Kids Girls
like
Find Similar
Cute pink and white acrylic bunny keychain with shaker pearls and beaded strap detail - Chain Style / Pink
Blue acrylic rabbit keychain featuring liquid oil heart and lucky pearl bead strap - Chain Style / Blue
Detail of bunny acrylic keychain with pink beads, gold ring and Lucky text engraving - Rabbit Style / Pink
Detail of bunny acrylic keychain featuring purple liquid oil pearls and Lucky inscription - Rabbit Style / Purple
+19
Cute Cartoon Rabbit Keychain Astronaut Space Pendant Acrylic Clear Head With Artificial Pearls Lucky Backpack Accessory For Kids Girls
-9%
$0.89-1.21
No MOQ
Cartoon Rabbit Strawberry Liquid Quicksand Keychain Acrylic Bottle Bag Charm Pink Silicone Strap
Cartoon Rabbit Strawberry Liquid Quicksand Keychain Acrylic Bottle Bag Charm Pink Silicone Strap
like
Find Similar
Pink liquid bottle keychain with bunny and strawberry inside, including a matching strap - Tea Cup
Detail of pink liquid shaker keychain featuring a cute rabbit figurine and glitter bottle - Soda Bottle
Detailed close-up of pink liquid quicksand keychain with rabbit and strawberry charm - Planet
Pink liquid strawberry bunny keychain with silicone hand strap and gold keyring bell - Milk Tea Cup
+1
Cartoon Rabbit Strawberry Liquid Quicksand Keychain Acrylic Bottle Bag Charm Pink Silicone Strap
-9%
$1.31
No MOQ
Cartoon Bear Liquid Quicksand Keychain Acrylic Floating Bottle Bag Charm With Bell Creative Cute Gift
Cartoon Bear Liquid Quicksand Keychain Acrylic Floating Bottle Bag Charm With Bell Creative Cute Gift
like
Find Similar
Cartoon white bear liquid quicksand keychain in a transparent backpack bottle with golden bell - School Bag
Star-shaped liquid sand keychain with a cute white bear and blue sequins inside - Pentagram
Close-up of liquid quicksand keychain with cute white bear and gold bell attachment - Bottle
Close-up of creative liquid milk tea keychain with white bear and blue floating glitter - Milk Tea Cup
+1
Cartoon Bear Liquid Quicksand Keychain Acrylic Floating Bottle Bag Charm With Bell Creative Cute Gift
-8%
$1.24
No MOQ
Capybara Keychain Cartoon Animal Acrylic Liquid Quicksand Bottle Pendant Bag Ornament With Gradient Strap Charm
Capybara Keychain Cartoon Animal Acrylic Liquid Quicksand Bottle Pendant Bag Ornament With Gradient Strap Charm
like
Find Similar
Creative Capybara liquid quicksand keychain with blue liquid and bubble silicone strap - Egg Style / Gradient Strap + Oil Infused Bottle
Cute Capybara liquid quicksand keychain with gradient strap and mini bottle charm - Soda Bottle Style / Gradient Strap + Oil Infused Bottle
Cute Capybara liquid quicksand keychain with blue sequins and soft gradient wrist strap - Milk Tea Cup Style / Gradient Strap + Oil Infused Bottle
Detail of Capybara bubble tea keychain with blue liquid glitter and a small bear inside - Iceberg Cup Style / Gradient Strap + Oil Infused Bottle
+1
Capybara Keychain Cartoon Animal Acrylic Liquid Quicksand Bottle Pendant Bag Ornament With Gradient Strap Charm
-9%
$1.31
No MOQ
Capybara Liquid Quicksand Keychain Acrylic Cartoon Animal Bag Charm Pendant With Sunglasses Strawberry Cute Accessory Gift
Capybara Liquid Quicksand Keychain Acrylic Cartoon Animal Bag Charm Pendant With Sunglasses Strawberry Cute Accessory Gift
like
Find Similar
Cute Capybara liquid quicksand keychain with strawberry doll in transparent acrylic cup - Light Gold Clasp + Oil Infused Bottle / Milk Tea Cup Style
Capybara quicksand liquid keychain with blue bottle and cute cartoon hamster pendant - Light Gold Clasp + Oil Infused Bottle / Cylindrical Bottle Style
Macro view of Capybara liquid keychain featuring glitter sequins and small strawberry - Light Gold Clasp + Oil Infused Bottle / Capsule Bottle Style
Creative Capybara liquid sand keychain with strawberry and blue glitter in a ball - Light Gold Clasp + Oil Infused Bottle / Peach Sphere Style
+1
Capybara Liquid Quicksand Keychain Acrylic Cartoon Animal Bag Charm Pendant With Sunglasses Strawberry Cute Accessory Gift
-9%
$1.15
No MOQ
Creative Cartoon Yellow Duck Liquid Quicksand Keychain With Bell Acrylic Resin Floating Sequins Bag Pendant Charm Gift
Creative Cartoon Yellow Duck Liquid Quicksand Keychain With Bell Acrylic Resin Floating Sequins Bag Pendant Charm Gift
like
Find Similar
Detail of liquid-filled star charm with yellow cartoon duck and golden bell keychain - Big Belly Cup Style
Close-up of yellow duck keychain with liquid, gold stars and large metal bell - Pressure Cooker Style
Close-up of yellow duck charm with purple bubble tea cup, gold bell and keychain - Milk Tea Cup Shape
Detailed close-up of cartoon yellow duck keychain with golden bell and ring - Bathtub Style
+2
Creative Cartoon Yellow Duck Liquid Quicksand Keychain With Bell Acrylic Resin Floating Sequins Bag Pendant Charm Gift
-9%
$0.96
No MOQ
 · 
14 views
Cute Little Yellow Duck Keychain Luminous Quicksand Oil Pendant Floating Bubble Beads Acrylic Silicone Strap Bag Charm
Cute Little Yellow Duck Keychain Luminous Quicksand Oil Pendant Floating Bubble Beads Acrylic Silicone Strap Bag Charm
like
Find Similar
Cute luminous little yellow duck keychain with pink glitter oil for backpack pendant charm - Fish Tank (Duck Ball)
Detail of yellow duck charm keychain with purple liquid bottle and silicone wrist strap - Purple Milk Tea Cup
Luminous rubber duck keychain with liquid sand bottle and BE PLAYFUL silicone wristlet strap - Orange Bathtub
Detail of cute yellow duck liquid quicksand keychain with pink wristband and fruit slices - Rose Red Big Belly Cup
+2
Cute Little Yellow Duck Keychain Luminous Quicksand Oil Pendant Floating Bubble Beads Acrylic Silicone Strap Bag Charm
-8%
$1.22
No MOQ
Cute Piggy Liquid Quicksand Keychain Acrylic Moving Star Sequins Bag Charm With Faux Artificial Pearl Strap And Bell For Girls
Cute Piggy Liquid Quicksand Keychain Acrylic Moving Star Sequins Bag Charm With Faux Artificial Pearl Strap And Bell For Girls
like
Find Similar
Creative milk box keychain with cute pig doll, pink liquid sand and golden star glitters - Milk Box
Detail of pink pig doll inside acrylic glitter cube with elegant pearl wrist strap - Square Bottle
Cartoon pig liquid quicksand bottle keychain with gold star sequins and pearl strap - Soda Bottle
Macro view of cloud-shaped liquid oil keychain with cute pig and pearl bead strap - Cloud
+6
Cute Piggy Liquid Quicksand Keychain Acrylic Moving Star Sequins Bag Charm With Faux Artificial Pearl Strap And Bell For Girls
-9%
$1.13-1.28
No MOQ
Astronaut Rabbit Floating Liquid Keychain Acrylic Quicksand Bag Pendant With Faux Artificial Pearl Wrist Strap
Astronaut Rabbit Floating Liquid Keychain Acrylic Quicksand Bag Pendant With Faux Artificial Pearl Wrist Strap
like
Find Similar
Floating milk bottle keychain with astronaut rabbit, liquid glitter and pearl beads - Milk Bottle Astronaut
Astronaut keychain in UFO capsule with blue floating oil and white pearl wrist strap - UFO Astronaut
Detail of floating liquid milk carton keychain with astronaut bunny and pearl chain - Milk Carton Astronaut
Detail of creative rabbit drifting bottle keychain with pearls and purple liquid charms - Square Bottle Astronaut
+1
Astronaut Rabbit Floating Liquid Keychain Acrylic Quicksand Bag Pendant With Faux Artificial Pearl Wrist Strap
-8%
$1.13
No MOQ
Dolphin Ocean Liquid Quicksand Keychain Floating Acrylic Resin Bag Charm With Faux Artificial Pearl Chain Glitter Stars
Dolphin Ocean Liquid Quicksand Keychain Floating Acrylic Resin Bag Charm With Faux Artificial Pearl Chain Glitter Stars
like
Find Similar
Ice Cream Shape - Single Buckle Style
Detail of fishbowl keychain featuring pink fish, blue base, and gold lobster clasp - Fish Tank Shape - Single Buckle Style
Detailed macro view of acrylic liquid keychain with floating fish and glitter stars - Square Shape - Single Buckle Style
Handheld ocean floating bottle acrylic keychain with red fish inside and blue bow - Lollipop Shape - Single Buckle Style
+11
Dolphin Ocean Liquid Quicksand Keychain Floating Acrylic Resin Bag Charm With Faux Artificial Pearl Chain Glitter Stars
-9%
$0.78-1.10
No MOQ
 · 
26 sold recently
Cute Cartoon Floating Liquid Quicksand Keychain Bag Pendant Acrylic Clear Glitter Keyring With Resin Animal For Women
Cute Cartoon Floating Liquid Quicksand Keychain Bag Pendant Acrylic Clear Glitter Keyring With Resin Animal For Women
like
Find Similar
Creative liquid quicksand keychain featuring floating cartoon puppy and rabbit in blue fluid - TV Shape / Silver Ring + Oil Injection Series
Blue liquid quicksand coffee cup keychain with cute white cartoon dolls and glitters - Heart Cup Shape / Silver Ring + Oil Injection Series
Blue heart-shaped liquid sand keychain with floating bunnies and cherry blossom sequins - Heart Shape / Silver Ring + Oil Injection Series
Cute liquid quicksand bottle keychain featuring floating cartoon dolls and blue glitters - Backpack Style / Silver Ring + Oil Injection Series
Cute Cartoon Floating Liquid Quicksand Keychain Bag Pendant Acrylic Clear Glitter Keyring With Resin Animal For Women
-13%
$0.92
Mix MOQ : 2
National Flag Bow Headband Polyester Large Hair Hoop For Football Soccer Match Party Fans Cheering Props Decoration
National Flag Bow Headband Polyester Large Hair Hoop For Football Soccer Match Party Fans Cheering Props Decoration
like
Find Similar
2026 World Cup US flag bow headband with stars and stripes for patriotic soccer fan support - USA (Y-00655-1)
Mexico national flag bow headband for soccer fans party and match cheering accessories - Mexico (Y-00655-2)
Canada flag bow headband with red maple leaf design for soccer fan party decorations - Canada (Y-00655-3)
Blue white and red striped bow headband accessory for 2026 World Cup soccer fans - France (Y-00655-4)
+5
National Flag Bow Headband Polyester Large Hair Hoop For Football Soccer Match Party Fans Cheering Props Decoration
-5%
$0.71
Mix MOQ : 3
 · 
50 sold recently
Soccer Theme Hanging Spiral Decorations Cardboard PVC International Tournament Style National Flags Party Ceiling Ornaments
Soccer Theme Hanging Spiral Decorations Cardboard PVC International Tournament Style National Flags Party Ceiling Ornaments
like
Find Similar
44-piece soccer party swirl decorations with national flags and golden medal cards - Set of 30 (14 Single Swirls with Cards + 16 Double Swirls)
Soccer theme party hanging swirls with world flags and gold medal football cards - Set of 15 (7 Single Swirls with Cards + 8 Double Swirls)
Soccer Theme Hanging Spiral Decorations Cardboard PVC International Tournament Style National Flags Party Ceiling Ornaments
-5%
$1.75-3.42
Mix MOQ : 5
Football Party Glasses Paper Photo Props Soccer Tournament Fan Cheering Supplies National Flag Design Novelty Fun
Football Party Glasses Paper Photo Props Soccer Tournament Fan Cheering Supplies National Flag Design Novelty Fun
like
Find Similar
Set of 6 Brazil themed football party paper glasses with soccer ball and flag designs - Brazil Style
Set of 6 Denmark flag football party glasses for world cup theme celebration - Denmark Style
Set of 6 Argentina football theme party glasses with blue and white soccer designs - Argentina Style
Pack of 6 Spain soccer party glasses with football frames for World Cup fans - Spain Style
+4
Football Party Glasses Paper Photo Props Soccer Tournament Fan Cheering Supplies National Flag Design Novelty Fun
-5%
$1.45
Mix MOQ : 30
Soccer Football Cupcake Toppers And Wrappers Paper Party Decorations For Sports Birthday Theme Tournament Celebration
Soccer Football Cupcake Toppers And Wrappers Paper Party Decorations For Sports Birthday Theme Tournament Celebration
like
Find Similar
Soccer theme cupcake toppers set with Goal text, trophy, and scoreboard for parties - Football Theme Round Cupcake Toppers
Football theme cupcake wrappers featuring GOAL text and green soccer ball patterns - Football Theme Wavy Cupcake Wrappers
Soccer Football Cupcake Toppers And Wrappers Paper Party Decorations For Sports Birthday Theme Tournament Celebration
$0.84-1.33
Mix MOQ : 50
Mother's Day Hanging Decorations Floral Heart Cardboard Tags Jute Ropes Party Ornaments Best Mom Gift Decor
Mother's Day Hanging Decorations Floral Heart Cardboard Tags Jute Ropes Party Ornaments Best Mom Gift Decor
like
Find Similar
Set of 10 pastel Happy Mother's Day hanging ornaments with rustic twine strings - Mother's Day Floral Shaped Tags And Hemp Ropes (L-00114-1)
Mother's Day Hanging Decorations Floral Heart Cardboard Tags Jute Ropes Party Ornaments Best Mom Gift Decor
-4%
$0.82
Mix MOQ : 2
Wine Glass Decoration Cards New Year Party Paper Ornaments Black Gold Happy New Year Best Wishes Festive Decor
Wine Glass Decoration Cards New Year Party Paper Ornaments Black Gold Happy New Year Best Wishes Festive Decor
like
Find Similar
12-piece black and gold New Year party wine glass cards and festive table decorations - New Year Decorative Card Set (L-00204)
Wine Glass Decoration Cards New Year Party Paper Ornaments Black Gold Happy New Year Best Wishes Festive Decor
-5%
$0.55
Mix MOQ : 5
Halloween Party Water Bottle Labels Waterproof Self Adhesive Pumpkin Witch Ghost Decorative Stickers Novelty
Halloween Party Water Bottle Labels Waterproof Self Adhesive Pumpkin Witch Ghost Decorative Stickers Novelty
like
Find Similar
12-piece Halloween water bottle sticker set with blackboard style spooky designs - Halloween Creative Multi-Style Collection (J-0361)
Halloween Party Water Bottle Labels Waterproof Self Adhesive Pumpkin Witch Ghost Decorative Stickers Novelty
-4%
$1.34
Mix MOQ : 5
Free Shipping
Christmas Spiral Hanging Decorations Double Sided Paper Gingerbread Man Santa Claus Party Ceiling Decor Festive Ornaments
Christmas Spiral Hanging Decorations Double Sided Paper Gingerbread Man Santa Claus Party Ceiling Decor Festive Ornaments
like
Find Similar
Christmas spiral hanging ornaments featuring gingerbread man and Santa Claus designs - Spiral Set (9 Cards + 9 Spirals + Hooks)
NewChristmas Spiral Hanging Decorations Double Sided Paper Gingerbread Man Santa Claus Party Ceiling Decor Festive Ornaments
-5%
$1.86
Mix MOQ : 5
Happy Retirement Hanging Swirl Decorations Black Gold Cardstock Ceiling Ornaments For Party Supplies
Happy Retirement Hanging Swirl Decorations Black Gold Cardstock Ceiling Ornaments For Party Supplies
like
Find Similar
Gold and black spiral hanging decorations set for Happy Retirement party atmosphere - Cards, Single Swirls and Double Swirls(Y-00036)
Happy Retirement Hanging Swirl Decorations Black Gold Cardstock Ceiling Ornaments For Party Supplies
-4%
$2.00
Mix MOQ : 5
Happy Retirement Party Decorative Paper Glasses Black Gold Glitter Funny Photo Props Novelty Eye Wear For Adults Farewell Celebration
Happy Retirement Party Decorative Paper Glasses Black Gold Glitter Funny Photo Props Novelty Eye Wear For Adults Farewell Celebration
like
Find Similar
8-piece black and gold paper retirement party photo booth eyewear with various designs - Retirement Party Style (J-0517)
Happy Retirement Party Decorative Paper Glasses Black Gold Glitter Funny Photo Props Novelty Eye Wear For Adults Farewell Celebration
-5%
$1.70
Mix MOQ : 5
Retirement Party Honeycomb Centerpieces Black Gold Paper Desktop Decorations For Farewell Celebration Office Home Event
Retirement Party Honeycomb Centerpieces Black Gold Paper Desktop Decorations For Farewell Celebration Office Home Event
like
Find Similar
9-piece black and gold retirement honeycomb centerpieces featuring Happy Retirement slogans - 9Pcs Retirement Honeycomb (Y-00563)
Retirement Party Honeycomb Centerpieces Black Gold Paper Desktop Decorations For Farewell Celebration Office Home Event
-4%
$3.92
Mix MOQ : 5
Baguette Cut Cubic Zirconia Tennis Necklace Copper 18K Gold Plated Elegant Rainbow Choker Jewelry Accessory For Women
Baguette Cut Cubic Zirconia Tennis Necklace Copper 18K Gold Plated Elegant Rainbow Choker Jewelry Accessory For Women
like
Find Similar
Rainbow claw chain choker necklace with black rectangular zirconia and gold finish - 18K Gold 2.5*5mm Horizontal Black
Tennis style golden necklace with emerald green rectangular cut crystals on white background - 18K Gold 2.5*5mm Horizontal Green
Golden tennis necklace featuring rectangle cut dark red rubies in a claw setting design - 18K Gold 2.5*5mm Horizontal Rose Red
Elegant gold-tone choker featuring rectangular pink crystals with adjustable lobster clasp - 18K Gold 2.5*5mm Horizontal Pink
+4
Baguette Cut Cubic Zirconia Tennis Necklace Copper 18K Gold Plated Elegant Rainbow Choker Jewelry Accessory For Women
$3.69-4.93
No MOQ
 · 
258 sold recently
Free Shipping
Women Large Capacity Tote Bag Pebbled PU Leather Retro Flap Design Commuter Handbag Solid Color
Women Large Capacity Tote Bag Pebbled PU Leather Retro Flap Design Commuter Handbag Solid Color
like
Find Similar
Minimalist dark brown lychee leather tote bag with unique cutout flap handle design - Brown
Brown lychee-grain leather tote bag with unique flap-over top handle design - Khaki
Large black tote bag in litchi grain leather with flap closure and sturdy handles - Black
Women Large Capacity Tote Bag Pebbled PU Leather Retro Flap Design Commuter Handbag Solid Color
$7.49
No MOQ
Women Canvas Tote Bag Large Capacity Shoulder Crossbody Bag With Faux Leather Straps French Retro Style Commute Handbag
Women Canvas Tote Bag Large Capacity Shoulder Crossbody Bag With Faux Leather Straps French Retro Style Commute Handbag
like
Find Similar
Minimalist large black canvas tote bag with leather trim and silver metal buckle details - Black
Retro canvas tote bag in cream with dark brown faux leather trim and silver buckles - White
French style dark blue denim tote bag with brown leather straps and vintage buckle design - Dark Blue
Blue canvas tote bag with brown leather straps and metal buckles for casual daily commuting - Light Blue
+1
Women Canvas Tote Bag Large Capacity Shoulder Crossbody Bag With Faux Leather Straps French Retro Style Commute Handbag
$8.36
No MOQ
Retro Matte PU Leather Underarm Bag Vintage Large Capacity Tote Commuter Handbag With Belt Buckle And Detachable Strap
Retro Matte PU Leather Underarm Bag Vintage Large Capacity Tote Commuter Handbag With Belt Buckle And Detachable Strap
like
Find Similar
Retro black matte leather shoulder bag with decorative silver buckle straps for women - Black
Retro dark red underarm bag in matte suede leather with decorative buckles and crossbody strap - Burgundy
Retro dark brown matte shoulder bag with silver buckles and adjustable crossbody strap - Brown
Retro brown suede underarm bag with vintage texture and adjustable decorative buckles - Brown
Retro Matte PU Leather Underarm Bag Vintage Large Capacity Tote Commuter Handbag With Belt Buckle And Detachable Strap
$10.37
No MOQ
Woven Texture Underarm Bag For Women Retro PU Leather Shoulder Bag Large Capacity Elegant Fashion Commuter Handbag
Woven Texture Underarm Bag For Women Retro PU Leather Shoulder Bag Large Capacity Elegant Fashion Commuter Handbag
like
Find Similar
Chic 2025 large capacity shoulder bags in six earthy tones with woven texture details - Green
Brown woven texture large capacity shoulder bag for women on a stylish leather chair - Brown
Brown woven texture bowling bag with dark leather straps and gold zipper detail - Brown
Retro black woven handbag with brown leather straps and gold metal clasp decoration - Black
+2
Woven Texture Underarm Bag For Women Retro PU Leather Shoulder Bag Large Capacity Elegant Fashion Commuter Handbag
$10.09
No MOQ
Brass 18K Gold Plated Zircon Dessert Candy Ice Cream Lollipop Heart Stud Earrings For Women Girls Cute Jewelry Accessory
Brass 18K Gold Plated Zircon Dessert Candy Ice Cream Lollipop Heart Stud Earrings For Women Girls Cute Jewelry Accessory
like
Find Similar
Detailed view of 5-piece summer dessert earring set with ice cream and cocktail designs - Dessert Style (18K Gold Plated) / Gold/Pink
Brass 18K Gold Plated Zircon Dessert Candy Ice Cream Lollipop Heart Stud Earrings For Women Girls Cute Jewelry Accessory
$3.62
No MOQ
 · 
19 views
Free Shipping
Rhinestone Necklace And Earrings Copper Acrylic Silver Plated Bridal Wedding Elegant Water Drop Pendant Women
Rhinestone Necklace And Earrings Copper Acrylic Silver Plated Bridal Wedding Elegant Water Drop Pendant Women
like
Find Similar
Sparkling bridal jewelry set with silver teardrop crystal necklace and earrings - White
Sparkling bridal jewelry set featuring a blue gemstone necklace and drop earrings on a bust - Sapphire Blue
Sparkling bridal jewelry set featuring red teardrop rhinestones on necklace and earrings - Red
Silver bridal jewelry set with sparkling black teardrop rhinestones and V-neck necklace - Black
+3
Rhinestone Necklace And Earrings Copper Acrylic Silver Plated Bridal Wedding Elegant Water Drop Pendant Women
$1.44-3.80
No MOQ
 · 
12 views
Free Shipping
Elegant Bowknot Choker Necklace Rhinestone Tassel Alloy Multilayer Sparkling French Style Jewelry For Women
Elegant Bowknot Choker Necklace Rhinestone Tassel Alloy Multilayer Sparkling French Style Jewelry For Women
like
Find Similar
Sparkling multi-layer rhinestone bow necklace with silver tassels and choker style - Silver
Elegant Bowknot Choker Necklace Rhinestone Tassel Alloy Multilayer Sparkling French Style Jewelry For Women
-5%
$2.44
No MOQ
Women Ruched PU Leather Hobo Bag Retro Large Capacity Croissant Shoulder Bag With Knot Strap Vintage Commuter Purse
Women Ruched PU Leather Hobo Bag Retro Large Capacity Croissant Shoulder Bag With Knot Strap Vintage Commuter Purse
like
Find Similar
Dark brown slouchy croissant shoulder bag with signature knotted strap detail - Brown
Brown croissant shoulder bag with pleated texture and stylish knotted strap for women - Khaki
Minimalist black croissant bag featuring pleated vegan leather and knotted shoulder strap - Black
Vintage dark brown crescent shoulder bag with pleated leather texture and knotted strap detail - Brown
Women Ruched PU Leather Hobo Bag Retro Large Capacity Croissant Shoulder Bag With Knot Strap Vintage Commuter Purse
$8.65
No MOQ
Vintage Glossy PU Leather Shoulder Bag For Women Large Capacity Multi Pocket Metal Turn Lock Retro Tote Handbag
Vintage Glossy PU Leather Shoulder Bag For Women Large Capacity Multi Pocket Metal Turn Lock Retro Tote Handbag
like
Find Similar
Detail of vintage brown satchel bag with multiple front pockets and metal twist locks - With Pendant / Brown
Retro black glossy tote bag with silver metal locks and decorative tassel on cream chair - With Pendant / Black
Retro chocolate brown glossy leather tote bag with multi-pockets and silver hardware - With Pendant / Brown
Close-up of a vintage dark brown leather shoulder bag with sleek silver metal twist locks - No Pendant / Brown
+2
Vintage Glossy PU Leather Shoulder Bag For Women Large Capacity Multi Pocket Metal Turn Lock Retro Tote Handbag
$12.10-12.68
No MOQ
Crocodile Embossed PU Leather Tote Bag Large Capacity Retro Minimalist Commute Women Underarm Shoulder Bag
Crocodile Embossed PU Leather Tote Bag Large Capacity Retro Minimalist Commute Women Underarm Shoulder Bag
like
Find Similar
Dark brown tote bag with crocodile texture and long shoulder straps in a minimalist style - Brown
Khaki large-capacity tote bag with crocodile pattern and long shoulder strap - Green
Minimalist black crocodile pattern faux leather tote bag with long shoulder straps - Black
Classic caramel brown crocodile embossed large tote bag for daily commute and casual style - Yellow Brown
Crocodile Embossed PU Leather Tote Bag Large Capacity Retro Minimalist Commute Women Underarm Shoulder Bag
$9.51
No MOQ
Vintage Octopus Tentacle Dragon Snake Open Adjustable Rings Alloy Gothic Punk Rock Jewelry For Men Women
Vintage Octopus Tentacle Dragon Snake Open Adjustable Rings Alloy Gothic Punk Rock Jewelry For Men Women
like
Find Similar
Close-up of vintage silver ring with engraved auspicious cloud patterns and open band - Golden Hoop Staff
Vintage silver octopus tentacle open ring with detailed suckers in steampunk style - Octopus
Detailed close-up of retro silver dragon claw ring showing scale texture and open band - Eagle Claw
Vintage punk dragon claw ring in silver finish with adjustable open band for men - Four Prong
+14
Vintage Octopus Tentacle Dragon Snake Open Adjustable Rings Alloy Gothic Punk Rock Jewelry For Men Women
$0.05-0.58
No MOQ
 · 
407 sold recently
Top 10% Best Sellers
in Rings
Cute Plush Tablet Sleeve Kawaii Cartoon Bear Bunny Embroidery Protective Bag Korean Style Soft Electronics Case
Cute Plush Tablet Sleeve Kawaii Cartoon Bear Bunny Embroidery Protective Bag Korean Style Soft Electronics Case
like
Find Similar
Detail of white plush rabbit 11 inch iPad bag featuring cute embroidery and soft ears - 9.7/10.5/11 Inch Universal / White Rabbit Donut Style / White
Cute brown plush 11-inch iPad sleeve featuring embroidered bear face and orange motif - 9.7/10.5/11 Inch Universal / Brown Curly Bear Orange Style / Brown
Cute Plush Tablet Sleeve Kawaii Cartoon Bear Bunny Embroidery Protective Bag Korean Style Soft Electronics Case
-13%
$3.86
Mix MOQ : 2
Elegant Rhinestone Necklace And Earrings Round Zircon Flower Pendant Wedding Party Bridal For Women Silver White
Elegant Rhinestone Necklace And Earrings Round Zircon Flower Pendant Wedding Party Bridal For Women Silver White
like
Find Similar
Elegant silver jewelry set with crystal necklace and earrings on model for evening wear - Silver
Elegant Rhinestone Necklace And Earrings Round Zircon Flower Pendant Wedding Party Bridal For Women Silver White
$1.75
No MOQ
 · 
23 views
Free Shipping
Teardrop Necklace Earrings Bracelet Alloy Rhinestone Zircon Elegant Bridal Wedding Party Luxury Fashion Accessories For Women
Teardrop Necklace Earrings Bracelet Alloy Rhinestone Zircon Elegant Bridal Wedding Party Luxury Fashion Accessories For Women
like
Find Similar
Sparkling crystal necklace, earrings and bracelet set in silver finish for brides - Silver Rhinestone Three-Piece Set (446+Single Row)
Detailed view of silver bridal jewelry set with V-pendant necklace and sparkly crystals - Silver Double-Row Rhinestone Three-Piece Set (446+Double Row)
Silver water drop necklace and earrings bridal jewelry set with sparkling rhinestones - Silver Double-Row Rhinestone Water Drop Set (463+Double Row)
Elegant silver-tone jewelry set featuring teardrop crystal necklace and long drop earrings - Silver Triple-Row Rhinestone Three-Piece Set (446+Triple Row)
+13
Teardrop Necklace Earrings Bracelet Alloy Rhinestone Zircon Elegant Bridal Wedding Party Luxury Fashion Accessories For Women
$1.57-4.85
No MOQ
 · 
148 sold recently
Coffee Theme Wall Stickers PVC Removable Decals But First Coffee Art For Kitchen Cafe Dining Room Modern Black White
Coffee Theme Wall Stickers PVC Removable Decals But First Coffee Art For Kitchen Cafe Dining Room Modern Black White
like
Find Similar
DIY coffee theme wall stickers with cup and pot patterns for cafe wall decor 80x67cm - 30*90cm
Coffee Theme Wall Stickers PVC Removable Decals But First Coffee Art For Kitchen Cafe Dining Room Modern Black White
$1.53
Mix MOQ : 2
Women Round Neck T-shirt Cotton Short Sleeve Loose Fit Books Coffee Graphic Print Casual Summer Commuter Slogan Tee
Women Round Neck T-shirt Cotton Short Sleeve Loose Fit Books Coffee Graphic Print Casual Summer Commuter Slogan Tee
like
Find Similar
Close-up of beige cotton T-shirt featuring 'no such thing as too many books' print - S / Sand (Black Text)
Detail of grey cotton T-shirt featuring white book stack and coffee cup graphic print - S / Dark Grey (White Text)
Detail of grey cotton T-shirt featuring artistic coffee cup and book stack graphic print - S / Dark Grey (Black Text)
Detail of yellow cotton T-shirt featuring 'there is no such thing as too many books' print - S / Mustard Yellow (Black Text)
+158
Women Round Neck T-shirt Cotton Short Sleeve Loose Fit Books Coffee Graphic Print Casual Summer Commuter Slogan Tee
$6.05
No MOQ
Kitchen Wall Stickers Waterproof PVC Bohemian Hand Drawn Kitchenware Decals Heart Of The Home Quote Removable Decorative
Kitchen Wall Stickers Waterproof PVC Bohemian Hand Drawn Kitchenware Decals Heart Of The Home Quote Removable Decorative
like
Find Similar
Detail view of Kitchen Heart of Home wall sticker dimensions and layout size - Kitchen Utensils & Quote Style (MS3098-YL)
Kitchen Wall Stickers Waterproof PVC Bohemian Hand Drawn Kitchenware Decals Heart Of The Home Quote Removable Decorative
$1.24
Mix MOQ : 2
Cotton Blend Crew Socks Funny Fried Egg Pattern Creative Streetwear Casual Breathable Soft For Men Women
Cotton Blend Crew Socks Funny Fried Egg Pattern Creative Streetwear Casual Breathable Soft For Men Women
like
Find Similar
Classic black and white checkered crew socks with ribbed cuffs and white cotton heels - EU 39-46 / Black White Grid
Mid-calf cotton socks featuring 3D geometric block pattern in purple and orange - EU 39-46 / Purple 3D Geometric Blocks
Funny mid-calf cotton socks with fried egg print and yellow contrast heel and toe - EU 39-46 / Poached Egg Pattern
Men's crew socks with black white and grey geometric chevron patterns and stripes - EU 39-46 / Black and White Chevron Stripes
+2
Cotton Blend Crew Socks Funny Fried Egg Pattern Creative Streetwear Casual Breathable Soft For Men Women
-5%
$1.23
No MOQ
Bridal Jewelry Necklace Bracelet And Earrings Alloy Silver Plated Rhinestone Zircon Teardrop Wedding Evening Party Women
Bridal Jewelry Necklace Bracelet And Earrings Alloy Silver Plated Rhinestone Zircon Teardrop Wedding Evening Party Women
like
Find Similar
Elegant silver bridal jewelry set with sparkling teardrop crystals on a dark background - 501+600 Stud Earrings 3-Piece Set / Silver
Elegant silver bridal jewelry set with sparkling rhinestones necklace bracelet and earrings - 776+446 Clip-on Earrings 3-Piece Set / Silver
Elegant bridal jewelry set with silver necklace, bracelet, and earrings featuring sparkling crystals - 463+600 Stud Earrings 3-Piece Set / Silver
Elegant gold-plated jewelry set with sparkling crystals for bridal or wedding events - 446 Gold 2-Piece Set
+11
Bridal Jewelry Necklace Bracelet And Earrings Alloy Silver Plated Rhinestone Zircon Teardrop Wedding Evening Party Women
$1.26-4.19
No MOQ
 · 
22 views
Canvas Tote Bag Women Large Capacity Hand Drawn Cartoon Doodle Print Korean Style Shoulder Handbag For School Casual
Canvas Tote Bag Women Large Capacity Hand Drawn Cartoon Doodle Print Korean Style Shoulder Handbag For School Casual
like
Find Similar
Minimalist canvas tote bag with black grid graffiti patterns and wide shoulder straps - Large / Beige (Printed)
Canvas Tote Bag Women Large Capacity Hand Drawn Cartoon Doodle Print Korean Style Shoulder Handbag For School Casual
-4%
$3.43
No MOQ
Canvas Tote Bag Women Shoulder Shopping Bag With Zipper Inner Pocket Lemon Flower Vase Print Casual Eco Friendly
Canvas Tote Bag Women Shoulder Shopping Bag With Zipper Inner Pocket Lemon Flower Vase Print Casual Eco Friendly
like
Find Similar
White canvas tote bag featuring hand-drawn sunflower and blue vase illustration - Vase Pattern (White)
White canvas tote bag featuring fresh lemon soda illustration for daily styling - Lemon Cup Pattern (White)
Canvas Tote Bag Women Shoulder Shopping Bag With Zipper Inner Pocket Lemon Flower Vase Print Casual Eco Friendly
-4%
$2.68
No MOQ
Women Striped Seersucker Tote Bag Large Capacity Shoulder Handbag With Lace Bow Decoration Sweet Korean Style Daily Bag
Women Striped Seersucker Tote Bag Large Capacity Shoulder Handbag With Lace Bow Decoration Sweet Korean Style Daily Bag
like
Find Similar
Blue and white seersucker tote bag with white lace bow detail worn by a model - Light Blue Stripe
Green and white striped canvas tote bag with delicate lace bow for women - Green Stripe
Blue checkered canvas tote bag with a white lace bow detail for casual commuting wear - Black Fine Stripes
Sweet pink and white striped canvas tote bag with lace trim and bow knot detail - Pink Fine Stripe
+1
Women Striped Seersucker Tote Bag Large Capacity Shoulder Handbag With Lace Bow Decoration Sweet Korean Style Daily Bag
$3.69
No MOQ
Funny Data Analyst Acrylic Retractable Badge Reel Alligator Clip ID Holder For Nurse Office Worker Creative Swivel Design
Funny Data Analyst Acrylic Retractable Badge Reel Alligator Clip ID Holder For Nurse Office Worker Creative Swivel Design
like
Find Similar
Macro detail of acrylic badge reel with coffee graphic and retractable cord mechanism - Coffee And Analytics (1)
Detail of retractable badge reel with spreadsheet design and acrylic inspirational panel - Excelling Spreadsheets (2)
Handheld acrylic retractable badge reel with CY-HER SECURITY print and crocodile clip - Cy-Her Security (3)
Detail showing retractable badge reel with acrylic quote plate and alligator clip - Men Lie Numbers Don't (4)
Funny Data Analyst Acrylic Retractable Badge Reel Alligator Clip ID Holder For Nurse Office Worker Creative Swivel Design
$1.01
Mix MOQ : 2
 · 
15 views
Quilted Tote Bag PU Leather Large Capacity With Small Pouch Flower Pattern Commute Shoulder Handbag For Women
Quilted Tote Bag PU Leather Large Capacity With Small Pouch Flower Pattern Commute Shoulder Handbag For Women
like
Find Similar
Black quilted tote bag with floral embroidery and matching mini coin purse detail - Large Tote + Matching Pouch / Black
Quilted tote bag set in coffee brown faux leather with embossed floral patterns - Large Tote + Matching Pouch / Brown
Chic quilted cream tote bag with floral embossing and matching mini zipper pouch - Large Tote + Matching Pouch / Light Pink
Beige quilted tote bag with floral patterns and matching small pouch for daily commute - Large Tote + Matching Pouch / Khaki
Quilted Tote Bag PU Leather Large Capacity With Small Pouch Flower Pattern Commute Shoulder Handbag For Women
$9.80
No MOQ
Camellia Flower Phone Grip Holder Elegant Faux Artificial Pearl Rhinestone Expandable Kickstand Luxury Metal Socket For Smartphones
Camellia Flower Phone Grip Holder Elegant Faux Artificial Pearl Rhinestone Expandable Kickstand Luxury Metal Socket For Smartphones
like
Find Similar
Detailed view of luxury metal pearl flower phone grip stand on a white smartphone - White
Detailed close-up of a pink floral phone grip with elegant pearls and enamel petals - Pink
Elegant black enamel flower phone socket with gold edges and pearl center on magazine - Black
Camellia Flower Phone Grip Holder Elegant Faux Artificial Pearl Rhinestone Expandable Kickstand Luxury Metal Socket For Smartphones
-8%
$1.23
No MOQ
Heart Shaped Glitter Resin Phone Griptok Stretchable Adhesive Cartoon Bear Rabbit Baby Coffee Decor Desktop Stand
Heart Shaped Glitter Resin Phone Griptok Stretchable Adhesive Cartoon Bear Rabbit Baby Coffee Decor Desktop Stand
like
Find Similar
Macro detail of heart-shaped phone grip featuring a black bunny and glitter elements - Starry-Baby Coffee Rabbit
Detail of heart-shaped phone grip with black bear, baby letters and coffee cup decor - Starry-Baby Coffee Bear
NewHeart Shaped Glitter Resin Phone Griptok Stretchable Adhesive Cartoon Bear Rabbit Baby Coffee Decor Desktop Stand
-8%
$0.92
No MOQ
Minimalist Large Capacity Tote Bag PU Leather Lychee Pattern With Satin Scarf Decor Shoulder Handbag For Women
Minimalist Large Capacity Tote Bag PU Leather Lychee Pattern With Satin Scarf Decor Shoulder Handbag For Women
like
Find Similar
Classic black leather tote bag with printed silk scarf handle and spacious design - Black
Minimalist beige tote bag in lychee leather texture with a blue and white decorative scarf - White
Brown faux leather tote bag with vintage printed silk scarf and fine pebble texture - Brown
Deep brown large tote bag with lychee texture and blue floral scarf decoration - Brown
Minimalist Large Capacity Tote Bag PU Leather Lychee Pattern With Satin Scarf Decor Shoulder Handbag For Women
$4.18
No MOQ
Cartoon Bear Donut Resin Decor Phone Case With Black Silicone Wristband Anti Fall TPU Full Coverage Shell Cute Cream Style
Cartoon Bear Donut Resin Decor Phone Case With Black Silicone Wristband Anti Fall TPU Full Coverage Shell Cute Cream Style
like
Find Similar
Detail of soft pink silicone phone case featuring 3D bear, donut charms and black wrist strap - iPhone 7/8/SE 2020 / Honey Bear (Khaki)
Close-up of beige iPhone case with 3D resin bear and donut charms and silicone wrist strap - iPhone 7/8/SE 2020 / Bread Bear (Khaki)
+30
Cartoon Bear Donut Resin Decor Phone Case With Black Silicone Wristband Anti Fall TPU Full Coverage Shell Cute Cream Style
-9%
$1.57
No MOQ
Foldable Phone Case For Samsung Galaxy Z Flip With 3D Bear Coffee Charm Large Bead Hand Chain Strap Textured PC Shell
Foldable Phone Case For Samsung Galaxy Z Flip With 3D Bear Coffee Charm Large Bead Hand Chain Strap Textured PC Shell
like
Find Similar
Detail of Galaxy Z Flip case with black bead chain, 3D bear charm and coffee cup motif - White / Samsung ZFlip3
Detail of Samsung Z Flip case with 3D teddy bear charm and black beaded handle strap - Black / Samsung ZFlip3
+28
Foldable Phone Case For Samsung Galaxy Z Flip With 3D Bear Coffee Charm Large Bead Hand Chain Strap Textured PC Shell
-9%
$2.88
No MOQ
Sweet Colorful Zircon Stud Earrings With Stainless Steel Earring Post Cute Fruit Strawberry Grape Piercing Jewelry For Women
Sweet Colorful Zircon Stud Earrings With Stainless Steel Earring Post Cute Fruit Strawberry Grape Piercing Jewelry For Women
like
Find Similar
Screw back heart fruit ear stud with red heart crystal and green leaf gemstones - Strawberry (EGD0003)
Grape shape stud earring with purple cubic zirconia and gold ball back closure - Grape (EGD0008)
Golden cherry stud earring with pink zircon fruits and green leaf stone and ball screw back - Cherry (EGD0012)
Detailed macro of gold cloud tassel earring with purple and blue zircon crystals - Cloud Tassel (EGD0064)
+11
Sweet Colorful Zircon Stud Earrings With Stainless Steel Earring Post Cute Fruit Strawberry Grape Piercing Jewelry For Women
-5%
$0.75-1.29
No MOQ
 · 
118 sold recently
Free Shipping
Cute Mink Fur Pom Pom Artificial Pearl Bow Phone Stand Retractable Griptok Magnetic Folding Mobile Accessories Desktop Bracket
Cute Mink Fur Pom Pom Artificial Pearl Bow Phone Stand Retractable Griptok Magnetic Folding Mobile Accessories Desktop Bracket
like
Find Similar
Close-up of pearl bow phone grip in a transparent Gift For You round gift box - Magnetic Suction-Mink Fur Bow-White
Close-up of pink fluffy powder puff with pearl bow in Gift For You transparent box - Magnetic Suction-Mink Fur Bow-Pink
Close-up of pearl bow phone socket in transparent gift box packaging with Gift For You text - Magnetic Suction-Mink Fur Bow-Black
Detail view of a white fluffy bow phone grip stand on a dark wood texture surface - Transparent Stand-Mink Fur Bow-White
+2
Cute Mink Fur Pom Pom Artificial Pearl Bow Phone Stand Retractable Griptok Magnetic Folding Mobile Accessories Desktop Bracket
-9%
$1.18-2.36
No MOQ
Free Shipping
Kawaii Stereoscopic Cartoon Bear Folding Phone Case Faux Leather Litchi Texture With Braided Lanyard And Stand For Women
Kawaii Stereoscopic Cartoon Bear Folding Phone Case Faux Leather Litchi Texture With Braided Lanyard And Stand For Women
like
Find Similar
Detail of lychee leather phone case with mirror, cute bear pendant and woven lanyard - Black (Coffee XX Bear Bracket - Smiley Rope) / Samsung ZFlip3
Close-up of brown litchi leather phone case with bear charms and braided wrist strap - Khaki (Coffee XX Bear Bracket - Smiley Rope) / Samsung ZFlip3
Close-up of black leather flip phone case with cute 3D charms and woven lanyard strap - Black (Coffee Bear Head Bracket - Smiley Rope) / Samsung ZFlip3
Detail of folding phone case featuring 3D coffee bear ornaments and a woven lanyard - Beige (Coffee Bear Head Bracket - Smiley Rope) / Samsung ZFlip3
+56
Kawaii Stereoscopic Cartoon Bear Folding Phone Case Faux Leather Litchi Texture With Braided Lanyard And Stand For Women
-9%
$3.62
No MOQ
3D Plush Bear Head Phone Case With Hand Strap Faux Leather Shockproof Protective Cover For Women Cute Korean Style
3D Plush Bear Head Phone Case With Hand Strap Faux Leather Shockproof Protective Cover For Women Cute Korean Style
like
Find Similar
Detail of iPhone case with 3D plush bear head and leather strap on metal tray - Black / iPhone 7/8/SE 2020
Detail of bear plush phone case with lanyard and metal buckle for iPhone 16 Pro Max - Off White / iPhone 7/8/SE 2020
Detail of iPhone 16 Pro Max brown leather case with plush bear and hand strap - Brown / iPhone 7/8/SE 2020
+84
3D Plush Bear Head Phone Case With Hand Strap Faux Leather Shockproof Protective Cover For Women Cute Korean Style
-8%
$2.23
No MOQ
Magnetic Airbag Phone Holder Folding Retractable MagSafe Compatible Circular Minimalist Solid Color Desktop Stand
Magnetic Airbag Phone Holder Folding Retractable MagSafe Compatible Circular Minimalist Solid Color Desktop Stand
like
Find Similar
Close-up of solid balm compact in soft dusty pink on minimalist white desktop surface - Dark Pink
Macro view of minimalist magnetic round grip stand on a silver laptop surface - White
Macro view of a dark blue solid gel makeup product in a round transparent container - Navy Blue
Macro shot of red magnetic phone grip on white desk with laptop keyboard detail - Red
+22
NewMagnetic Airbag Phone Holder Folding Retractable MagSafe Compatible Circular Minimalist Solid Color Desktop Stand
-9%
$1.83
No MOQ
Free Shipping
Magnetic Phone Grip Holder Retractable Satin Rose Flower Rhinestone Artificial Pearl Decoration Elegant Mobile Phone Accessories
Magnetic Phone Grip Holder Retractable Satin Rose Flower Rhinestone Artificial Pearl Decoration Elegant Mobile Phone Accessories
like
Find Similar
Detailed view of pink fabric rose phone grip with sparkling rhinestones and pearls - (4 Rhinestones) Magnetic Small Fabric Rose / Pink
Detailed close-up of a black fabric camellia phone socket with crystal rhinestones - (4 Rhinestones) Magnetic Small Fabric Rose / Black
Close-up of red fabric camellia phone socket with sparkling rhinestones on desktop - (4 Rhinestones) Magnetic Small Fabric Rose / Red
Detail of fabric camellia phone socket with champagne satin rose and rhinestones - (4 Rhinestones) Magnetic Small Fabric Rose / Khaki
+5
Magnetic Phone Grip Holder Retractable Satin Rose Flower Rhinestone Artificial Pearl Decoration Elegant Mobile Phone Accessories
-9%
$1.96
No MOQ
Rhinestone Jewelry Copper Shiny Double Layer Necklace Earrings Bracelet For Wedding Bridal Banquet Elegant Women
Rhinestone Jewelry Copper Shiny Double Layer Necklace Earrings Bracelet For Wedding Bridal Banquet Elegant Women
like
Find Similar
Sparkling silver double-layer rhinestone necklace, bracelet, and earrings jewelry set for women - 619+782 Silver Necklace Earrings Bracelet Set
Macro shot of silver bridal necklace and long tassel earrings with sparkling crystals - 619 Silver Necklace Earrings Set
Luxurious silver bridal jewelry set with sparkling rhinestones for wedding and evening galas - 619+799 Silver Necklace Earrings Bracelet Set
Sparkling full diamond rhinestone bracelet with adjustable extension chain for women's gala - 799 Silver Bracelet
+3
Rhinestone Jewelry Copper Shiny Double Layer Necklace Earrings Bracelet For Wedding Bridal Banquet Elegant Women
-5%
$1.24-3.73
No MOQ
 · 
49 views
Free Shipping
Pink Zircon Tennis Bracelet For Women Elegant Round Cut Claw Chain Copper Jewelry With Adjustable Extension Sweet Style
Pink Zircon Tennis Bracelet For Women Elegant Round Cut Claw Chain Copper Jewelry With Adjustable Extension Sweet Style
like
Find Similar
1 option
Pink Zircon Tennis Bracelet For Women Elegant Round Cut Claw Chain Copper Jewelry With Adjustable Extension Sweet Style
-4%
$2.37
No MOQ
 · 
38 views
Free Shipping
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access