Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Brush Your Teeth Cartoon Tooth Cup Removable Bathroom Wall Sticker PVC Waterproof Washroom Mirror Background Decorative Decal
Brush Your Teeth Cartoon Tooth Cup Removable Bathroom Wall Sticker PVC Waterproof Washroom Mirror Background Decorative Decal
like
Find Similar
Cartoon tooth and cup wall sticker with Brush your teeth lettering for bathroom decor - Brushing Teeth Cartoon Pattern (PH_QTB197)
Brush Your Teeth Cartoon Tooth Cup Removable Bathroom Wall Sticker PVC Waterproof Washroom Mirror Background Decorative Decal
$0.78
No MOQ
Coffee Gnome Wall Sticker PVC Self-Adhesive Cartoon Coffee Cup Decal For Kitchen Dining Room Cafe Home Decorative Wall Art
Coffee Gnome Wall Sticker PVC Self-Adhesive Cartoon Coffee Cup Decal For Kitchen Dining Room Cafe Home Decorative Wall Art
like
Find Similar
Detail view of coffee gnome wall decals showing paste dimensions and layout size - 29x29cm
Coffee Gnome Wall Sticker PVC Self-Adhesive Cartoon Coffee Cup Decal For Kitchen Dining Room Cafe Home Decorative Wall Art
$1.44
No MOQ
World Cup Football Temporary Tattoo Stickers Soccer Trophy Victory Pattern Cartoon Body Face Art Decals For Fans Celebration Party
World Cup Football Temporary Tattoo Stickers Soccer Trophy Victory Pattern Cartoon Body Face Art Decals For Fans Celebration Party
like
Find Similar
Close-up of World Cup soccer stickers featuring Victory text and gold trophy icons - Soccer Theme Athlete Trophy Style
World Cup Football Temporary Tattoo Stickers Soccer Trophy Victory Pattern Cartoon Body Face Art Decals For Fans Celebration Party
$0.49
Mix MOQ : 2
Soccer World Cup Theme Party Decoration Foil Rain Curtain Black White Football Hanging Backdrop For Fans Birthday Celebration
Soccer World Cup Theme Party Decoration Foil Rain Curtain Black White Football Hanging Backdrop For Fans Birthday Celebration
like
Find Similar
Fringe curtain with football pattern, 100x200cm size specifications for party decor - Soccer Pattern
Soccer World Cup Theme Party Decoration Foil Rain Curtain Black White Football Hanging Backdrop For Fans Birthday Celebration
$2.00
Mix MOQ : 2
2026 World Cup Soccer Football Theme Party Photo Backdrop Prop For Fans Viewing Gathering Green Polyester Banner Cutout Design
2026 World Cup Soccer Football Theme Party Photo Backdrop Prop For Fans Viewing Gathering Green Polyester Banner Cutout Design
like
Find Similar
Outdoor 2026 World Cup photo booth banner with soccer flags and trophy on green field - 180x90cm
New2026 World Cup Soccer Football Theme Party Photo Backdrop Prop For Fans Viewing Gathering Green Polyester Banner Cutout Design
$3.03
Mix MOQ : 2
Cartoon Beverage Enamel Brooch Pin Alloy Milk Coffee Cup Badge For Clothes Backpack Accessories Daily Jewelry For Women Kids
Cartoon Beverage Enamel Brooch Pin Alloy Milk Coffee Cup Badge For Clothes Backpack Accessories Daily Jewelry For Women Kids
like
Find Similar
Cartoon enamel brooch shaped like a white coffee cup with a brown sleeve and coffee text - Coffee Cup Style (XZ1595)
Cartoon Beverage Enamel Brooch Pin Alloy Milk Coffee Cup Badge For Clothes Backpack Accessories Daily Jewelry For Women Kids
-9%
$0.65
No MOQ
Funny Cartoon Drink Cup Enamel Pin Serotonin Booster Metal Badge For Clothes Backpack Fashion Jewelry Brooch For Unisex
Funny Cartoon Drink Cup Enamel Pin Serotonin Booster Metal Badge For Clothes Backpack Fashion Jewelry Brooch For Unisex
like
Find Similar
Cute serotonin booster enamel pin featuring a yellow cartoon cup and pink lid design - Cartoon Drink Cup Style (QHXZ5614)
Funny Cartoon Drink Cup Enamel Pin Serotonin Booster Metal Badge For Clothes Backpack Fashion Jewelry Brooch For Unisex
-9%
$0.39
No MOQ
Free Shipping
Modern PVC Coffee Cup Wall Sticker Start Your Day English Letter Decal For Kitchen Cafe Dining Room Minimalist Home Decor
Modern PVC Coffee Cup Wall Sticker Start Your Day English Letter Decal For Kitchen Cafe Dining Room Minimalist Home Decor
like
Find Similar
Detail view of coffee cup wall sticker with maple leaves and size specifications - Ms8622-nh（20*30cm）
Modern PVC Coffee Cup Wall Sticker Start Your Day English Letter Decal For Kitchen Cafe Dining Room Minimalist Home Decor
$0.58
Mix MOQ : 2
Alloy Drip Oil Smile Face Water Cup Pendants For DIY Jewelry Making Creative Enamel Smiling Charm Accessories For Necklace Bracelet
Alloy Drip Oil Smile Face Water Cup Pendants For DIY Jewelry Making Creative Enamel Smiling Charm Accessories For Necklace Bracelet
like
Find Similar
Set of 5 enamel coffee cup smile face pendants with rose gold alloy plating for DIY crafts - White
Alloy Drip Oil Smile Face Water Cup Pendants For DIY Jewelry Making Creative Enamel Smiling Charm Accessories For Necklace Bracelet
$0.54
No MOQ
Free Shipping
Cute Cartoon Creature Enamel Pin Brooch Kawaii Animal Holding Coffee Cup Zinc Alloy Badge For Clothes Bag Decoration Jewelry Gift
Cute Cartoon Creature Enamel Pin Brooch Kawaii Animal Holding Coffee Cup Zinc Alloy Badge For Clothes Bag Decoration Jewelry Gift
like
Find Similar
Cartoon enamel pin featuring Gizmo holding a blue coffee cup with golden metallic edges - Cute Animal Holding Coffee Cup Style(QHXZ756)
Cute Cartoon Creature Enamel Pin Brooch Kawaii Animal Holding Coffee Cup Zinc Alloy Badge For Clothes Bag Decoration Jewelry Gift
-9%
$0.47
No MOQ
Romantic Glitter Silver Laser Cut Butterfly Place Cards Pearlescent Paper Cup Decoration for Wedding Banquet Party Table Decor
Romantic Glitter Silver Laser Cut Butterfly Place Cards Pearlescent Paper Cup Decoration for Wedding Banquet Party Table Decor
like
Find Similar
Silver glitter butterfly wall sticker with hollow lace wings for festive decoration - Glitter Silver
Romantic Glitter Silver Laser Cut Butterfly Place Cards Pearlescent Paper Cup Decoration for Wedding Banquet Party Table Decor
$0.11
Mix MOQ : 50
Alloy Enamel Magnetic Suction DIY Jewelry Charms Pendants Heart Strawberry Watermelon Cat Sun Moon Multi Language Projection Stone For Kids
Alloy Enamel Magnetic Suction DIY Jewelry Charms Pendants Heart Strawberry Watermelon Cat Sun Moon Multi Language Projection Stone For Kids
like
Find Similar
Close-up of watermelon heart magnetic pendant on rose gold silk fabric background - Magnetic Watermelon Heart
Close-up of magnetic heart-shaped friendship pendants with gold edges and glitter filling - Glitter Magnetic Heart
Macro view of pink donut heart pendant with magnetic pairing and golden plating - Smiley Donut Heart
Detail showing two-piece magnetic strawberry pendant in pink on champagne silk - Magnetic Red Strawberry
+4
Alloy Enamel Magnetic Suction DIY Jewelry Charms Pendants Heart Strawberry Watermelon Cat Sun Moon Multi Language Projection Stone For Kids
$0.58-1.44
Mix MOQ : 25
 · 
15 views
Free Shipping
Reflective Gold Crown Laser Cut Paper Place Cards For Wedding Party Table Cup Decorative Name Cards
Reflective Gold Crown Laser Cut Paper Place Cards For Wedding Party Table Cup Decorative Name Cards
like
Find Similar
Golden laser-cut crown place cards for party drinks shown against a sunny outdoor backdrop - Double-sided Gold
Reflective Gold Crown Laser Cut Paper Place Cards For Wedding Party Table Cup Decorative Name Cards
$0.10
Mix MOQ : 50
Christmas Cake Decoration Holiday Dessert Packaging Paper Box Cup Sleeve Topper Santa Reindeer Pattern Festive Party Supplies Accessory
Christmas Cake Decoration Holiday Dessert Packaging Paper Box Cup Sleeve Topper Santa Reindeer Pattern Festive Party Supplies Accessory
like
Find Similar
Set of 50 disposable 360ml clear plastic boba cups with dome lids for Christmas desserts - 360ml / 50 Pieces / Bobo Cup Without Spork
50-piece 360ml transparent dessert cup set with spherical lids and pink spoons - 360ml / 50 Pieces / Bobo Cup With Spork
50-piece set of festive Christmas paper cup sleeves with Chinese and English graphics - 50 Pieces / 5 Styles Mixed Cup Sleeves
Christmas Cake Decoration Holiday Dessert Packaging Paper Box Cup Sleeve Topper Santa Reindeer Pattern Festive Party Supplies Accessory
$1.61-5.42
Mix MOQ : 3
Sexy Black Lace Underwire Lingerie Bra And Thong Butterfly Embroidery Open Cup Hollow Out Temptation Underwear For Women
Sexy Black Lace Underwire Lingerie Bra And Thong Butterfly Embroidery Open Cup Hollow Out Temptation Underwear For Women
like
Find Similar
One Size / Black
NewSexy Black Lace Underwire Lingerie Bra And Thong Butterfly Embroidery Open Cup Hollow Out Temptation Underwear For Women
$3.46
No MOQ
Hollowed Hummingbird Wine Glass Place Card Laser Cut Pearlescent Paper Bird Shape Cup Decor For Wedding Party Event Table Decoration
Hollowed Hummingbird Wine Glass Place Card Laser Cut Pearlescent Paper Bird Shape Cup Decor For Wedding Party Event Table Decoration
like
Find Similar
Blue laser-cut hummingbird paper card for wine glass rim decoration at weddings - Hummingbird Shape / Blue
Hollowed Hummingbird Wine Glass Place Card Laser Cut Pearlescent Paper Bird Shape Cup Decor For Wedding Party Event Table Decoration
$0.07
Mix MOQ : 50
Magnetic Phone Grip Tok Macaron Glitter Heart Round Stand Magnetic Suction Acrylic Resin Sparkly Star Moon Sequins
Magnetic Phone Grip Tok Macaron Glitter Heart Round Stand Magnetic Suction Acrylic Resin Sparkly Star Moon Sequins
like
Find Similar
Macro view of circular magnetic phone holder with black starry glitter and sequins - Magnetic Stand / Black Silver Foil Glitter Round
Macro detail of a round lavender MagSafe phone grip with holographic glitter and sequins - Magnetic Stand / White Silver Foil Glitter Round
Close-up of pink macaron Magsafe phone grip with holographic glitter and star sequins - Magnetic Stand / Pink Silver Foil Glitter Round
Detail of purple macaron magnetic phone socket with glitter star and moon sequins - Magnetic Stand / Purple Silver Foil Glitter Round
+8
Magnetic Phone Grip Tok Macaron Glitter Heart Round Stand Magnetic Suction Acrylic Resin Sparkly Star Moon Sequins
-9%
$1.96
Mix MOQ : 2
Free Shipping
Bee Shaped Baby Divided Suction Plate Food Grade Silicone Cartoon Feeding Bowl Dish For Toddlers Non Slip BPA Free
Bee Shaped Baby Divided Suction Plate Food Grade Silicone Cartoon Feeding Bowl Dish For Toddlers Non Slip BPA Free
like
Find Similar
Yellow cartoon bee silicone baby plate with three compartments on pink background - Ginger Yellow
Blue silicone baby divided plate in cute animal shape for toddler mealtime - Grey Blue
Beige cartoon bee-shaped silicone divided plate for kids with a smiling face pattern - Off White
Dark red silicone baby plate in cartoon monkey shape with three divided compartments - Brick Red
Bee Shaped Baby Divided Suction Plate Food Grade Silicone Cartoon Feeding Bowl Dish For Toddlers Non Slip BPA Free
$2.31
No MOQ
 · 
24 sold recently
Heart Shaped Contact Lens Case Plastic With Mirror Tweezers Suction Stick Travel Kit Candy Color Cute Girls
Heart Shaped Contact Lens Case Plastic With Mirror Tweezers Suction Stick Travel Kit Candy Color Cute Girls
like
Find Similar
Deep red heart-shaped contact lens case set with mirror and tools on soft fabrics - Red
Detail view of pink heart contact lens case with mirror, tweezers, and applicator tool - Pink
Macro detail of mint heart contact lens case set with mirror, tweezers and accessories - Blue
Detail view of heart-shaped contact lens case with mirror, tweezers and scoop inside - Yellow
+1
Heart Shaped Contact Lens Case Plastic With Mirror Tweezers Suction Stick Travel Kit Candy Color Cute Girls
$0.55
No MOQ
 · 
32 sold recently
Laser Heart Phone Grip Holder Iridescent 3D Geometric Cut Resin Telescopic Suction Bracket Magnetic Finger Ring
Laser Heart Phone Grip Holder Iridescent 3D Geometric Cut Resin Telescopic Suction Bracket Magnetic Finger Ring
like
Find Similar
Macro shot of red 3D faceted heart phone grip holder with crystalline texture on desk - Magnetic / Laser Ankara Red
Macro view of 3D iridescent laser heart phone grip with translucent pink faceted finish - Magnetic / Phantom Pink
Macro shot of 3D heart-shaped phone grip with iridescent gradient and faceted texture - Magnetic / Iridescent Black
Macro view of a 3D laser heart phone grip with gradient green resin and faceted finish - Magnetic / Phantom Yellow
+16
Laser Heart Phone Grip Holder Iridescent 3D Geometric Cut Resin Telescopic Suction Bracket Magnetic Finger Ring
-9%
$0.97-1.83
No MOQ
Magnetic Suction Base Round Transparent Plastic Compatible With Magnetic Phone Grip Holder Accessory Minimalist Colorful
Magnetic Suction Base Round Transparent Plastic Compatible With Magnetic Phone Grip Holder Accessory Minimalist Colorful
like
Find Similar
White magnetic ring adapter for MagSafe cases made of acrylic with a hollow circular design - Transparent White
Detail of pink magnetic MagSafe ring socket base with silver metallic edges and enamel finish - Transparent - Pink Edge
Macro view of clear MagSafe magnetic base plate for phone grip holder attachment - Transparent Black
Close-up of a circular MagSafe magnetic phone holder in orange with a transparent rim - Transparent - Red Edge
+11
Magnetic Suction Base Round Transparent Plastic Compatible With Magnetic Phone Grip Holder Accessory Minimalist Colorful
-9%
$1.39
No MOQ
Magnetic Phone Grip Water Ripple Glitter Foil Suction Stand Marble Texture Round Desk Accessories
Magnetic Phone Grip Water Ripple Glitter Foil Suction Stand Marble Texture Round Desk Accessories
like
Find Similar
Macro detail of MagSafe phone grip featuring mint green water ripple texture and silver flakes - Magnetic Epoxy Silver Foil Water Ripple / White
Detail of green MagSafe phone grip with silver foil texture on a wooden desk - Magnetic Epoxy Silver Foil Water Ripple / Emerald Green
Macro detail of red glitter MagSafe phone grip on a minimalist wooden desktop - Magnetic Epoxy Silver Foil Water Ripple / Cherry Red
Close-up of MagSafe phone grip with gold foil pattern on a wooden desk surface - Magnetic Epoxy Silver Foil Water Ripple / Orange
+11
Magnetic Phone Grip Water Ripple Glitter Foil Suction Stand Marble Texture Round Desk Accessories
-9%
$1.83
No MOQ
Free Shipping
Magnetic Couple Bracelets Natural Stone Beaded Heart Suction Matching Hand Woven Adjustable Rope Gift For Lovers
Magnetic Couple Bracelets Natural Stone Beaded Heart Suction Matching Hand Woven Adjustable Rope Gift For Lovers
like
Find Similar
Magnetic heart couple bracelets with pink natural stone and matte black beads - Pink Jade & Matte Beads
Detail of heart-shaped magnetic clasp connecting matte black and natural stone bead bracelets - Amazonite & Matte Stone
Detail of magnetic heart clasp connecting natural stone beaded bracelets for couples - White Turquoise & Matte Stone
Detail of magnetic heart clasp connecting matte black and gray natural stone bead bracelets - Hematite & Matte Stone
+8
Magnetic Couple Bracelets Natural Stone Beaded Heart Suction Matching Hand Woven Adjustable Rope Gift For Lovers
$1.41-2.57
No MOQ
Magnetic Phone Grip Holder Tulip Shape Magnetic Suction Expanding Socket For Magsafe Silicone Matte Flower Decorative Bracket
Magnetic Phone Grip Holder Tulip Shape Magnetic Suction Expanding Socket For Magsafe Silicone Matte Flower Decorative Bracket
like
Find Similar
Detailed view of white tulip Magsafe phone grip featuring Gift For You printing - White
Close-up of pink tulip Magsafe phone grip with 'Gift For You' text being held by a hand - Pink
Detail of magnetic phone grip with black tulip design and Gift For You engraving - Black
Detail of red tulip MagSafe phone grip with silver ring and Gift For You text - Red
+6
Magnetic Phone Grip Holder Tulip Shape Magnetic Suction Expanding Socket For Magsafe Silicone Matte Flower Decorative Bracket
-9%
$2.02
No MOQ
Free Shipping
Magnetic Heart Phone Grip Stand Acrylic Expandable Folding Desktop Bracket Compatible Magnetic Suction Heart Shape Accessory
Magnetic Heart Phone Grip Stand Acrylic Expandable Folding Desktop Bracket Compatible Magnetic Suction Heart Shape Accessory
like
Find Similar
Detail of pink heart Magsafe phone grip with Pink Love text on a ceramic jewelry tray - Pink LOVE
Top view of a pink heart MagSafe phone socket with Romantic text on a yellow ceramic tray - Pink Romantic
Pink heart-shaped MagSafe phone grip with Weekend text resting on a ceramic dish - Pink Yes
Pink ceramic tray with yellow border and gift card showing hand-painted spiral texture - Pink With Lace Edge
+5
Magnetic Heart Phone Grip Stand Acrylic Expandable Folding Desktop Bracket Compatible Magnetic Suction Heart Shape Accessory
-9%
$1.78
No MOQ
Realistic Orchid Flower Magnetic Suction Phone Holder Acrylic Foldable Grip Universal Floral Desktop Bracket
Realistic Orchid Flower Magnetic Suction Phone Holder Acrylic Foldable Grip Universal Floral Desktop Bracket
like
Find Similar
Macro detail of 3D orchid acrylic phone grip with gradient petals and foldable base - Light Purple Orchid (1)
Macro view of pink orchid flower Magsafe grip mounted on white smartphone back - Pink Orchid (2)
Detail of pink orchid acrylic phone grip with Magsafe suction and floral design - Pink Purple Gradient Orchid (3)
Detailed view of pink floral MagSafe grip stand with realistic layered acrylic petals - Gradient Pink Petal (4)
+4
Realistic Orchid Flower Magnetic Suction Phone Holder Acrylic Foldable Grip Universal Floral Desktop Bracket
-9%
$2.10
Mix MOQ : 2
Magnetic Phone Grip Retractable Spherical Crystal Ball Stand Resin Glitter Artificial Pearl Desktop Mobile Accessory Gift Suction
Magnetic Phone Grip Retractable Spherical Crystal Ball Stand Resin Glitter Artificial Pearl Desktop Mobile Accessory Gift Suction
like
Find Similar
Macro shot of a bright green mini folding chair phone holder with a pearlescent cream jar - White Glitter
Detail of orange sphere phone grip on a mini green folding chair stand accessory - Orange Glitter
Macro detail of pink shimmer cream blush in a clear case on a green miniature chair - Pink Glitter
Close-up of a pink magnetic phone holder on a mini green folding chair stand - Glitter Red
+4
Magnetic Phone Grip Retractable Spherical Crystal Ball Stand Resin Glitter Artificial Pearl Desktop Mobile Accessory Gift Suction
-9%
$2.17
No MOQ
Free Shipping
Colorful Artificial Pearl Phone Grip Holder Round Magnetic Suction Stand Adhesive Bracket Plastic DIY Universal Accessories
Colorful Artificial Pearl Phone Grip Holder Round Magnetic Suction Stand Adhesive Bracket Plastic DIY Universal Accessories
like
Find Similar
Detail of a pearl-rimmed phone grip base featuring a clear design and adhesive pad - White
Detailed close-up of champagne pearl circular phone grip with polished pearl finish - Orange
Detail of round phone socket with light pink pearls and a transparent resin base - Pink
Macro shot of circular phone grip featuring iridescent colorful pearls on a white base - Black
+7
NewColorful Artificial Pearl Phone Grip Holder Round Magnetic Suction Stand Adhesive Bracket Plastic DIY Universal Accessories
-9%
$1.44
No MOQ
Free Shipping
Magnetic Couple Bracelets Stainless Steel Tree Of Life Heart Suction Adjustable Nylon Braided Rope Lovers Jewelry
Magnetic Couple Bracelets Stainless Steel Tree Of Life Heart Suction Adjustable Nylon Braided Rope Lovers Jewelry
like
Find Similar
Detail of red and black magnetic couple bracelets with Tree of Life charms on wood - Black and Red Pair
Detail of tree of life charm and heart magnetic clasps on black braided rope bracelets - Black (Pair)
Detail of tree of life charm and magnetic heart pendants on adjustable cord bracelets - Black and White Pair
Detail of tree of life charm and heart magnetic buckle on black and pink couple bracelets - Black and Pink Pair
+3
Magnetic Couple Bracelets Stainless Steel Tree Of Life Heart Suction Adjustable Nylon Braided Rope Lovers Jewelry
$1.57
No MOQ
 · 
14 views
Free Shipping
Magnetic Phone Holder Butterfly Embroidery Faux Artificial Pearl Suction Griptok Collapsible Desk Stand Elegant INS Style Lady Gift
Magnetic Phone Holder Butterfly Embroidery Faux Artificial Pearl Suction Griptok Collapsible Desk Stand Elegant INS Style Lady Gift
like
Find Similar
Detail of embroidered yellow butterfly phone grip with faux pearl beads and magnetic suction - Magnetic Pearl Embroidery Butterfly-Orange
Detail of pink butterfly embroidery phone grip with pearls and 'Gift For You' text - Magnetic Pearl Embroidery Butterfly-Pink
Detail of light blue embroidered butterfly phone grip with white faux pearl embellishments - Magnetic Pearl Embroidery Butterfly-Blue
Detailed macro of embroidered green butterfly phone grip with white pearl accents - Magnetic Pearl Embroidery Butterfly-Fruit Green
+3
Magnetic Phone Holder Butterfly Embroidery Faux Artificial Pearl Suction Griptok Collapsible Desk Stand Elegant INS Style Lady Gift
-9%
$2.10
No MOQ
Alloy Heart Pendants Magnetic Suction Love You Miss You Puzzle Stitching For Couple Best Friends Simple Creative Jewelry
Alloy Heart Pendants Magnetic Suction Love You Miss You Puzzle Stitching For Couple Best Friends Simple Creative Jewelry
like
Find Similar
Golden magnetic heart puzzle pendant necklace accessory for couples and best friends - Heart Lettering Magnetic Style / Gold
Silver magnetic heart pendant set for couples with love you and miss you engraving - Heart Lettering Magnetic Style / Silver
Magnetic heart-shaped pendants with 'Love you' and 'Miss you' engravings for necklaces - Heart Lettering Magnetic Style / Black
Magnetic heart-shaped split pendants with cute red footprint design for friendship - Footprint Bow Magnetic Style / White
Alloy Heart Pendants Magnetic Suction Love You Miss You Puzzle Stitching For Couple Best Friends Simple Creative Jewelry
$0.36
Mix MOQ : 2
 · 
15 sold recently
Free Shipping
Creative Brain And Coffee Enamel Pin Badge Funny Mental Health Brooch For Clothing Backpacks Unisex Gift Fashion Accessory
Creative Brain And Coffee Enamel Pin Badge Funny Mental Health Brooch For Clothing Backpacks Unisex Gift Fashion Accessory
like
Find Similar
Coffee cup enamel pin featuring A Cup of Get Shit Done text on white background - Inspirational Slogan Coffee Cup Style (QHXZ4428)
Coffee pot enamel pin with Key to Survival text in black and brown finish - Key To Survival Coffee Pot Style (QHXZ4429)
Detail of coffee cup hugging a pink brain enamel pin representing mental inspiration - Brain Hugging Coffee Cup Style (QHXZ4430)
Creative enamel brain pin with coffee cup patterns for mental health awareness - Qhxz4431
Creative Brain And Coffee Enamel Pin Badge Funny Mental Health Brooch For Clothing Backpacks Unisex Gift Fashion Accessory
-9%
$0.39
No MOQ
Free Shipping
Creative Enamel Book Hedgehog Brooch Alloy Lapel Pin Reading Theme Badge For Clothes Bag Decoration Literary Student Gift
Creative Enamel Book Hedgehog Brooch Alloy Lapel Pin Reading Theme Badge For Clothes Bag Decoration Literary Student Gift
like
Find Similar
Enamel book pin with coffee cup featuring Drink Read Love engraved spines - Stacked Books With Coffee Cup Style (XZ2246)
Enamel hedgehog pin wearing a scarf and reading a book on Just One More Page base - Reading Hedgehog Style (XZ1580)
Creative Enamel Book Hedgehog Brooch Alloy Lapel Pin Reading Theme Badge For Clothes Bag Decoration Literary Student Gift
-7%
$0.58
No MOQ
Cartoon Cat Enamel Pin Set Zinc Alloy Catpuccino Cat Mom Brooch Fashion Jewelry Gift For Women Men Denim Jacket Accessory
Cartoon Cat Enamel Pin Set Zinc Alloy Catpuccino Cat Mom Brooch Fashion Jewelry Gift For Women Men Denim Jacket Accessory
like
Find Similar
Cute round enamel cat badge with Hug All The Cats text and cartoon feline illustrations - HUG ALL THE CATS Round Style (QHXZ3437)
Catpuccino enamel pin featuring cute cartoon cats in a coffee cup design badge - CATPUCCINO Coffee Cup Style (QHXZ3438)
Cartoon enamel pin featuring four white cats in colorful coffee cups with a floral tray - Distracted by Cats & Coffee Collage Style (QHXZ3439)
Enamel cat skeleton pin featuring 'THIS IS ALMOST ENOUGH CATS' text for cat lovers - THIS IS ALMOST ENOUGH CATS Square Style (QHXZ3440)
+1
Cartoon Cat Enamel Pin Set Zinc Alloy Catpuccino Cat Mom Brooch Fashion Jewelry Gift For Women Men Denim Jacket Accessory
-9%
$0.50
No MOQ
Free Shipping
Soccer Theme Party Tableware Decorations Football Printed Paper Plates Napkins Tablecloth Banner Balloons For Birthday Sports Events Fans Celebration
Soccer Theme Party Tableware Decorations Football Printed Paper Plates Napkins Tablecloth Banner Balloons For Birthday Sports Events Fans Celebration
like
Find Similar
Soccer party paper plates 10-piece set 23cm for birthday sports event decorations - Large Soccer Paper Plates
Set of 10 football theme 18cm paper plates with Goal text for sports birthday parties - Small Soccer Paper Plates
Set of 10 soccer pattern disposable paper plates for football theme birthday party 7 inch - Black and White Soccer Small Plates
Detail of 10-piece soccer theme 9-inch paper plates with classic football pattern design - Black and White Soccer Large Plates
+19
Soccer Theme Party Tableware Decorations Football Printed Paper Plates Napkins Tablecloth Banner Balloons For Birthday Sports Events Fans Celebration
$0.32-4.18
Mix MOQ : 5
 · 
19 sold recently
Soccer Theme Party Decorative Glasses Football Championship Celebration Props For Fans Bars Clubs Game Day Sport Eyewear
Soccer Theme Party Decorative Glasses Football Championship Celebration Props For Fans Bars Clubs Game Day Sport Eyewear
like
Find Similar
Soccer ball shaped party glasses with red temples for World Cup celebrations - Soccer Large Style
Soccer party glasses with orange and black frame, 17.8cm wide, ideal for fan celebrations - Soccer Shooting Style
Felt soccer party glasses with crown and number one finger foam decoration - Soccer Goalkeeper
Soccer party glasses with flame motif and soccer ball pattern for world cup celebrations - Soccer Yellow Green
+19
Soccer Theme Party Decorative Glasses Football Championship Celebration Props For Fans Bars Clubs Game Day Sport Eyewear
-5%
$0.55
Mix MOQ : 2
Soccer Party Glasses Football Theme Felt Plastic Eyewear For Fan Cheer Sports Event Celebration Party Photo Prop
Soccer Party Glasses Football Theme Felt Plastic Eyewear For Fan Cheer Sports Event Celebration Party Photo Prop
like
Find Similar
Detail showing 16x12cm dimensions of the football party glasses with athlete silhouettes - Football Contention Black Purple
Detail view of soccer fan party glasses with size specs 15cm width and trophy decor - Soccer Trophy Celebration
Detail showing football party glasses dimensions 18.5x12.7cm with weight of 16.4g - Green Field Shooting
Detailed view of green football party glasses frame with 17x13cm dimension and weight info - FOOTBALL Stars
+17
Soccer Party Glasses Football Theme Felt Plastic Eyewear For Fan Cheer Sports Event Celebration Party Photo Prop
-5%
$0.55
Mix MOQ : 2
Brass Zircon Cartilage Stud Earrings With Silver Earring Post Cute Sweet Ice Cream Heart Candy Shape Screw Back Jewelry
Brass Zircon Cartilage Stud Earrings With Silver Earring Post Cute Sweet Ice Cream Heart Candy Shape Screw Back Jewelry
like
Find Similar
Pink heart-shaped zircon ear stud with a rose gold bow and screw-back closure - Heart with Bow / Rose Gold
Pink heart-shaped gemstone earring with 18K gold screw back stud design - Heart with Bow / Silver
Rose gold ice cream stud earring with colorful cubic zirconia and ball screw back - Ice Cream / Rose Gold
Silver ice cream cone stud earring featuring orange, yellow, and purple zircon stones - Ice Cream / Silver
+26
Brass Zircon Cartilage Stud Earrings With Silver Earring Post Cute Sweet Ice Cream Heart Candy Shape Screw Back Jewelry
$1.05-1.26
No MOQ
 · 
22 views
Free Shipping
Football Soccer Theme Headbands Sports Fans Cheering Accessories Trophy Goal Ball Design Party Favors Festive Decorations
Football Soccer Theme Headbands Sports Fans Cheering Accessories Trophy Goal Ball Design Party Favors Festive Decorations
like
Find Similar
Red soccer party headband featuring Goal and Soccer text with specific product dimensions - Goal Soccer Match Style
Red soccer fan headband with jersey number 10 and goalpost design for World Cup support - Soccer Goal Post Style
Red Football themed party headband with trophy and ball icons, sized 23.5cm by 15.8cm - Football Trumpet Style
Soccer headband with Happy European text and player silhouette for party fans - Happy European Cup Style
+11
Football Soccer Theme Headbands Sports Fans Cheering Accessories Trophy Goal Ball Design Party Favors Festive Decorations
-5%
$0.49
Mix MOQ : 2
Zircon Cartilage Ear Studs Titanium Steel Screw Back Butterfly Spider Flower Heart Piercing Jewelry Fashion Accessory
Zircon Cartilage Ear Studs Titanium Steel Screw Back Butterfly Spider Flower Heart Piercing Jewelry Fashion Accessory
like
Find Similar
Silver heart stud earring with pearl and cubic zirconia, measuring 0.74cm by 0.72cm - Zircon Heart with Pearl (940-2#银) / Silver
Silver stainless steel stud earring featuring a flower cup design with orange stones - Drink Cup Style (940-1#银) / Silver
Silver spider stud earring with iridescent heart crystal and precise size dimensions - Iridescent Heart Spider (940-4#银) / Silver
Gold stainless steel juice cup stud earring with yellow and orange zircon crystals - Drink Cup Style (940-1#金) / Gold
+10
Zircon Cartilage Ear Studs Titanium Steel Screw Back Butterfly Spider Flower Heart Piercing Jewelry Fashion Accessory
$1.17-1.41
No MOQ
 · 
34 sold recently
Free Shipping
Embroidered Coffee Curtain Lace Small Window Valance Polyester Semi Transparent Rod Pocket Nordic Vintage Kitchen Decor
Embroidered Coffee Curtain Lace Small Window Valance Polyester Semi Transparent Rod Pocket Nordic Vintage Kitchen Decor
like
Find Similar
White semi-sheer cafe curtain with coffee embroidery and elegant wave pattern hem - Coffee Cup Embroidery Style (60*70cm)
White lace kitchen valance with purple lavender embroidery and wavy edges for window - Lavender Embroidery Style (50*150cm)
Beige American cafe curtain with ladybug embroidery hanging in a cozy dining room - Ladybug Flower Embroidery Style (140*60cm)
French country style cafe curtain with colorful butterfly patterns and lace trim - Butterfly Embroidery Lace Style (140*60cm)
+7
Embroidered Coffee Curtain Lace Small Window Valance Polyester Semi Transparent Rod Pocket Nordic Vintage Kitchen Decor
-5%
$2.74-6.27
No MOQ
Vintage Lace Coffee Curtain Polyester Short Window Valance Rod Pocket Embroidered Pastoral Home Decor For Kitchen Cafe
Vintage Lace Coffee Curtain Polyester Short Window Valance Rod Pocket Embroidered Pastoral Home Decor For Kitchen Cafe
like
Find Similar
White semi-sheer cafe curtain with coffee embroidery and elegant wave pattern hem - 60*70 / Coffee Cup
White lace kitchen valance with purple lavender embroidery and wavy edges for window - 50*150 / Lavender Coffee Curtain
Beige American cafe curtain with ladybug embroidery hanging in a cozy dining room - 140*60 / Ladybug
French country style cafe curtain with colorful butterfly patterns and lace trim - 140*60 / Butterfly
+7
Vintage Lace Coffee Curtain Polyester Short Window Valance Rod Pocket Embroidered Pastoral Home Decor For Kitchen Cafe
$2.88-6.60
No MOQ
French Style Lace Coffee Curtain Polyester Gauze Rod Pocket Short Valance For Kitchen Cabinet Pastoral Embroidered
French Style Lace Coffee Curtain Polyester Gauze Rod Pocket Short Valance For Kitchen Cabinet Pastoral Embroidered
like
Find Similar
Detail of white lace cafe curtain featuring yellow daisy embroidery and scalloped edges - W150*H45 / Yellow Heart Coffee Curtain
Close-up of white lace cafe curtain with heart embroidery and elegant scalloped edge - W150*H45 / White Heart Coffee Curtain
White lace cafe curtain with coffee embroidery and elegant scalloped lace hem - W150*H45 / Coffee Cup Pattern Curtain
White lace coffee curtain with colorful butterfly prints and rod pocket design - W150*H45 / Four-Color Butterfly Curtain
+30
French Style Lace Coffee Curtain Polyester Gauze Rod Pocket Short Valance For Kitchen Cabinet Pastoral Embroidered
-5%
$2.41-4.93
No MOQ
Geometric Copper Huggie Hoop Earrings Gold Plated Minimalist Fashion Jewelry For Women
Geometric Copper Huggie Hoop Earrings Gold Plated Minimalist Fashion Jewelry For Women
like
Find Similar
Detail of minimalist gold-plated geometric hoop earrings featuring a small inset zircon stone - Minimalist Single Stone / Gold
Detailed close-up of gold geometric hoop earrings with textured bamboo-style design - Bamboo Texture Hoop / Gold
Detailed view of gold hoop earrings with unique embossed octopus sucker texture on metal - Suction Cup Dot Pattern / Gold
Detail view of 15mm golden hoop earrings featuring intricate hollow heart pattern engravings - Hollow Heart / Gold
+4
Geometric Copper Huggie Hoop Earrings Gold Plated Minimalist Fashion Jewelry For Women
$0.94
Mix MOQ : 2
 · 
14 views
Free Shipping
Football Floating Liquid Quicksand Keychain Acrylic Clear Bag Charm Glitter Star Heart Soccer Fan Gift Cute Decorative
Football Floating Liquid Quicksand Keychain Acrylic Clear Bag Charm Glitter Star Heart Soccer Fan Gift Cute Decorative
like
Find Similar
Acrylic quicksand keychain with soccer ball and gold star glitters in a liquid bottle - Strawberry Shape
Cloud-shaped acrylic keychain with green liquid quicksand and miniature soccer ball - Cloud Shape
Acrylic quicksand keychain with liquid football and gold glitter in a cup shape - Coffee Cup Shape
Close-up of candy-shaped acrylic keychain with green liquid, glitters and a mini football - Candy Shape
+2
Football Floating Liquid Quicksand Keychain Acrylic Clear Bag Charm Glitter Star Heart Soccer Fan Gift Cute Decorative
-9%
$0.89
Mix MOQ : 10
Soccer Football Wall Decal PVC Self Adhesive Sports Theme Room Decor Removable Vinyl Stickers For Bedroom Living Room
Soccer Football Wall Decal PVC Self Adhesive Sports Theme Room Decor Removable Vinyl Stickers For Bedroom Living Room
like
Find Similar
Classic black and white Soccer wall sticker with stars for home sports room decor - 30cm*30cm*1 (OPP Bag) / World Cup Soccer Sticker ZQ2633 (Self-Adhesive)
Soccer Football Wall Decal PVC Self Adhesive Sports Theme Room Decor Removable Vinyl Stickers For Bedroom Living Room
$0.72
No MOQ
Football Soccer Wall Stickers PVC Waterproof Removable Art Decal For Kids Room Bedroom Sport Fan Decor Lettering
Football Soccer Wall Stickers PVC Waterproof Removable Art Decal For Kids Room Bedroom Sport Fan Decor Lettering
like
Find Similar
Football wall sticker detail showing letters and soccer silhouettes for room decoration - World Cup Football Sticker (With Adhesive) / 30cm*20cm*2 Sheets(ZQ2626)
Football Soccer Wall Stickers PVC Waterproof Removable Art Decal For Kids Room Bedroom Sport Fan Decor Lettering
$1.01
No MOQ
Soccer Window Stickers Static Cling PVC Colorful Football Athlete Silhouette Inspirational Quotes Glass Door Decor Sports
Soccer Window Stickers Static Cling PVC Colorful Football Athlete Silhouette Inspirational Quotes Glass Door Decor Sports
like
Find Similar
Rainbow gradient soccer wall decal showing athlete silhouette and I'M BUSTING slogan - 60cm*40cm / World Cup Soccer Static Cling (ZQ2625)
Soccer Window Stickers Static Cling PVC Colorful Football Athlete Silhouette Inspirational Quotes Glass Door Decor Sports
-5%
$1.86
No MOQ
Green Metallic Foil Soccer Fan Cheerleader Costume Accessories Wig Pom Poms Fringe Skirt Whistle Tattoo Sticker Party Prop
Green Metallic Foil Soccer Fan Cheerleader Costume Accessories Wig Pom Poms Fringe Skirt Whistle Tattoo Sticker Party Prop
like
Find Similar
Green sequin 2026 World Cup soccer cheerleading set with wig, skirt, and pom-poms - World Cup Fan 5-Piece Set
Green Metallic Foil Soccer Fan Cheerleader Costume Accessories Wig Pom Poms Fringe Skirt Whistle Tattoo Sticker Party Prop
$3.23
Mix MOQ : 3
Soccer Wrist Flower Cheerleader Pom Poms PET Streamers For Football Fans Cheering Dance Performance Party Costume Props
Soccer Wrist Flower Cheerleader Pom Poms PET Streamers For Football Fans Cheering Dance Performance Party Costume Props
like
Find Similar
Soccer themed black and white tinsel wrist flower for cheerleading and sports fans - Black & White Style
Red and black football wrist flower tinsel pom-pom for cheerleader fans 5.2g weight - Black and Red Style
Cheerleader green and gold soccer tinsel wrist flower for world cup fans cheering - Gold and Green Style
Green tinsel football wrist flower prop for cheerleaders and sports fans cheering - Green Tinsel Style / World Cup Football Wrist Corsage
Soccer Wrist Flower Cheerleader Pom Poms PET Streamers For Football Fans Cheering Dance Performance Party Costume Props
$0.29
Mix MOQ : 3
Soccer Temporary Tattoo Face Stickers Football Theme Global Tournament Decals For Cheerleading Party Event
Soccer Temporary Tattoo Face Stickers Football Theme Global Tournament Decals For Cheerleading Party Event
like
Find Similar
Watercolor soccer temporary tattoo stickers with World Cup trophy and GOAL text designs - Watercolor Soccer World Cup A
Detailed set of 12 vibrant soccer tattoo stickers with football field and trophy designs - Soccer World Cup B
Soccer Temporary Tattoo Face Stickers Football Theme Global Tournament Decals For Cheerleading Party Event
$0.13
Mix MOQ : 12
 · 
24 sold recently
Soccer Football Static Window Clings Double Sided PVC Removable Decals Cartoon Player Trophy Decoration Kids Boys Room Glass
Soccer Football Static Window Clings Double Sided PVC Removable Decals Cartoon Player Trophy Decoration Kids Boys Room Glass
like
Find Similar
Detailed view of 4-sheet 2026 soccer window clings set with cartoon kids and trophy graphics - World Cup Soccer (ZQ2616) / 30x20cm X 4 Sheets
Soccer Football Static Window Clings Double Sided PVC Removable Decals Cartoon Player Trophy Decoration Kids Boys Room Glass
-4%
$1.78
No MOQ
Soccer Football Cartoon Window Stickers Static Cling PVC Double Sided Decals Kids Room Party Decoration Sports Theme
Soccer Football Cartoon Window Stickers Static Cling PVC Double Sided Decals Kids Room Party Decoration Sports Theme
like
Find Similar
Detailed sheet of 2026 World Cup soccer stickers showing static film decal sizes and designs - Soccer World Cup Style (ZQ2614)
Soccer Football Cartoon Window Stickers Static Cling PVC Double Sided Decals Kids Room Party Decoration Sports Theme
$1.87
No MOQ
Cute Glowing Rabbit Bear Cat Keychain LED Light Acrylic Glitter Animal Bag Pendant Car Keyring Gift For Women Girls Backpack Charms
Cute Glowing Rabbit Bear Cat Keychain LED Light Acrylic Glitter Animal Bag Pendant Car Keyring Gift For Women Girls Backpack Charms
like
Find Similar
Luminous Hello Kitty keychain with purple laser strap and pink glitter ball ornament - Cat [pink]
Hello Kitty keychain featuring pink gradient strap and red sequin ball charm - Cat [fuchsia]
Purple Hello Kitty 3D doll keychain with glitter ball and holographic wrist strap - Cat [purple]
Pink and blue Hello Kitty keychain featuring a polka dot bow and iridescent blue strap - Cat [blue]
+27
Cute Glowing Rabbit Bear Cat Keychain LED Light Acrylic Glitter Animal Bag Pendant Car Keyring Gift For Women Girls Backpack Charms
-9%
$0.78-1.18
No MOQ
 · 
141 sold recently
Creative Acrylic Liquid Quicksand Keychain Floating Lighthouse Sailboat Bag Pendant Nautical Style Ocean Theme Gift
Creative Acrylic Liquid Quicksand Keychain Floating Lighthouse Sailboat Bag Pendant Nautical Style Ocean Theme Gift
like
Find Similar
Acrylic quicksand keychain featuring a nautical lighthouse in blue liquid with gold ring - Alarm Clock
Lighthouse acrylic liquid quicksand keychain with blue oil and golden metal ring - TV Shape
Detail of nautical keychain with lighthouse, blue liquid and sequins in acrylic cube - Square Bottle Shape
Macro shot of cat-claw-shaped acrylic liquid keychain with blue glitter and gold ring - Cat Paw Shape
+1
Creative Acrylic Liquid Quicksand Keychain Floating Lighthouse Sailboat Bag Pendant Nautical Style Ocean Theme Gift
-16%
$0.94
No MOQ
Unicorn Bear Rabbit Animal Quicksand Keychain Acrylic Resin Floating Colorful Beads Bell Liquid Bag Charm Pendant
Unicorn Bear Rabbit Animal Quicksand Keychain Acrylic Resin Floating Colorful Beads Bell Liquid Bag Charm Pendant
like
Find Similar
Pink bear keychain with purple liquid glitter and sand effect, featuring a green heart - Purple Bear
Unicorn oil liquid keychain with white cat head, red liquid sand and colorful beads - Lucky Red Cat Rabbit
Creative blue cat liquid quicksand keychain with colorful beads and golden ring - Lucky Blue Cat Rabbit
Creative white lucky cat keychain with colorful flowing beads inside a liquid globe - Lucky White Cat Rabbit
+33
Unicorn Bear Rabbit Animal Quicksand Keychain Acrylic Resin Floating Colorful Beads Bell Liquid Bag Charm Pendant
-9%
$0.78-0.96
No MOQ
Capybara Liquid Quicksand Keychain Acrylic Floating Strawberry Figure Heart Cat Paw Bottle Keyring With Golden Bell
Capybara Liquid Quicksand Keychain Acrylic Floating Strawberry Figure Heart Cat Paw Bottle Keyring With Golden Bell
like
Find Similar
Capybara acrylic oil liquid keyring with strawberry doll and golden star glitter - Black Gold Wishing Bottle
Capybara keychain with liquid drift bottle effect and strawberry hat charm - Green TV
Creative Capybara liquid floating cup keychain with blue oil, stars and golden bell - Blue Heart Cup
Cat paw liquid keychain with golden stars, white pearls and a strawberry bear charm - Purple Cat Paw
+1
Capybara Liquid Quicksand Keychain Acrylic Floating Strawberry Figure Heart Cat Paw Bottle Keyring With Golden Bell
-8%
$0.92
Mix MOQ : 2
Creative Liquid Glitter Keychain Acrylic Cartoon Bunny Figure Floating Oil Pendant Cute Bag Hanging Ornament Gift For Girls
Creative Liquid Glitter Keychain Acrylic Cartoon Bunny Figure Floating Oil Pendant Cute Bag Hanging Ornament Gift For Girls
like
Find Similar
Pink heart-shaped liquid quicksand keychain with cute rabbit doll and cherry blossoms - Perfume Bottle (Pink Rabbit)
Creative Capybara bunny milk tea bottle keychain with pink liquid and glitter - Milk Tea Cup (Pink Rabbit)
Pink heart-shaped liquid quicksand keychain with cute bunny figure and gold metal clasp - Heart Lollipop (Pink Rabbit)
Pink lollipop keychain with rabbit figure in liquid acrylic oil and golden hardware - Round Lollipop (Pink Rabbit)
+1
Creative Liquid Glitter Keychain Acrylic Cartoon Bunny Figure Floating Oil Pendant Cute Bag Hanging Ornament Gift For Girls
-9%
$0.96
Mix MOQ : 2
Women Crew Socks Cotton Ribbed Speckled Yarn Embroidered Cherry Apple Cupcake Japanese Style Kawaii Sweet Breathable
Women Crew Socks Cotton Ribbed Speckled Yarn Embroidered Cherry Apple Cupcake Japanese Style Kawaii Sweet Breathable
like
Find Similar
Black ribbed crew socks with colorful flecks and cute puppy embroidery details - One Size / Black Bear (CUTEY)
Creamy dotted yarn mid-calf socks featuring cherry embroidery and ribbed cuffs - One Size / Off-White Cherry (Cherry)
Beige knit crew socks featuring red apple embroidery and textured speckled fabric - One Size / Khaki Apple (APPLE)
Grey ribbed crew socks with colorful nep yarn dots and blue side embroidery detail - One Size / Light Grey Bowknot (BOWKNOT)
+2
Women Crew Socks Cotton Ribbed Speckled Yarn Embroidered Cherry Apple Cupcake Japanese Style Kawaii Sweet Breathable
$1.30
Mix MOQ : 2
Women Cotton Blend Mid Calf Socks Cartoon Embroidery Lettuce Edge Japanese Style Breathable Casual
Women Cotton Blend Mid Calf Socks Cartoon Embroidery Lettuce Edge Japanese Style Breathable Casual
like
Find Similar
Black mid-calf cotton socks featuring colorful specks and cute cartoon face applique - Black with Cartoon Face Embroidery
Japanese style black cotton socks with yellow ruffle trim and blue cartoon teacup embroidery - Black with Coffee Cup Pattern
Cute white cotton socks with black ruffle trim and red cartoon tomato embroidery detail - White with Tomato Pattern
Ginger yellow cotton socks with blue contrast trim and cute smile face embroidery - Yellow Smile Face
Women Cotton Blend Mid Calf Socks Cartoon Embroidery Lettuce Edge Japanese Style Breathable Casual
-5%
$1.26
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access