Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Punk Alloy Enamel Pin Rose Coffee Cup And OK Hand Gesture Fun Brooch Badge Accessory For Jackets Bags Men Women Jewelry
Punk Alloy Enamel Pin Rose Coffee Cup And OK Hand Gesture Fun Brooch Badge Accessory For Jackets Bags Men Women Jewelry
like
Find Similar
Detail shot of OK hand gesture enamel pin with black and white minimalist design - OK Hand Gesture Style (C1470-1)
Punk Alloy Enamel Pin Rose Coffee Cup And OK Hand Gesture Fun Brooch Badge Accessory For Jackets Bags Men Women Jewelry
-9%
$0.50
No MOQ
Free Shipping
Cartoon Rabbit In Cup Pink Flower Toilet Sticker Waterproof PVC Bathroom Wall Decal Creative Home Decoration Accessory fun-m37
Cartoon Rabbit In Cup Pink Flower Toilet Sticker Waterproof PVC Bathroom Wall Decal Creative Home Decoration Accessory fun-m37
like
Find Similar
Cartoon rabbit in flower teacup wall sticker showing precise product size 27x29cm - 27*29CM (fun-m37)
Cartoon Rabbit In Cup Pink Flower Toilet Sticker Waterproof PVC Bathroom Wall Decal Creative Home Decoration Accessory fun-m37
$0.72
No MOQ
Cartoon Creative Cup Flower Potted Plant Wall Stickers PVC Waterproof Self-Adhesive Floral Decals For Living Room Bedroom Kitchen Home Decor
Cartoon Creative Cup Flower Potted Plant Wall Stickers PVC Waterproof Self-Adhesive Floral Decals For Living Room Bedroom Kitchen Home Decor
like
Find Similar
Detailed view of six floral cup wall stickers with dimensions 30x20cm for home decoration - 20*30cm
Cartoon Creative Cup Flower Potted Plant Wall Stickers PVC Waterproof Self-Adhesive Floral Decals For Living Room Bedroom Kitchen Home Decor
-5%
$1.64
No MOQ
Modern Minimalist PVC Coffee Cup Heart Pattern Wall Sticker Removable DIY Wall Decal For Kitchen Cafe Bedroom Home Wall Decoration
Modern Minimalist PVC Coffee Cup Heart Pattern Wall Sticker Removable DIY Wall Decal For Kitchen Cafe Bedroom Home Wall Decoration
like
Find Similar
Coffee cup wall sticker dimensions 58x27cm with heart and I Love Coffee text - 27*58cm Layout
Modern Minimalist PVC Coffee Cup Heart Pattern Wall Sticker Removable DIY Wall Decal For Kitchen Cafe Bedroom Home Wall Decoration
$1.21
No MOQ
Stainless Steel Drink Cup Pendant Necklace Set With Rhinestone Cute Beverage Soda Bottle Gold Plated Jewelry For Women Girls Gift
Stainless Steel Drink Cup Pendant Necklace Set With Rhinestone Cute Beverage Soda Bottle Gold Plated Jewelry For Women Girls Gift
like
Find Similar
Close-up of gold cup pendant necklace with sparkling zircon straw detail and fine chain - Necklace-Gold-White Zirconia
Stainless Steel Drink Cup Pendant Necklace Set With Rhinestone Cute Beverage Soda Bottle Gold Plated Jewelry For Women Girls Gift
$3.35
No MOQ
Free Shipping
Watercolor Coffee Time Wall Stickers For Kitchen Cafe Home Decor Self Adhesive Vinyl Decals Cups And Pastries Pattern
Watercolor Coffee Time Wall Stickers For Kitchen Cafe Home Decor Self Adhesive Vinyl Decals Cups And Pastries Pattern
like
Find Similar
Coffee theme wall stickers with mugs and candles in warm vintage earth tones - Kitchen Candle Coffee Style (SC397-30X60)
NewWatercolor Coffee Time Wall Stickers For Kitchen Cafe Home Decor Self Adhesive Vinyl Decals Cups And Pastries Pattern
$1.21
Mix MOQ : 4
Our Kitchen Wall Decal Coffee Cup Knife Fork Spoon Removable Vinyl Wall Sticker For Kitchen Dining Room Restaurant Decor
Our Kitchen Wall Decal Coffee Cup Knife Fork Spoon Removable Vinyl Wall Sticker For Kitchen Dining Room Restaurant Decor
like
Find Similar
Kitchen wall decal featuring coffee pot, cutlery, and 'Our Kitchen' text, size 40x30cm - 30*40cm
Our Kitchen Wall Decal Coffee Cup Knife Fork Spoon Removable Vinyl Wall Sticker For Kitchen Dining Room Restaurant Decor
-4%
$0.82
No MOQ
Creative Coffee Heartbeat Wall Sticker Removable PVC Heart Coffee Cup Decal For Cafe Kitchen Dining Room Home Wall Decor
Creative Coffee Heartbeat Wall Sticker Removable PVC Heart Coffee Cup Decal For Cafe Kitchen Dining Room Home Wall Decor
like
Find Similar
Detail view of heartbeat coffee wall decal measuring 60cm by 25cm for cafe decor - 25*60cm Layout (DZ796)
Creative Coffee Heartbeat Wall Sticker Removable PVC Heart Coffee Cup Decal For Cafe Kitchen Dining Room Home Wall Decor
$0.72
No MOQ
Watercolor Coffee Cup Heart Latte Pink Rose Flower Wall Sticker Removable PVC Decal For Kitchen Dining Room Home Decor
Watercolor Coffee Cup Heart Latte Pink Rose Flower Wall Sticker Removable PVC Decal For Kitchen Dining Room Home Decor
like
Find Similar
Detailed size chart for MG-F008 coffee and pink flower wall sticker, 39cm by 39cm dimensions - 39*39cm/MG-F008
Watercolor Coffee Cup Heart Latte Pink Rose Flower Wall Sticker Removable PVC Decal For Kitchen Dining Room Home Decor
$1.15
No MOQ
Coffee Time Wall Stickers PVC Waterproof Coffee Cup Beans Decal DIY Kitchen Dining Room Cafe Decor Removable Art Poster
Coffee Time Wall Stickers PVC Waterproof Coffee Cup Beans Decal DIY Kitchen Dining Room Cafe Decor Removable Art Poster
like
Find Similar
Detailed dimensions of Coffee Time wall sticker showing 30x20cm sheet and layout size - Coffee Time (HY-F785) / 20x30cm
Coffee Time Wall Stickers PVC Waterproof Coffee Cup Beans Decal DIY Kitchen Dining Room Cafe Decor Removable Art Poster
$0.72
No MOQ
Creative Beverage Drink Cup Enamel Brooch Zinc Alloy Badge Cartoon Lettering Pin Fashion Clothes Bag Accessories Jewelry Gift
Creative Beverage Drink Cup Enamel Brooch Zinc Alloy Badge Cartoon Lettering Pin Fashion Clothes Bag Accessories Jewelry Gift
like
Find Similar
Enamel pin badge featuring a mint green beverage cup with 'I just Love having A blast' text - Mint Green Drink Cup Style (QHXZ3282)
Creative Beverage Drink Cup Enamel Brooch Zinc Alloy Badge Cartoon Lettering Pin Fashion Clothes Bag Accessories Jewelry Gift
-8%
$0.42
No MOQ
Free Shipping
Coffee Bean Cup 3D Embossed Nail Stickers Brown Retro Coffee Life Theme Self Adhesive Nail Art Decoration For DIY Manicure
Coffee Bean Cup 3D Embossed Nail Stickers Brown Retro Coffee Life Theme Self Adhesive Nail Art Decoration For DIY Manicure
like
Find Similar
Detailed 3D embossed coffee bean and cup nail art stickers with enjoy life text decor - Coffee Life Theme (#287) / With Card Packaging
Coffee Bean Cup 3D Embossed Nail Stickers Brown Retro Coffee Life Theme Self Adhesive Nail Art Decoration For DIY Manicure
$0.72
No MOQ
Free Shipping
Magnetic Gym Storage Bag Tactical Nylon Water Cup Holder With Magnetic Backing For Phone Keys Fitness Outdoor Sports Bag
Magnetic Gym Storage Bag Tactical Nylon Water Cup Holder With Magnetic Backing For Phone Keys Fitness Outdoor Sports Bag
like
Find Similar
1 option
Magnetic Gym Storage Bag Tactical Nylon Water Cup Holder With Magnetic Backing For Phone Keys Fitness Outdoor Sports Bag
-40%
$4.58
No MOQ
Red New Year Creative Stickers For Scrapbook Water Cup Phone Case Waterproof PVC DIY Decorative Festive Stickers
Red New Year Creative Stickers For Scrapbook Water Cup Phone Case Waterproof PVC DIY Decorative Festive Stickers
like
Find Similar
Set of 50 festive red Lunar New Year stickers for scrapbooking and phone cases - Red New Year Theme
Red New Year Creative Stickers For Scrapbook Water Cup Phone Case Waterproof PVC DIY Decorative Festive Stickers
$0.96
No MOQ
Floral Tea Cup Butterfly Toilet Sticker Waterproof PVC Wall Decal For Bathroom Home Decor Removable Self Adhesive Sticker
Floral Tea Cup Butterfly Toilet Sticker Waterproof PVC Wall Decal For Bathroom Home Decor Removable Self Adhesive Sticker
like
Find Similar
Floral teacup wall sticker detail showing layout dimensions and watercolor butterfly design - Watercolor Floral Tea Cup Style (HY-M258)
Floral Tea Cup Butterfly Toilet Sticker Waterproof PVC Wall Decal For Bathroom Home Decor Removable Self Adhesive Sticker
$0.86
No MOQ
Tarot Card Three Of Cups Enamel Pin Cartoon Drinks Coffee Soda Zinc Alloy Brooch Badge For Clothing Bags Unisex Jewelry
Tarot Card Three Of Cups Enamel Pin Cartoon Drinks Coffee Soda Zinc Alloy Brooch Badge For Clothing Bags Unisex Jewelry
like
Find Similar
Three of Cups tarot brooch featuring modern drinks and straw on a minimalist metal pin - Three of Cups Tarot Card Style (QHXZ4562)
Tarot Card Three Of Cups Enamel Pin Cartoon Drinks Coffee Soda Zinc Alloy Brooch Badge For Clothing Bags Unisex Jewelry
-8%
$0.42
No MOQ
French Creative Sweet Instant Ramen Cup Shape Acetate Hair Claw Clip Cute Shark Hairclip Printed Hair Accessories For Women
French Creative Sweet Instant Ramen Cup Shape Acetate Hair Claw Clip Cute Shark Hairclip Printed Hair Accessories For Women
like
Find Similar
French style acetate instant ramen hair claw clip for women sweet elegant shark hair clip - White
French Creative Sweet Instant Ramen Cup Shape Acetate Hair Claw Clip Cute Shark Hairclip Printed Hair Accessories For Women
$2.56
Mix MOQ : 3
Montessori Wooden Color Sorting Toy Set Educational Rainbow Balls and Cups For Toddlers Fine Motor Skills Training Early Learning Toy
Montessori Wooden Color Sorting Toy Set Educational Rainbow Balls and Cups For Toddlers Fine Motor Skills Training Early Learning Toy
like
Find Similar
Eco-friendly packaging for Montessori balls and cups sorting toy set, 26x22.3x7cm - 12 Colors Balls and Cups
Montessori Wooden Color Sorting Toy Set Educational Rainbow Balls and Cups For Toddlers Fine Motor Skills Training Early Learning Toy
-5%
$14.24
No MOQ
Switzerland National Flag Polyester Pongee Swiss Red White Cross Banner For World Cup Festival Outdoor Indoor Decoration
Switzerland National Flag Polyester Pongee Swiss Red White Cross Banner For World Cup Festival Outdoor Indoor Decoration
like
Find Similar
National Swiss flag made of durable polyester featuring red background and white cross - Switzerland Flag / 90*145cm
Switzerland National Flag Polyester Pongee Swiss Red White Cross Banner For World Cup Festival Outdoor Indoor Decoration
-4%
$1.34
Mix MOQ : 2
Stainless Steel Grandpa Fix It Bottle Opener Keychain Funny Father's Day Gift With Beer Bottle Cup Enamel Charms Keyring
Stainless Steel Grandpa Fix It Bottle Opener Keychain Funny Father's Day Gift With Beer Bottle Cup Enamel Charms Keyring
like
Find Similar
Creative metal beer opener keychain with funny grandpa quote and colorful enamel charms - Beer Bottle Opening
NewStainless Steel Grandpa Fix It Bottle Opener Keychain Funny Father's Day Gift With Beer Bottle Cup Enamel Charms Keyring
-8%
$0.79
Mix MOQ : 2
Creative Coffee Bean Heart Wall Sticker Hand Painted Coffee Cup Coffee Machine PVC Self Adhesive Decal For Kitchen Decor
Creative Coffee Bean Heart Wall Sticker Hand Painted Coffee Cup Coffee Machine PVC Self Adhesive Decal For Kitchen Decor
like
Find Similar
Detail showing Mediterranean window wall sticker dimensions and DIY floral layout - Coffee Heart Style (fun-b147)
Creative Coffee Bean Heart Wall Sticker Hand Painted Coffee Cup Coffee Machine PVC Self Adhesive Decal For Kitchen Decor
$1.21
No MOQ
Modern PVC Coffee Cup Wall Sticker With But First Coffee Quote Yellow Decorative Decal For Kitchen Cafe Shop Home Decor
Modern PVC Coffee Cup Wall Sticker With But First Coffee Quote Yellow Decorative Decal For Kitchen Cafe Shop Home Decor
like
Find Similar
Macro view of coffee cup wall sticker with splashing liquid and But first Coffee text - 29x29cm (fun-f152)
Modern PVC Coffee Cup Wall Sticker With But First Coffee Quote Yellow Decorative Decal For Kitchen Cafe Shop Home Decor
$0.72
No MOQ
Kitchen Wall Sticker Heart Home Quote Decal PVC Self Adhesive Coffee Cup Decoration For Dining Room Wall Art Mural Decor
Kitchen Wall Sticker Heart Home Quote Decal PVC Self Adhesive Coffee Cup Decoration For Dining Room Wall Art Mural Decor
like
Find Similar
Detailed size chart for Kitchen is Heart of Home wall sticker showing 60cm by 22cm scale - 22*60cm
Kitchen Wall Sticker Heart Home Quote Decal PVC Self Adhesive Coffee Cup Decoration For Dining Room Wall Art Mural Decor
$1.01
No MOQ
Coffee Cup Wall Sticker With Spanish Quote Un Cafe Es Siempre Una Buena Idea PVC DIY Removable Decal For Kitchen Cafe
Coffee Cup Wall Sticker With Spanish Quote Un Cafe Es Siempre Una Buena Idea PVC DIY Removable Decal For Kitchen Cafe
like
Find Similar
Detail of minimalist coffee cup wall sticker with Spanish quote Un café es siempre una buena idea - 30*31cm Layout
Coffee Cup Wall Sticker With Spanish Quote Un Cafe Es Siempre Una Buena Idea PVC DIY Removable Decal For Kitchen Cafe
-4%
$1.15
No MOQ
Wake Up To A Good Cup Of Coffee Quote Wall Sticker PVC Removable Waterproof DIY Coffee Cup Decal For Kitchen Cafe
Wake Up To A Good Cup Of Coffee Quote Wall Sticker PVC Removable Waterproof DIY Coffee Cup Decal For Kitchen Cafe
like
Find Similar
1 option
NewWake Up To A Good Cup Of Coffee Quote Wall Sticker PVC Removable Waterproof DIY Coffee Cup Decal For Kitchen Cafe
-4%
$1.10
No MOQ
Coffee Lovers Wall Decal Black PVC Removable Waterproof Wall Sticker With Coffee Cup Heart Bird Pattern For Kitchen Cafe Home Decor
Coffee Lovers Wall Decal Black PVC Removable Waterproof Wall Sticker With Coffee Cup Heart Bird Pattern For Kitchen Cafe Home Decor
like
Find Similar
1 option
Coffee Lovers Wall Decal Black PVC Removable Waterproof Wall Sticker With Coffee Cup Heart Bird Pattern For Kitchen Cafe Home Decor
$1.44
No MOQ
Coffee And Jesus Quote Removable Vinyl Wall Sticker For Kitchen Dining Room Decor Minimalist Coffee Cup Silhouette Decal
Coffee And Jesus Quote Removable Vinyl Wall Sticker For Kitchen Dining Room Decor Minimalist Coffee Cup Silhouette Decal
like
Find Similar
Kitchen wall decal featuring Jesus and coffee text quote with 56cm x 32cm dimensions - 56x32cm / Black
Coffee And Jesus Quote Removable Vinyl Wall Sticker For Kitchen Dining Room Decor Minimalist Coffee Cup Silhouette Decal
$1.30
No MOQ
Vintage Alloy Coffee Theme Enamel Brooch Pin Set Creative Moka Pot Coffee Cup Badge Jewelry Gift For Clothes Backpack
Vintage Alloy Coffee Theme Enamel Brooch Pin Set Creative Moka Pot Coffee Cup Badge Jewelry Gift For Clothes Backpack
like
Find Similar
Colorful moka pot enamel pin with geometric patterns and golden metal outlines - Colorful Geometric Moka Pot (XZ7897)
Vintage Alloy Coffee Theme Enamel Brooch Pin Set Creative Moka Pot Coffee Cup Badge Jewelry Gift For Clothes Backpack
-9%
$0.50
No MOQ
Free Shipping
Coffee Tea Enamel Pin Badge Brooch Alloy Drip Oil Moka Pot Cup Accessories For Bag Clothes Backpack Decor Gift Unisex
Coffee Tea Enamel Pin Badge Brooch Alloy Drip Oil Moka Pot Cup Accessories For Bag Clothes Backpack Decor Gift Unisex
like
Find Similar
Detailed espresso portafilter enamel pin with coffee beans on white background - Coffee Portafilter Style (XZ7906)
Coffee Tea Enamel Pin Badge Brooch Alloy Drip Oil Moka Pot Cup Accessories For Bag Clothes Backpack Decor Gift Unisex
-8%
$0.45
No MOQ
Free Shipping
Soccer Theme PET Rain Curtain Backdrop For World Cup Football Party Decorations Sport Event Decor Black White Streamer
Soccer Theme PET Rain Curtain Backdrop For World Cup Football Party Decorations Sport Event Decor Black White Streamer
like
Find Similar
Fringe curtain with football pattern, 100x200cm size specifications for party decor - 1*2m Soccer Fringe Curtain
Soccer Theme PET Rain Curtain Backdrop For World Cup Football Party Decorations Sport Event Decor Black White Streamer
-4%
$2.00
No MOQ
Wooden Montessori Magnetic Shape and Color Sorting Cup Fishing Game Toy For Kids Early Learning Geometric Cognition Puzzle Set
Wooden Montessori Magnetic Shape and Color Sorting Cup Fishing Game Toy For Kids Early Learning Geometric Cognition Puzzle Set
like
Find Similar
Magnetic wooden shape sorting toy with colorful blocks and fishing rod for kids - Shape Color Sorting Fishing Game (WD)
Wooden Montessori Magnetic Shape and Color Sorting Cup Fishing Game Toy For Kids Early Learning Geometric Cognition Puzzle Set
-5%
$6.02
No MOQ
Natural Wooden Egg Cup Holder For Kids Pretend Play Kitchen Simulation Toy Educational Wood Egg Tray Easter DIY Crafts Decor
Natural Wooden Egg Cup Holder For Kids Pretend Play Kitchen Simulation Toy Educational Wood Egg Tray Easter DIY Crafts Decor
like
Find Similar
Set of two realistic wooden egg cups with natural grain for kitchen play and DIY painting - Wooden Egg Tray
Natural Wooden Egg Cup Holder For Kids Pretend Play Kitchen Simulation Toy Educational Wood Egg Tray Easter DIY Crafts Decor
-4%
$0.22
No MOQ
3 Sheets Football World Cup Window Stickers PVC Soccer Theme Champagne Goal Floral Wall Decals For Home Party Celebration
3 Sheets Football World Cup Window Stickers PVC Soccer Theme Champagne Goal Floral Wall Decals For Home Party Celebration
like
Find Similar
Detail view of soccer stickers set with layout size 56x59cm for party glass decoration - World Cup Football Stickers (ZQ2610ABC)
3 Sheets Football World Cup Window Stickers PVC Soccer Theme Champagne Goal Floral Wall Decals For Home Party Celebration
-5%
$1.86
No MOQ
Cartoon Bubble Tea Cup Enamel Pin Alloy Artificial Pearl Brooch Cute Personalized Badge For Bag Clothing Decoration Unisex Accessories
Cartoon Bubble Tea Cup Enamel Pin Alloy Artificial Pearl Brooch Cute Personalized Badge For Bag Clothing Decoration Unisex Accessories
like
Find Similar
Cute mint green bubble tea enamel pin featuring a cartoon game controller design - Mint Game Console Cup (QHXZ2177)
Cartoon Bubble Tea Cup Enamel Pin Alloy Artificial Pearl Brooch Cute Personalized Badge For Bag Clothing Decoration Unisex Accessories
-9%
$0.50
No MOQ
Creative Alloy Enamel Brooch Pin Plant In Cup Flower Badge Jewelry For Denim Jacket Backpack Accessory Unisex Fashion Gift
Creative Alloy Enamel Brooch Pin Plant In Cup Flower Badge Jewelry For Denim Jacket Backpack Accessory Unisex Fashion Gift
like
Find Similar
Enamel pin featuring a white tea cup with green leaves, yellow flower and tea tag - White Tea Cup Style (xz2449)
Creative Alloy Enamel Brooch Pin Plant In Cup Flower Badge Jewelry For Denim Jacket Backpack Accessory Unisex Fashion Gift
-9%
$0.65
No MOQ
Free Shipping
Creative Cartoon Coffee Cup Enamel Pin Badge Alloy Baking Paint Brooch Accessory For Clothes Bags Jewelry Gift Unisex
Creative Cartoon Coffee Cup Enamel Pin Badge Alloy Baking Paint Brooch Accessory For Clothes Bags Jewelry Gift Unisex
like
Find Similar
Creative coffee cup enamel brooch with white and brown colors for clothing accessories - Coffee Cup Style (XZ1595)
Creative Cartoon Coffee Cup Enamel Pin Badge Alloy Baking Paint Brooch Accessory For Clothes Bags Jewelry Gift Unisex
-9%
$0.50
No MOQ
Football Soccer Party Glasses Paper Sports Theme Decorative Eyewear For World Cup Birthday Celebration Photo Props Fans
Football Soccer Party Glasses Paper Sports Theme Decorative Eyewear For World Cup Birthday Celebration Photo Props Fans
like
Find Similar
Set of 8 football themed paper party glasses with soccer trophy and goal designs - Soccer Theme Party Eyewear (YJ-009)
Football Soccer Party Glasses Paper Sports Theme Decorative Eyewear For World Cup Birthday Celebration Photo Props Fans
$1.99
No MOQ
Christmas Ceramic Mug Cartoon Bear Print Holiday Coffee Cup With Gift Box For Seasonal Celebration
Christmas Ceramic Mug Cartoon Bear Print Holiday Coffee Cup With Gift Box For Seasonal Celebration
like
Find Similar
Close-up of red Christmas ceramic mug with Merry Christmas print and matching gift box - 350ml / Red Without Spoon
Christmas Ceramic Mug Cartoon Bear Print Holiday Coffee Cup With Gift Box For Seasonal Celebration
$2.45
No MOQ
Welcome To Our Kitchen PVC Wall Stickers Watercolor Teapot Butterfly Coffee Cup Decals DIY Removable Dining Room Home Decor
Welcome To Our Kitchen PVC Wall Stickers Watercolor Teapot Butterfly Coffee Cup Decals DIY Removable Dining Room Home Decor
like
Find Similar
Detail view of coffee and dessert wall stickers with Welcome to our kitchen text - 40*60cm
Welcome To Our Kitchen PVC Wall Stickers Watercolor Teapot Butterfly Coffee Cup Decals DIY Removable Dining Room Home Decor
$1.44
No MOQ
Waterproof Kitchen Wall Stickers Personalized Bread Coffee Cup Food Hand-drawn DIY PVC Self-Adhesive Wall Decals Home Decor
Waterproof Kitchen Wall Stickers Personalized Bread Coffee Cup Food Hand-drawn DIY PVC Self-Adhesive Wall Decals Home Decor
like
Find Similar
Detail showing 90x30cm kitchen wall decals with hand-drawn food and utensil illustrations - 30x90cm Layout (LD93095)
Waterproof Kitchen Wall Stickers Personalized Bread Coffee Cup Food Hand-drawn DIY PVC Self-Adhesive Wall Decals Home Decor
$1.30
No MOQ
3D Acrylic Mirror Wall Stickers Cutlery Coffee Cup Wine Bottle Design DIY Wall Decals For Kitchen Dining Room Home Decor
3D Acrylic Mirror Wall Stickers Cutlery Coffee Cup Wine Bottle Design DIY Wall Decals For Kitchen Dining Room Home Decor
like
Find Similar
1 option
3D Acrylic Mirror Wall Stickers Cutlery Coffee Cup Wine Bottle Design DIY Wall Decals For Kitchen Dining Room Home Decor
-12%
$3.80
No MOQ
Handmade Coffee Gnome Plush Christmas Faceless Doll Knitted Striped Hat Ornament With Mini Coffee Cup For Home Desktop Decoration
Handmade Coffee Gnome Plush Christmas Faceless Doll Knitted Striped Hat Ornament With Mini Coffee Cup For Home Desktop Decoration
like
Find Similar
1 option
Handmade Coffee Gnome Plush Christmas Faceless Doll Knitted Striped Hat Ornament With Mini Coffee Cup For Home Desktop Decoration
$3.46
Mix MOQ : 2
Floral Cup Butterfly Toilet Lid Decal Watercolor Flower Bathroom Wall Sticker Waterproof Self-Adhesive PVC Home Art Mural Decoration
Floral Cup Butterfly Toilet Lid Decal Watercolor Flower Bathroom Wall Sticker Waterproof Self-Adhesive PVC Home Art Mural Decoration
like
Find Similar
Detail of floral teacup and butterfly wall sticker layout and applied decorative effect - 29*29cm/HY-M287
Floral Cup Butterfly Toilet Lid Decal Watercolor Flower Bathroom Wall Sticker Waterproof Self-Adhesive PVC Home Art Mural Decoration
$0.86
No MOQ
Summer Watermelon Tiered Tray Decor Wood Cup Shaped Signs Hello Summer Life Is Sweet Farmhouse Kitchen Table Decorations
Summer Watermelon Tiered Tray Decor Wood Cup Shaped Signs Hello Summer Life Is Sweet Farmhouse Kitchen Table Decorations
like
Find Similar
Set of four wooden watermelon summer themed tray ornaments with Hello Summer text - Painted Watermelon Style
Summer Watermelon Tiered Tray Decor Wood Cup Shaped Signs Hello Summer Life Is Sweet Farmhouse Kitchen Table Decorations
-4%
$3.29
No MOQ
Inspirational Enamel Pin Set Cartoon Purple Alloy Brooch Star Moon Heart Crystal Ball Coffee Cup Aesthetic Denim Jacket Backpack Jewelry Accessory
Inspirational Enamel Pin Set Cartoon Purple Alloy Brooch Star Moon Heart Crystal Ball Coffee Cup Aesthetic Denim Jacket Backpack Jewelry Accessory
like
Find Similar
Vintage crystal ball enamel brooch with stars and 'you'll get through this' slogan - Dark Purple Crystal Ball Style (XZ4053)
Inspirational Enamel Pin Set Cartoon Purple Alloy Brooch Star Moon Heart Crystal Ball Coffee Cup Aesthetic Denim Jacket Backpack Jewelry Accessory
-9%
$0.47
No MOQ
Mother's Day Wine Glass Charms Flower Heart Pattern Paper Cup Identification Tags Party Table Decorations For Mom Women
Mother's Day Wine Glass Charms Flower Heart Pattern Paper Cup Identification Tags Party Table Decorations For Mom Women
like
Find Similar
Set of 4 Mother's Day wine glass paper markers with floral and heart patterns - Mother's Day Theme
Mother's Day Wine Glass Charms Flower Heart Pattern Paper Cup Identification Tags Party Table Decorations For Mom Women
$0.52
Mix MOQ : 2
Free Shipping
Modern PVC Wake Up And Smell The Coffee Quote Wall Sticker Artistic Coffee Cup Decal For Kitchen Cafe Restaurant Decor
Modern PVC Wake Up And Smell The Coffee Quote Wall Sticker Artistic Coffee Cup Decal For Kitchen Cafe Restaurant Decor
like
Find Similar
Detailed dimensions of the Coffee wall sticker showing both layout and final applied size - 35x60cm
Modern PVC Wake Up And Smell The Coffee Quote Wall Sticker Artistic Coffee Cup Decal For Kitchen Cafe Restaurant Decor
$1.21
No MOQ
Coffee Cup Wall Sticker Modern Minimalist Kitchen Decor Removable PVC Mural Art Self Adhesive Coffee Shop Living Room Bedroom Mural Decal
Coffee Cup Wall Sticker Modern Minimalist Kitchen Decor Removable PVC Mural Art Self Adhesive Coffee Shop Living Room Bedroom Mural Decal
like
Find Similar
Detailed size chart of minimalist coffee cup wall stickers showing 60x30cm dimensions - 30*60cm
Coffee Cup Wall Sticker Modern Minimalist Kitchen Decor Removable PVC Mural Art Self Adhesive Coffee Shop Living Room Bedroom Mural Decal
$1.12
Mix MOQ : 2
Funny Alloy Enamel Brooch Pin Set Creative Designer Milk Tea Cup Software Icons Quote Lapel Badge For Clothing Backpack
Funny Alloy Enamel Brooch Pin Set Creative Designer Milk Tea Cup Software Icons Quote Lapel Badge For Clothing Backpack
like
Find Similar
Black and orange enamel pin featuring Trust Me I am a UX UI Designer text motif - Designer Quote Style (QHXZ2352)
Funny Alloy Enamel Brooch Pin Set Creative Designer Milk Tea Cup Software Icons Quote Lapel Badge For Clothing Backpack
-9%
$0.50
Mix MOQ : 2
Montessori Wooden Color Sorting Toy For Toddlers Educational Rainbow Cups And Balls Set Hand-eye Coordination Training Game Wood Sorting Toys
Montessori Wooden Color Sorting Toy For Toddlers Educational Rainbow Cups And Balls Set Hand-eye Coordination Training Game Wood Sorting Toys
like
Find Similar
Montessori wooden color sorting set with 7 cups and balls for toddler learning - 7 Colors Balls and Cups Sorting
Montessori Wooden Color Sorting Toy For Toddlers Educational Rainbow Cups And Balls Set Hand-eye Coordination Training Game Wood Sorting Toys
-5%
$9.58
No MOQ
Creative Book Stack And Coffee Cup Enamel Pin Sorry I Am Booked Pun Metal Brooch For Book Lovers Students Lapel Badge
Creative Book Stack And Coffee Cup Enamel Pin Sorry I Am Booked Pun Metal Brooch For Book Lovers Students Lapel Badge
like
Find Similar
Artistic coffee and book stack enamel pin with Sorry I'm Booked gold plating - Colorful Books and Coffee Cup Style (XZ9543)
Creative Book Stack And Coffee Cup Enamel Pin Sorry I Am Booked Pun Metal Brooch For Book Lovers Students Lapel Badge
-9%
$0.65
No MOQ
Acetate Coffee Cup Shaped Hair Claw Clip Creative Sky Blue Floral Shark Clip Cute Handmade Large Hair Catch Hair Clip For Women
Acetate Coffee Cup Shaped Hair Claw Clip Creative Sky Blue Floral Shark Clip Cute Handmade Large Hair Catch Hair Clip For Women
like
Find Similar
Close-up of cute light blue silicone earphone case with coffee cup design and pink flowers - Flower Coffee Cup Style / 9.5cm*5.5cm
Acetate Coffee Cup Shaped Hair Claw Clip Creative Sky Blue Floral Shark Clip Cute Handmade Large Hair Catch Hair Clip For Women
$3.75
No MOQ
Free Shipping
Creative Coffee Cup Enamel Brooch Coffee For Life Fueled By Coffee Letter Pin Badge Cartoon Alloy Jewelry For Backpack Decor
Creative Coffee Cup Enamel Brooch Coffee For Life Fueled By Coffee Letter Pin Badge Cartoon Alloy Jewelry For Backpack Decor
like
Find Similar
Cartoon coffee cup enamel pin in black and gold with 'COFFEE FOR LIFE' lettering - Coffee For Life Cup (XZ3711)
Creative Coffee Cup Enamel Brooch Coffee For Life Fueled By Coffee Letter Pin Badge Cartoon Alloy Jewelry For Backpack Decor
-9%
$0.50
No MOQ
Free Shipping
S925 Sterling Silver Creative Miniature Coffee Cup Open Ring Retro Adjustable Finger Jewelry For Women Individual Niche Design Gift
S925 Sterling Silver Creative Miniature Coffee Cup Open Ring Retro Adjustable Finger Jewelry For Women Individual Niche Design Gift
like
Find Similar
S925 sterling silver open ring with unique abstract spiral design and matte finish - Coffee Cup Style (JZF096)
NewS925 Sterling Silver Creative Miniature Coffee Cup Open Ring Retro Adjustable Finger Jewelry For Women Individual Niche Design Gift
-13%
$37.83
No MOQ
Free Shipping
Retro Coffee Series Enamel Brooch Coffee Cup Pot Portafilter Machine Handle Fun Metal Pin For Daily Accessories Jewelry
Retro Coffee Series Enamel Brooch Coffee Cup Pot Portafilter Machine Handle Fun Metal Pin For Daily Accessories Jewelry
like
Find Similar
Retro coffee latte art enamel pin with a black and gold finish and heart design - Coffee Latte Art Pattern (C1491-1)
Retro Coffee Series Enamel Brooch Coffee Cup Pot Portafilter Machine Handle Fun Metal Pin For Daily Accessories Jewelry
-9%
$0.50
No MOQ
Free Shipping
Christmas Refrigerator Sticker PVC Self Adhesive Gingerbread Man Cup Wall Decal For Refrigerator Glass Window Holiday Home Decor
Christmas Refrigerator Sticker PVC Self Adhesive Gingerbread Man Cup Wall Decal For Refrigerator Glass Window Holiday Home Decor
like
Find Similar
Detailed view of Christmas gingerbread man wall sticker with Merry Christmas red cup and sizes - 32*30cm / UV24Y12770S_T
NewChristmas Refrigerator Sticker PVC Self Adhesive Gingerbread Man Cup Wall Decal For Refrigerator Glass Window Holiday Home Decor
$1.30
Mix MOQ : 2
8 Sheets Christmas Snowman Expression Face DIY Wall Stickers PVC Waterproof Holiday Decoration For Cup Gift Box
8 Sheets Christmas Snowman Expression Face DIY Wall Stickers PVC Waterproof Holiday Decoration For Cup Gift Box
like
Find Similar
Set of 8 DIY Christmas snowman expression stickers with 71 PVC decorative decals - Snowman Expression (UV24Y12697T_T) / 30x20cm
8 Sheets Christmas Snowman Expression Face DIY Wall Stickers PVC Waterproof Holiday Decoration For Cup Gift Box
$2.97
Mix MOQ : 2
Cartoon Beverage Cup Enamel Brooch Serotonin Booster Smiley Face Alloy Lapel Pin For Clothes Bag Decor Unisex Accessories
Cartoon Beverage Cup Enamel Brooch Serotonin Booster Smiley Face Alloy Lapel Pin For Clothes Bag Decor Unisex Accessories
like
Find Similar
Cute serotonin booster enamel pin featuring a yellow cartoon cup and pink lid design - Yellow Beverage Cup(QHXZ5614)
Cartoon Beverage Cup Enamel Brooch Serotonin Booster Smiley Face Alloy Lapel Pin For Clothes Bag Decor Unisex Accessories
-9%
$0.39
No MOQ
Coffee Cup Wall Sticker But First Coffee Quote Decal Minimalist PVC Vinyl DIY Art Mural For Kitchen Cafe Office Decor
Coffee Cup Wall Sticker But First Coffee Quote Decal Minimalist PVC Vinyl DIY Art Mural For Kitchen Cafe Office Decor
like
Find Similar
Self-adhesive coffee cup wall sticker with heart smoke design and coffee beans motif - 30*20cm
Coffee Cup Wall Sticker But First Coffee Quote Decal Minimalist PVC Vinyl DIY Art Mural For Kitchen Cafe Office Decor
$0.66
Mix MOQ : 2
Coffee Time Slogan Wall Sticker PVC DIY Black Coffee Cup Decal For Living Room Kitchen Cafe Wall Decor Modern Minimalist
Coffee Time Slogan Wall Sticker PVC DIY Black Coffee Cup Decal For Living Room Kitchen Cafe Wall Decor Modern Minimalist
like
Find Similar
Detail showing coffee cup wall sticker layout and dimensions in inches and centimeters - 25*29cm
Coffee Time Slogan Wall Sticker PVC DIY Black Coffee Cup Decal For Living Room Kitchen Cafe Wall Decor Modern Minimalist
$0.86
No MOQ
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access