Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Creative Tarot Three Of Cups Enamel Pin Modern Drink Bottle Zinc Alloy Brooch Cartoon Iced Coffee Soda Badge For Clothing
Creative Tarot Three Of Cups Enamel Pin Modern Drink Bottle Zinc Alloy Brooch Cartoon Iced Coffee Soda Badge For Clothing
like
Find Similar
Three of Cups tarot brooch featuring modern drinks and straw on a minimalist metal pin - Three of Cups Tarot Style (QHXZ4562)
Creative Tarot Three Of Cups Enamel Pin Modern Drink Bottle Zinc Alloy Brooch Cartoon Iced Coffee Soda Badge For Clothing
-8%
$0.42
No MOQ
Glitter Paper Heart Wine Glass Cup Cards Decoration Hollow Out Love Design For Valentine's Day Wedding Party Pink Red
Glitter Paper Heart Wine Glass Cup Cards Decoration Hollow Out Love Design For Valentine's Day Wedding Party Pink Red
like
Find Similar
Glittering heart wine glass cards with Love cutout for Valentine's party decoration - Red And Pink Mixed Style (L-00242)
Glitter Paper Heart Wine Glass Cup Cards Decoration Hollow Out Love Design For Valentine's Day Wedding Party Pink Red
$1.10
Mix MOQ : 5
Free Shipping
Scalloped Edge Round Tray Silicone Mold DIY Resin Casting Gypsum Candle Cup Storage Plate Decorative Handcrafted
Scalloped Edge Round Tray Silicone Mold DIY Resin Casting Gypsum Candle Cup Storage Plate Decorative Handcrafted
like
Find Similar
Silicone mold for 17cm round lace bead tray used for DIY gypsum and candle storage - Round Scalloped Bead Tray / White
NewScalloped Edge Round Tray Silicone Mold DIY Resin Casting Gypsum Candle Cup Storage Plate Decorative Handcrafted
-4%
$3.43
No MOQ
French Style Sexy Lace Lingerie Set Thin Mesh Non-Wired Triangle Cup Bralette And Panty Set Breathable Intimates For Women
French Style Sexy Lace Lingerie Set Thin Mesh Non-Wired Triangle Cup Bralette And Panty Set Breathable Intimates For Women
like
Find Similar
Elegant black French lace lingerie set with wireless triangle cup bra and matching briefs - XL / Black
French Style Sexy Lace Lingerie Set Thin Mesh Non-Wired Triangle Cup Bralette And Panty Set Breathable Intimates For Women
$12.14
No MOQ
Free Shipping
But First Coffee Wall Stickers PVC Coffee Cup Heart Beans Decal For Kitchen Cafe Restaurant Modern Art Decor
But First Coffee Wall Stickers PVC Coffee Cup Heart Beans Decal For Kitchen Cafe Restaurant Modern Art Decor
like
Find Similar
Self-adhesive coffee cup wall sticker with heart smoke design and coffee beans motif - 20x30cm(MS4216-ZC)
But First Coffee Wall Stickers PVC Coffee Cup Heart Beans Decal For Kitchen Cafe Restaurant Modern Art Decor
$0.66
Mix MOQ : 2
Kids Crossbody Bag Handmade Crochet Woolen Knit Artificial Pearl Milk Tea Cup Bear Shape Cute Cartoon Accessory
Kids Crossbody Bag Handmade Crochet Woolen Knit Artificial Pearl Milk Tea Cup Bear Shape Cute Cartoon Accessory
like
Find Similar
Handmade brown knit bubble tea bear crossbody bag with a crochet shoulder strap - Khaki
Kids Crossbody Bag Handmade Crochet Woolen Knit Artificial Pearl Milk Tea Cup Bear Shape Cute Cartoon Accessory
$7.49
No MOQ
Round Alloy Enamel Brooch Coffee Cup Star Pattern Green Gold Decorative Pin For Clothing Bag Backpack Unisex Fan Gift Accessories
Round Alloy Enamel Brooch Coffee Cup Star Pattern Green Gold Decorative Pin For Clothing Bag Backpack Unisex Fan Gift Accessories
like
Find Similar
Round mint green Gilmore Girl enamel badge with gold metallic edges and star details - Qhxz123
Round Alloy Enamel Brooch Coffee Cup Star Pattern Green Gold Decorative Pin For Clothing Bag Backpack Unisex Fan Gift Accessories
-10%
$0.52
No MOQ
Free Shipping
Elegant Hollowed-out Butterfly Place Cards Pearlescent Paper Cup Decoration For Wedding Party Banquet Event Table Settings Decor
Elegant Hollowed-out Butterfly Place Cards Pearlescent Paper Cup Decoration For Wedding Party Banquet Event Table Settings Decor
like
Find Similar
Elegant white 3D butterfly wall sticker with intricate laser-cut floral hollow patterns - White
Pink 3D butterfly wall sticker with laser-cut hollow floral pattern on white background - Pink
3D hollow gold butterfly glass card with elegant floral lace pattern for wedding decor - Gold
Elegant Hollowed-out Butterfly Place Cards Pearlescent Paper Cup Decoration For Wedding Party Banquet Event Table Settings Decor
$0.07
Mix MOQ : 50
Cartoon Panda Tea Cup Flower Luminous Wall Sticker Glow In The Dark PVC Switch Decorative Decal For Home Living Room Bedroom
Cartoon Panda Tea Cup Flower Luminous Wall Sticker Glow In The Dark PVC Switch Decorative Decal For Home Living Room Bedroom
like
Find Similar
1 option
Cartoon Panda Tea Cup Flower Luminous Wall Sticker Glow In The Dark PVC Switch Decorative Decal For Home Living Room Bedroom
$0.92
No MOQ
Creative Cartoon Cat Coffee Cup Enamel Brooch Pin Cute Animal Catpuccino Alloy Badge For Clothes Backpack Accessories Gift
Creative Cartoon Cat Coffee Cup Enamel Brooch Pin Cute Animal Catpuccino Alloy Badge For Clothes Backpack Accessories Gift
like
Find Similar
Macro detail of enamel pin showing a white cat in a blue Catpuccino coffee cup - Cat Coffee Cup Style (XZ1437)
Creative Cartoon Cat Coffee Cup Enamel Brooch Pin Cute Animal Catpuccino Alloy Badge For Clothes Backpack Accessories Gift
-10%
$0.52
No MOQ
Free Shipping
Funny Coffee Cup Enamel Pin Creative Water Espresso Badge Alloy Brooch For Clothes Backpack Accessories Gift For Coffee Lover
Funny Coffee Cup Enamel Pin Creative Water Espresso Badge Alloy Brooch For Clothes Backpack Accessories Gift For Coffee Lover
like
Find Similar
Creative coffee cup enamel pin with This Is Coffee text on a white background - Coffee Cup Style (QHXZ2390) / Black and White
Funny Coffee Cup Enamel Pin Creative Water Espresso Badge Alloy Brooch For Clothes Backpack Accessories Gift For Coffee Lover
-8%
$0.45
No MOQ
Christmas Ugly Sweater Pattern Disposable Tableware Plates Cups Napkins Cutlery Tablecloth For Holiday Party Decoration
Christmas Ugly Sweater Pattern Disposable Tableware Plates Cups Napkins Cutlery Tablecloth For Holiday Party Decoration
like
Find Similar
Ugly sweater themed Christmas party tableware set with red and green festive patterns - Christmas Ugly Sweater Style
NewChristmas Ugly Sweater Pattern Disposable Tableware Plates Cups Napkins Cutlery Tablecloth For Holiday Party Decoration
$6.05
Mix MOQ : 50
Elegant 3D Laser Cut Butterfly Cup Cards Pearlescent Paper Hollow Place Cards For Wedding Party Decoration Wine Glass Decor
Elegant 3D Laser Cut Butterfly Cup Cards Pearlescent Paper Hollow Place Cards For Wedding Party Decoration Wine Glass Decor
like
Find Similar
Elegant 3D hollow butterfly paper card for wine glass wedding and party decoration - White
Elegant 3D Laser Cut Butterfly Cup Cards Pearlescent Paper Hollow Place Cards For Wedding Party Decoration Wine Glass Decor
$0.07
No MOQ
Gothic Skull Enamel Pin Alloy Brooch Dark Punk Metal Badge Potion Bottle Coffee Cup For Backpack Clothes Jacket Hat Unisex Jewelry
Gothic Skull Enamel Pin Alloy Brooch Dark Punk Metal Badge Potion Bottle Coffee Cup For Backpack Clothes Jacket Hat Unisex Jewelry
like
Find Similar
Gothic skull potion bottle enamel pin with LOVE text in black and white finish - LOVE Heart Potion Bottle Style (XZ5965)
Gothic Skull Enamel Pin Alloy Brooch Dark Punk Metal Badge Potion Bottle Coffee Cup For Backpack Clothes Jacket Hat Unisex Jewelry
-9%
$0.68
No MOQ
Free Shipping
Kitchen Rules Wall Decals PVC Vinyl Removable Stickers Coffee Cup Butterfly Quote Wall Art Decor For Home Dining Room Cafe
Kitchen Rules Wall Decals PVC Vinyl Removable Stickers Coffee Cup Butterfly Quote Wall Art Decor For Home Dining Room Cafe
like
Find Similar
Creative Kitchen Rules wall sticker with coffee cup and flower motifs 45x55cm - 25*70cm
Kitchen Rules Wall Decals PVC Vinyl Removable Stickers Coffee Cup Butterfly Quote Wall Art Decor For Home Dining Room Cafe
$1.24
Mix MOQ : 2
Santa Claus Silicone Mold For DIY Handmade Flower Pot Candle Cup Plaster Resin Craft Christmas Decoration
Santa Claus Silicone Mold For DIY Handmade Flower Pot Candle Cup Plaster Resin Craft Christmas Decoration
like
Find Similar
Santa Claus silicone mold for DIY flower pots and candle cups with 8.9cm height dimensions - Santa Claus Flower Pot
Santa Claus Silicone Mold For DIY Handmade Flower Pot Candle Cup Plaster Resin Craft Christmas Decoration
-4%
$4.33
Mix MOQ : 5
Coffee Time Slogan Wall Sticker Cartoon Smile Coffee Cup Bean PVC Decorative Wall Decal For Cafe Kitchen Dining Room Decor
Coffee Time Slogan Wall Sticker Cartoon Smile Coffee Cup Bean PVC Decorative Wall Decal For Cafe Kitchen Dining Room Decor
like
Find Similar
Detail view of coffee cup wall stickers showing sheet size and finish size dimensions - 20x30cm
Coffee Time Slogan Wall Sticker Cartoon Smile Coffee Cup Bean PVC Decorative Wall Decal For Cafe Kitchen Dining Room Decor
$0.72
No MOQ
Watercolor Flower Tea Cup Wall Sticker Happy Day PVC Art Decal For Living Room Bedroom Home Decoration Mural
Watercolor Flower Tea Cup Wall Sticker Happy Day PVC Art Decal For Living Room Bedroom Home Decoration Mural
like
Find Similar
Floral teacup wall sticker with Happy Day text in pink and orange watercolor style - Watercolor Flower Teacup Style (PH_QTA13)
Watercolor Flower Tea Cup Wall Sticker Happy Day PVC Art Decal For Living Room Bedroom Home Decoration Mural
-4%
$0.69
No MOQ
Baby Feeding Squeeze Spoon Bottle Silicone Soft Rice Cereal Paste Feeder With Suction Base For Infant Toddler Training
Baby Feeding Squeeze Spoon Bottle Silicone Soft Rice Cereal Paste Feeder With Suction Base For Infant Toddler Training
like
Find Similar
Yellow silicone baby food squeezing bottle with feeding spoon and scale markings - Yellow
Baby Feeding Squeeze Spoon Bottle Silicone Soft Rice Cereal Paste Feeder With Suction Base For Infant Toddler Training
$2.56
No MOQ
 · 
49 views
Tarot Three Of Cups Enamel Brooch Pin Creative Cartoon Drinks Zinc Alloy Badge Jewelry Accessory For Clothes Bag Decoration
Tarot Three Of Cups Enamel Brooch Pin Creative Cartoon Drinks Zinc Alloy Badge Jewelry Accessory For Clothes Bag Decoration
like
Find Similar
Three of Cups tarot brooch featuring modern drinks and straw on a minimalist metal pin - Three of Cups Style(QHXZ4562)
Tarot Three Of Cups Enamel Brooch Pin Creative Cartoon Drinks Zinc Alloy Badge Jewelry Accessory For Clothes Bag Decoration
-8%
$0.42
No MOQ
Easter Flower Cup Rabbit Wall Sticker PVC Self Adhesive Cartoon Bunny Floral Decal For Kids Room Living Room Bedroom Home Decor
Easter Flower Cup Rabbit Wall Sticker PVC Self Adhesive Cartoon Bunny Floral Decal For Kids Room Living Room Bedroom Home Decor
like
Find Similar
Detail of bunny wall sticker showing self-adhesive thickness and floral heart patterns - Rabbit in Cup (PH_QTB449)
Easter Flower Cup Rabbit Wall Sticker PVC Self Adhesive Cartoon Bunny Floral Decal For Kids Room Living Room Bedroom Home Decor
$0.81
No MOQ
Removable PVC Coffee Time Wall Sticker Floral Butterfly Coffee Cup Decal For Kitchen Dining Room Home Cafe Decoration
Removable PVC Coffee Time Wall Sticker Floral Butterfly Coffee Cup Decal For Kitchen Dining Room Home Cafe Decoration
like
Find Similar
Detail showing the watercolor coffee cup wall sticker with dimensions 30x25cm - 29*29cm / Coffee Cup Floral Pattern (HY-F787)
Removable PVC Coffee Time Wall Sticker Floral Butterfly Coffee Cup Decal For Kitchen Dining Room Home Cafe Decoration
$0.86
No MOQ
Simulation Lemon Milk Tea Cup Alloy Enamel Charms For Jewelry Making DIY Bracelet Necklace Pendants Accessory Summer Drink Beverage Theme Charms
Simulation Lemon Milk Tea Cup Alloy Enamel Charms For Jewelry Making DIY Bracelet Necklace Pendants Accessory Summer Drink Beverage Theme Charms
like
Find Similar
Pack of 6 yellow enamel juice cup charms with lemon slice for DIY jewelry making - Lemon Milk Tea Cup
Simulation Lemon Milk Tea Cup Alloy Enamel Charms For Jewelry Making DIY Bracelet Necklace Pendants Accessory Summer Drink Beverage Theme Charms
$0.96
No MOQ
Free Shipping
Croatia National Flag Polyester Banner For World Cup Euro Sports Events Home Outdoor Decoration With Metal Grommets
Croatia National Flag Polyester Banner For World Cup Euro Sports Events Home Outdoor Decoration With Metal Grommets
like
Find Similar
1 option
Croatia National Flag Polyester Banner For World Cup Euro Sports Events Home Outdoor Decoration With Metal Grommets
$1.50
Mix MOQ : 10
Creative Cream Soda Ice Cream Cup Shape Hair Claw Blue Acetate Hair Clip For Women Cute Summer Drink Style Hair Accessories
Creative Cream Soda Ice Cream Cup Shape Hair Claw Blue Acetate Hair Clip For Women Cute Summer Drink Style Hair Accessories
like
Find Similar
Blue marble acetic acid hair claw clip in a unique cream soda and ice cream shape - Blue Hair Claw (9.5cm)
Creative Cream Soda Ice Cream Cup Shape Hair Claw Blue Acetate Hair Clip For Women Cute Summer Drink Style Hair Accessories
$3.82
No MOQ
Free Shipping
Cute Cartoon Round Sealing Stickers Adhesive Labels For Baking Packaging Takeout Dessert Cups Scrapbooking Aesthetic
Cute Cartoon Round Sealing Stickers Adhesive Labels For Baking Packaging Takeout Dessert Cups Scrapbooking Aesthetic
like
Find Similar
1 option
Cute Cartoon Round Sealing Stickers Adhesive Labels For Baking Packaging Takeout Dessert Cups Scrapbooking Aesthetic
$0.45
No MOQ
Halloween Party Wine Glass Paper Card Decorations Spider Pumpkin Bat Cup Rim Inserts Spooky Holiday Drink Accessories
Halloween Party Wine Glass Paper Card Decorations Spider Pumpkin Bat Cup Rim Inserts Spooky Holiday Drink Accessories
like
Find Similar
Set of 9 Halloween paper glass cards featuring pumpkin, skull, bat and spider designs - Halloween Theme Insert Card Set
Halloween Party Wine Glass Paper Card Decorations Spider Pumpkin Bat Cup Rim Inserts Spooky Holiday Drink Accessories
$0.36
Mix MOQ : 3
Bowknot Storage Box Silicone Mold DIY Resin Jewelry Case Candle Cup Making Tool Desktop Ornament
Bowknot Storage Box Silicone Mold DIY Resin Jewelry Case Candle Cup Making Tool Desktop Ornament
like
Find Similar
1 option
Bowknot Storage Box Silicone Mold DIY Resin Jewelry Case Candle Cup Making Tool Desktop Ornament
-4%
$6.30
Mix MOQ : 5
Silver Aluminum Foil Cupcake Liners Large Muffin Cups Double Sided Heat Resistant Oil Proof Baking Cups For Wedding Party Cake
Silver Aluminum Foil Cupcake Liners Large Muffin Cups Double Sided Heat Resistant Oil Proof Baking Cups For Wedding Party Cake
like
Find Similar
Silver foil cupcake liners with rolled edges for baking muffins, set of 50 pieces - Default
Silver Aluminum Foil Cupcake Liners Large Muffin Cups Double Sided Heat Resistant Oil Proof Baking Cups For Wedding Party Cake
$1.87
No MOQ
Stainless Steel Couple Keychain You Are The Best Part Of Every Day Heart Coffee Cup Pendant Key Ring Romantic Jewelry Gift
Stainless Steel Couple Keychain You Are The Best Part Of Every Day Heart Coffee Cup Pendant Key Ring Romantic Jewelry Gift
like
Find Similar
Polished steel keychain with coffee couple illustration and motivational quote engraved - Silver (Coffee Cup & Heart)
Stainless Steel Couple Keychain You Are The Best Part Of Every Day Heart Coffee Cup Pendant Key Ring Romantic Jewelry Gift
-9%
$0.47
No MOQ
Coffee Time Wall Stickers PVC Waterproof Decals Coffee Cup Butterfly Pattern For Cafe Kitchen Dining Room Decor
Coffee Time Wall Stickers PVC Waterproof Decals Coffee Cup Butterfly Pattern For Cafe Kitchen Dining Room Decor
like
Find Similar
Waterproof coffee theme wall decal with size guide and layout for lounge decor - 30*60cm / Brown
Coffee Time Wall Stickers PVC Waterproof Decals Coffee Cup Butterfly Pattern For Cafe Kitchen Dining Room Decor
$1.30
Mix MOQ : 2
Watermelon Summer Tiered Tray Decor Wooden Ornaments Cup Shaped Fruit Desktop Home Decor Signs
Watermelon Summer Tiered Tray Decor Wooden Ornaments Cup Shaped Fruit Desktop Home Decor Signs
like
Find Similar
4-piece wooden watermelon decor set for tiered trays featuring summer ice cream and cup designs - Four-Piece Set
Watermelon Summer Tiered Tray Decor Wooden Ornaments Cup Shaped Fruit Desktop Home Decor Signs
$3.46
Mix MOQ : 3
Christmas Coffee Cup Wall Sticker PVC Gingerbread House Tree Pattern Waterproof Decal For Kitchen Restaurant Cafe Home Decor
Christmas Coffee Cup Wall Sticker PVC Gingerbread House Tree Pattern Waterproof Decal For Kitchen Restaurant Cafe Home Decor
like
Find Similar
Detail view of Christmas coffee cup wall stickers showing sheet and finish dimensions - 24x24cm
NewChristmas Coffee Cup Wall Sticker PVC Gingerbread House Tree Pattern Waterproof Decal For Kitchen Restaurant Cafe Home Decor
$0.86
No MOQ
Halloween Wooden Pumpkin Coffee Cup Desktop Ornament Gothic Skeleton Hand Multi-Layer Laser Cut Wood Carving Party Decor
Halloween Wooden Pumpkin Coffee Cup Desktop Ornament Gothic Skeleton Hand Multi-Layer Laser Cut Wood Carving Party Decor
like
Find Similar
Halloween wooden pumpkin cup desk lamp with skeletal hand and glowing LED light - Halloween Pumpkin Cup Style
Halloween Wooden Pumpkin Coffee Cup Desktop Ornament Gothic Skeleton Hand Multi-Layer Laser Cut Wood Carving Party Decor
$3.89
No MOQ
World Cup Soccer Theme Garden Goose Costume Includes Bow Skirt And Whistle Funny Outdoor Lawn Statue Clothing For Home Patio Decoration
World Cup Soccer Theme Garden Goose Costume Includes Bow Skirt And Whistle Funny Outdoor Lawn Statue Clothing For Home Patio Decoration
like
Find Similar
Soccer baby themed porch goose outfit set with football pattern dress and whistle - Soccer Costume Includes Bow And Skirt And Whistle
World Cup Soccer Theme Garden Goose Costume Includes Bow Skirt And Whistle Funny Outdoor Lawn Statue Clothing For Home Patio Decoration
$8.07
No MOQ
Free Shipping
DIY Bowknot Shape 14k Gold Plated Copper Jewelry Connector Double Ended Artificial Pearl Cup Buckle For Necklace Bracelet Making DIY Findings
DIY Bowknot Shape 14k Gold Plated Copper Jewelry Connector Double Ended Artificial Pearl Cup Buckle For Necklace Bracelet Making DIY Findings
like
Find Similar
Detailed view of 14k gold plated bow clasp connector for DIY jewelry making - Bowknot Double Buckle (Approx 45*15mm) / 14K Gold
Close-up of silver bow jewelry clasp connector for DIY necklace and bracelet crafting - Bowknot Double Buckle (Approx 45*15mm) / White Gold
DIY Bowknot Shape 14k Gold Plated Copper Jewelry Connector Double Ended Artificial Pearl Cup Buckle For Necklace Bracelet Making DIY Findings
$1.10
No MOQ
Free Shipping
Heart Laser Cut Place Cards For Wedding Party Decoration Hollow Paper Cup Cards Valentine's Day Table Wine Glass Name Cards
Heart Laser Cut Place Cards For Wedding Party Decoration Hollow Paper Cup Cards Valentine's Day Table Wine Glass Name Cards
like
Find Similar
Elegant white laser-cut heart glass card with intricate floral lace pattern for weddings - White
Pink heart-shaped laser cut lace place card for wedding table and party decor - Pink
Heart Laser Cut Place Cards For Wedding Party Decoration Hollow Paper Cup Cards Valentine's Day Table Wine Glass Name Cards
$0.07
Mix MOQ : 50
Vintage Acetate Coffee Cup Hair Claw Clip For Women Teal Green Floral Decorative Clamp Novelty Flower Hair Accessories
Vintage Acetate Coffee Cup Hair Claw Clip For Women Teal Green Floral Decorative Clamp Novelty Flower Hair Accessories
like
Find Similar
Mint green coffee cup hair claw clip with pink flowers and a spoon accessory - 9.5cm x 5.5cm / Teal Green Coffee Cup Style
Vintage Acetate Coffee Cup Hair Claw Clip For Women Teal Green Floral Decorative Clamp Novelty Flower Hair Accessories
$3.46
No MOQ
Free Shipping
Fun Caffeine Fiend Coffee Cup Enamel Brooch Pin With Ghosts Pattern Alloy Badge Jewelry For Halloween Party Accessory
Fun Caffeine Fiend Coffee Cup Enamel Brooch Pin With Ghosts Pattern Alloy Badge Jewelry For Halloween Party Accessory
like
Find Similar
Creative orange caffeine fiend coffee cup enamel pin with three white ghosts - Orange Coffee Cup Ghost Style (CC1523)
Fun Caffeine Fiend Coffee Cup Enamel Brooch Pin With Ghosts Pattern Alloy Badge Jewelry For Halloween Party Accessory
-9%
$0.47
No MOQ
Free Shipping
Watercolor Floral Cup Care Instruction Cards Tumbler Care Guide Cards Hand Wash Only Label For Handmade Mug Small Business Packaging
Watercolor Floral Cup Care Instruction Cards Tumbler Care Guide Cards Hand Wash Only Label For Handmade Mug Small Business Packaging
like
Find Similar
Cup care instruction cards with watercolor floral designs on high-quality white paper - 50mm x 90mm / Colorful
Watercolor Floral Cup Care Instruction Cards Tumbler Care Guide Cards Hand Wash Only Label For Handmade Mug Small Business Packaging
$0.03
Mix MOQ : 100
Stainless Steel Cup And Peg Pendant Bail For Jewelry Making Artificial Pearl Caps Connector Findings Simple Minimalist Design
Stainless Steel Cup And Peg Pendant Bail For Jewelry Making Artificial Pearl Caps Connector Findings Simple Minimalist Design
like
Find Similar
Silver 316L stainless steel umbrella hollow earring post with ring and pendant connector - Umbrella Shaped Hollow Pendant (KLJ652-Z)
Stainless Steel Cup And Peg Pendant Bail For Jewelry Making Artificial Pearl Caps Connector Findings Simple Minimalist Design
$0.36
No MOQ
Free Shipping
Watercolor Purple Flower Vase Wall Stickers Butterfly Teapot Cup Self-Adhesive PVC Decals For Living Room Bedroom Decor
Watercolor Purple Flower Vase Wall Stickers Butterfly Teapot Cup Self-Adhesive PVC Decals For Living Room Bedroom Decor
like
Find Similar
Flat lay showing the 60x40cm PVC wall sticker set with purple watercolor floral designs - 40*60cm Layout
Watercolor Purple Flower Vase Wall Stickers Butterfly Teapot Cup Self-Adhesive PVC Decals For Living Room Bedroom Decor
-4%
$1.15
No MOQ
3D Broken Wall Football Wall Sticker World Cup Soccer Player Theme Decorative PVC Self-Adhesive Mural For Kids Bedroom Living Room
3D Broken Wall Football Wall Sticker World Cup Soccer Player Theme Decorative PVC Self-Adhesive Mural For Kids Bedroom Living Room
like
Find Similar
3D football wall sticker breaking through wall with stadium view and mini soccer elements - Football Pattern Style (ZC1270)
3D Broken Wall Football Wall Sticker World Cup Soccer Player Theme Decorative PVC Self-Adhesive Mural For Kids Bedroom Living Room
$1.38
Mix MOQ : 4
Laser Cut Butterfly Cup Cards For Wedding Party Decoration Hollow Pearlescent Paper Place Cards For Wine Glass Table Decor
Laser Cut Butterfly Cup Cards For Wedding Party Decoration Hollow Pearlescent Paper Place Cards For Wine Glass Table Decor
like
Find Similar
Elegant 3D laser cut butterfly place cards for wedding glasses in white art paper - White
Laser Cut Butterfly Cup Cards For Wedding Party Decoration Hollow Pearlescent Paper Place Cards For Wine Glass Table Decor
$0.07
Mix MOQ : 50
Soccer Theme Birthday Party Photo Booth Props Football World Cup Celebration Decorations Paper Wood Material Fun Props
Soccer Theme Birthday Party Photo Booth Props Football World Cup Celebration Decorations Paper Wood Material Fun Props
like
Find Similar
25-piece soccer party photo booth props kit with themed glasses and sports cutouts - Soccer Theme(L-0072)
Soccer Theme Birthday Party Photo Booth Props Football World Cup Celebration Decorations Paper Wood Material Fun Props
$2.25
Mix MOQ : 5
Creative Coffee Is Always A Good Idea Wall Sticker PVC Coffee Cup Decal For Cafe Restaurant Living Room Home Decor
Creative Coffee Is Always A Good Idea Wall Sticker PVC Coffee Cup Decal For Cafe Restaurant Living Room Home Decor
like
Find Similar
Coffee Is Always a Good Idea wall decal with cup design and size dimensions - 35x60cm (FX-E213)
Creative Coffee Is Always A Good Idea Wall Sticker PVC Coffee Cup Decal For Cafe Restaurant Living Room Home Decor
$1.21
No MOQ
Watercolor Coffee Theme Wall Sticker Mocha Pot Cup Beans Decal For Kitchen Cafe Home Decor Removable PVC Mural Art Sticker
Watercolor Coffee Theme Wall Sticker Mocha Pot Cup Beans Decal For Kitchen Cafe Home Decor Removable PVC Mural Art Sticker
like
Find Similar
International Coffee Day wall decal with coffee beans and pot, layout size 28x29cm - PH-QT9639
Watercolor Coffee Theme Wall Sticker Mocha Pot Cup Beans Decal For Kitchen Cafe Home Decor Removable PVC Mural Art Sticker
-4%
$0.82
No MOQ
Coffee Cup Wall Sticker With Coffee Beans Pattern Creative Coffee Day Decal For Kitchen Dining Room Cafe DIY Art Mural
Coffee Cup Wall Sticker With Coffee Beans Pattern Creative Coffee Day Decal For Kitchen Dining Room Cafe DIY Art Mural
like
Find Similar
Dark brown Coffee Day wall sticker featuring coffee cup and beans in 54x25cm size - Dark Coffee (PH-QT9093)
Coffee Cup Wall Sticker With Coffee Beans Pattern Creative Coffee Day Decal For Kitchen Dining Room Cafe DIY Art Mural
$0.92
No MOQ
Travel Series DIY Metal Keychain Popcorn Coffee Cup Headset Charms For Women Girls Silver Pink Enamel Jewelry Gift Accessory
Travel Series DIY Metal Keychain Popcorn Coffee Cup Headset Charms For Women Girls Silver Pink Enamel Jewelry Gift Accessory
like
Find Similar
DIY travel keychain with popcorn, cold drink cup and pink enamel headphone pendants - Silver Pink
Travel Series DIY Metal Keychain Popcorn Coffee Cup Headset Charms For Women Girls Silver Pink Enamel Jewelry Gift Accessory
-9%
$3.12
No MOQ
Free Shipping
Watercolor Coffee Cup Flower Kitchen Wall Sticker Spice Of Life Quote PVC Waterproof DIY Home Decor Mural Decal Sticker
Watercolor Coffee Cup Flower Kitchen Wall Sticker Spice Of Life Quote PVC Waterproof DIY Home Decor Mural Decal Sticker
like
Find Similar
Kitchen wall decal with coffee cup art and The spice of life quote in warm colors - Cup & Flowers (FB018) / 30x60cm
Watercolor Coffee Cup Flower Kitchen Wall Sticker Spice Of Life Quote PVC Waterproof DIY Home Decor Mural Decal Sticker
$1.21
Mix MOQ : 4
Cute Cartoon Drink Cup Enamel Pin Serotonin Booster Smile Face Zinc Alloy Brooch Badge For Clothing Bags Backpack Jewelry Gift
Cute Cartoon Drink Cup Enamel Pin Serotonin Booster Smile Face Zinc Alloy Brooch Badge For Clothing Bags Backpack Jewelry Gift
like
Find Similar
Cute serotonin booster enamel pin featuring a yellow cartoon cup and pink lid design - Cartoon Drink Cup Style (QHXZ5614)
Cute Cartoon Drink Cup Enamel Pin Serotonin Booster Smile Face Zinc Alloy Brooch Badge For Clothing Bags Backpack Jewelry Gift
-9%
$0.39
No MOQ
Vintage Antique Silver Erlenmeyer Flask Keychain Scientific Chemistry Scale Measuring Cup Pendant Keyring Graduate Gift
Vintage Antique Silver Erlenmeyer Flask Keychain Scientific Chemistry Scale Measuring Cup Pendant Keyring Graduate Gift
like
Find Similar
Vintage silver metal Erlenmeyer flask keychain with 100ml scale engraving for science fans - Antique Silver
Vintage Antique Silver Erlenmeyer Flask Keychain Scientific Chemistry Scale Measuring Cup Pendant Keyring Graduate Gift
-14%
$0.23
Mix MOQ : 10
Cute Ceramic Mug Cartoon Apple Bear Print Red Rim Colorful Dots Warm Memory Coffee Milk Cup Christmas Valentine Gift
Cute Ceramic Mug Cartoon Apple Bear Print Red Rim Colorful Dots Warm Memory Coffee Milk Cup Christmas Valentine Gift
like
Find Similar
Detail of white ceramic apple mug with red rim and colorful polka dots in a cozy home setting - 350ml / Star Apple
Cute Ceramic Mug Cartoon Apple Bear Print Red Rim Colorful Dots Warm Memory Coffee Milk Cup Christmas Valentine Gift
$2.59
No MOQ
Nordic Style Hand Painted Kitchen Tableware Wall Stickers PVC Teapot Cup Plate Decals For Dining Room Wall Decor
Nordic Style Hand Painted Kitchen Tableware Wall Stickers PVC Teapot Cup Plate Decals For Dining Room Wall Decor
like
Find Similar
Nordic kitchen wall sticker showing plates and cups pattern with size 30x90cm - 30*90cm
Nordic Style Hand Painted Kitchen Tableware Wall Stickers PVC Teapot Cup Plate Decals For Dining Room Wall Decor
$1.30
No MOQ
Plush Mohawk Fan Wig Headband Tricolor Sports Cheering Headpiece National Flag Colors For World Cup Carnival Party Supplies
Plush Mohawk Fan Wig Headband Tricolor Sports Cheering Headpiece National Flag Colors For World Cup Carnival Party Supplies
like
Find Similar
Christmas themed headband featuring long red and white plush faux fur on a green elastic base - Tricolor Mohawk Style (1154A)
NewPlush Mohawk Fan Wig Headband Tricolor Sports Cheering Headpiece National Flag Colors For World Cup Carnival Party Supplies
-5%
$1.42
No MOQ
Christmas Wood Coasters Heat Resistant Laser Cut Hollow Wood Pad Natural Snowflake Tree Pattern Table Decor Cup Mats
Christmas Wood Coasters Heat Resistant Laser Cut Hollow Wood Pad Natural Snowflake Tree Pattern Table Decor Cup Mats
like
Find Similar
Set of four wooden Christmas coasters with laser-cut tree, snowflake and forest patterns - Christmas Hollow Pattern
Christmas Wood Coasters Heat Resistant Laser Cut Hollow Wood Pad Natural Snowflake Tree Pattern Table Decor Cup Mats
$0.32
Mix MOQ : 50
Gold Star Laser Cut Wine Glass Place Cards Hollow Paper Cup Decoration For Wedding Party Birthday Event Dinner Table Decor
Gold Star Laser Cut Wine Glass Place Cards Hollow Paper Cup Decoration For Wedding Party Birthday Event Dinner Table Decor
like
Find Similar
Golden laser-cut star wine glass place cards for wedding table decorations - Gold
Gold Star Laser Cut Wine Glass Place Cards Hollow Paper Cup Decoration For Wedding Party Birthday Event Dinner Table Decor
$0.07
Mix MOQ : 50
Hollow Out Fish Shape Wine Glass Place Cards Laser Cut Paper Name Card For Wedding Party Table Decorations Red Carp Cup Markers
Hollow Out Fish Shape Wine Glass Place Cards Laser Cut Paper Name Card For Wedding Party Table Decorations Red Carp Cup Markers
like
Find Similar
Red cutout fish-shaped place card for wine glasses with detailed koi pattern for festive events - Red (BK-249)
Hollow Out Fish Shape Wine Glass Place Cards Laser Cut Paper Name Card For Wedding Party Table Decorations Red Carp Cup Markers
$0.07
Mix MOQ : 100
Montessori Wooden Color Classification Cup Shape Matching Toy For Toddlers Preschool Early Learning Education Geometric Blocks
Montessori Wooden Color Classification Cup Shape Matching Toy For Toddlers Preschool Early Learning Education Geometric Blocks
like
Find Similar
Montessori wooden color sorting cup and geometric shape matching educational toy for toddlers - Color Classification Cylinder
Montessori Wooden Color Classification Cup Shape Matching Toy For Toddlers Preschool Early Learning Education Geometric Blocks
-4%
$4.11
No MOQ
Christmas Carousel Cake Box Paper Packaging With LED Light String Transparent Plastic Cups And Decorative Dessert Toppers
Christmas Carousel Cake Box Paper Packaging With LED Light String Transparent Plastic Cups And Decorative Dessert Toppers
like
Find Similar
Set of 50 disposable 360ml clear plastic boba cups with dome lids for Christmas desserts - 360ML Plastic Cups 50 Pcs (No Spoons)
50-piece 360ml transparent dessert cup set with spherical lids and pink spoons - 360ML Plastic Cups 50 Pcs (With Spoons)
Warm white LED copper wire string lights with 3 modes for Christmas gift box decor - Warm White 1M LED String Light (Single)
Christmas Carousel Cake Box Paper Packaging With LED Light String Transparent Plastic Cups And Decorative Dessert Toppers
$0.20-4.64
Mix MOQ : 3
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access