Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Monster Truck Birthday Party Supplies Off-Road Theme Banner Tableware Tablecloth Napkins Plates Cups Cake Toppers Balloons
Monster Truck Birthday Party Supplies Off-Road Theme Banner Tableware Tablecloth Napkins Plates Cups Cake Toppers Balloons
like
Find Similar
Monster truck party paper plates set in red and orange colors, 7-inch diameter 10pcs pack - 7 Inch Plates (10PCS)
Monster truck themed 9-inch disposable paper plates for boys birthday party, 10 pieces - 9 Inch Plates (10PCS)
Set of 20 monster truck happy birthday paper napkins in 13-inch and 6.5-inch sizes - 20 Napkins
10-piece monster truck party paper cups with dimensions for birthday celebration - Paper Cups 10pcs
+11
Monster Truck Birthday Party Supplies Off-Road Theme Banner Tableware Tablecloth Napkins Plates Cups Cake Toppers Balloons
-12%
$0.33-2.15
No MOQ
 · 
188 sold recently
Ceramic Mug With Lid And Spoon Tulip Flower Pattern Floral Handle Ins Style Cute Coffee Cup Gift For Women Home Office
Ceramic Mug With Lid And Spoon Tulip Flower Pattern Floral Handle Ins Style Cute Coffee Cup Gift For Women Home Office
like
Find Similar
Pink tulip ceramic mug with matching lid, spoon, and creative floral handle decoration - With Lid and Spoon / Pink
Ceramic tulip pattern mug in cream white with a red lid and flower handle decoration - With Lid and Spoon / Red
Ceramic tulip mug with orange lid and spoon, cream finish with floral pattern - With Lid and Spoon / Orange
Cream ceramic tulip mug with brown handle, wavy lid and yellow ball stirring spoon - With Lid and Spoon / Brown
+4
Ceramic Mug With Lid And Spoon Tulip Flower Pattern Floral Handle Ins Style Cute Coffee Cup Gift For Women Home Office
-5%
$3.78-4.60
No MOQ
 · 
17 sold recently
Mini Food Resin Flatback Charms Cute Cartoon Cheese And Egg Milk Tea Cup Biscuit Ice Cream DIY Jewelry Making Decoration
Mini Food Resin Flatback Charms Cute Cartoon Cheese And Egg Milk Tea Cup Biscuit Ice Cream DIY Jewelry Making Decoration
like
Find Similar
Close-up of a pink resin mini oval button showing dimensions of 1.2cm x 1.5cm on a grid - Pink Cheese/Biscuit
Miniature resin cheese charm measured with a ruler for DIY crafts size reference - Yellow Triangle Cheese
Macro detail of a 1.5cm fried egg resin charm on a grid mat for DIY crafts - Fried Egg
Close-up of a 1.5cm mini resin bubble tea cup charm being measured on a ruler - Pink Boba Cup
+2
Mini Food Resin Flatback Charms Cute Cartoon Cheese And Egg Milk Tea Cup Biscuit Ice Cream DIY Jewelry Making Decoration
$0.03
Mix MOQ : 2
 · 
319 sold recently
Portable Insulated Cup Sleeve Oxford Cloth Cartoon Print Water Bottle Carrier Bag With Handheld Strap Zipper Closure
Portable Insulated Cup Sleeve Oxford Cloth Cartoon Print Water Bottle Carrier Bag With Handheld Strap Zipper Closure
like
Find Similar
Portable yellow lemon pattern cup sleeve with handle for thermal bottles and milk tea - Light Yellow Lemon
Pink insulated cup sleeve with summer ice cream pattern and portable carry handle - Pink Ice Cream
Portable navy blue insulated milk tea cup sleeve with cute cartoon rabbit pattern - Grey Green Rabbit
Blue insulated water bottle carrier bag with cute cartoon cat patterns and handle - Blue Cat
Portable Insulated Cup Sleeve Oxford Cloth Cartoon Print Water Bottle Carrier Bag With Handheld Strap Zipper Closure
-5%
$0.99
Mix MOQ : 2
 · 
13 sold recently
Enamel Food Drink Pendants Stainless Steel DIY Jewelry Making Coffee Cup French Fries Wine Bottle Shapes Cute Fashion
Enamel Food Drink Pendants Stainless Steel DIY Jewelry Making Coffee Cup French Fries Wine Bottle Shapes Cute Fashion
like
Find Similar
Pink and blue glitter ice cream cone charm in gold finish for DIY jewelry, 14x8mm - Pink Blue Ice Cream Charm (KLJ9465-ZLA)
Colorful enamel cupcake pendant in gold finish for DIY jewelry making 13x9mm - Colorful Cupcake Charm (KLJ9466-ZLA)
Gold bottle-shaped pendant charm with five inlaid crystals and 22x5mm dimensions - Rhinestone Wine Bottle Charm (KLJ9474-ZLA)
Golden wine glass enamel charm with red heart detail and 18x8mm size markings - Red Heart Wine Glass Charm (KLJ9475-ZLA)
+14
Enamel Food Drink Pendants Stainless Steel DIY Jewelry Making Coffee Cup French Fries Wine Bottle Shapes Cute Fashion
$0.56-0.89
No MOQ
 · 
14 sold recently
Free Shipping
Halloween Disposable Tableware Paper Plates Cups Napkins Tablecloth Cutlery Blood Handprint Horror Party Decorations
Halloween Disposable Tableware Paper Plates Cups Napkins Tablecloth Cutlery Blood Handprint Horror Party Decorations
like
Find Similar
Halloween party paper plates with bloody handprint and ghost design, 10-piece set 7 inch - Small Paper Plates
Halloween blood splatter disposable paper plates set of 10 for spooky party table decor - Large Paper Plates
Set of 10 horror themed paper cups 9oz featuring blood handprints for Halloween party - Paper Cup
Halloween party napkins featuring spooky red bloody handprints and happy text design - Napkins
+5
Halloween Disposable Tableware Paper Plates Cups Napkins Tablecloth Cutlery Blood Handprint Horror Party Decorations
-5%
$0.49-1.15
No MOQ
 · 
13 sold recently
Summer Christmas Party Tableware Plastic Tablecloth Paper Plates Cups Napkins Cutlery Straws Tropical Beach Santa Decor
Summer Christmas Party Tableware Plastic Tablecloth Paper Plates Cups Napkins Cutlery Straws Tropical Beach Santa Decor
like
Find Similar
Light blue plastic cutlery set with fork knife and spoon featuring diamond texture handles - Blue Plastic Table Knives
Eco-friendly light blue and white spiral paper straws for summer beach and pool parties - Blue and White Striped Paper Straws (Small)
Fan-shaped stack of summer Christmas napkins with tropical palm and beach ball prints - Summer Christmas Printed Napkins
Stack of Summer Christmas party paper cups with Santa beach and palm leaf illustrations - Summer Christmas Printed Paper Cups
+6
Summer Christmas Party Tableware Plastic Tablecloth Paper Plates Cups Napkins Cutlery Straws Tropical Beach Santa Decor
$0.27-1.58
Mix MOQ : 10
 · 
23 sold recently
Halloween Straw Cover Caps Dustproof Reusable PVC Silicone Ghost Pumpkin Cat For Tumbler Cups Toppers Decorative
Halloween Straw Cover Caps Dustproof Reusable PVC Silicone Ghost Pumpkin Cat For Tumbler Cups Toppers Decorative
like
Find Similar
Halloween black cat witch on pumpkin 10mm reusable straw cover cap for water bottles - Pumpkin Cat / Bagged without Straw
Halloween pumpkin ghost silicone straw topper 10mm dust plug for reusable straws - Pumpkin Elf / Bagged without Straw
Orange cup shaped 10mm Halloween straw cover with black flower and size dimensions - Orange Cup / Bagged without Straw
Ghost wizard straw cover made of soft silicone for 10mm Stanley cup straws - White Star Ghost / Bagged without Straw
+2
Halloween Straw Cover Caps Dustproof Reusable PVC Silicone Ghost Pumpkin Cat For Tumbler Cups Toppers Decorative
$0.20
Mix MOQ : 2
 · 
274 sold recently
High Borosilicate Glass Mug Heat Resistant Coffee Cup With Handle Letter Print Good Morning Pattern Minimalist Breakfast Water Cup
High Borosilicate Glass Mug Heat Resistant Coffee Cup With Handle Letter Print Good Morning Pattern Minimalist Breakfast Water Cup
like
Find Similar
Nordic glass Good Morning mug with handle filled with iced pink fruit juice drink - Round Cup White Letter
Nordic glass cup with white Good Morning text and handle for breakfast milk - Straight Mug White Letter
Nordic glass mug with Good Morning print and handle filled with ice and berries - Round Cup Black Letter
Minimalist Good Morning glass mug with handle and black lettering for breakfast milk - Straight Mug Black Letter
+6
High Borosilicate Glass Mug Heat Resistant Coffee Cup With Handle Letter Print Good Morning Pattern Minimalist Breakfast Water Cup
-12%
$0.51-0.96
Mix MOQ : 2
 · 
12 sold recently
Cute Cat Milk Tea Cup Keychain Acrylic Liquid Quicksand Sakura Pendant Bag Charm Cartoon Gift Accessory
Cute Cat Milk Tea Cup Keychain Acrylic Liquid Quicksand Sakura Pendant Bag Charm Cartoon Gift Accessory
like
Find Similar
Pink cat milk tea cup keychain with creative liquid oil and golden metal clasp - Purple Milk Tea
Blue acrylic cat bubble tea cup keychain with liquid oil and golden lobster clasp - Blue Milk Tea
Cartoon milk tea cup keychain with white cat figurine and liquid filling inside - Brown Milk Tea
Green cat milk tea cup keychain with liquid oil and golden metal lobster clasp - Green Milk Tea
+4
Cute Cat Milk Tea Cup Keychain Acrylic Liquid Quicksand Sakura Pendant Bag Charm Cartoon Gift Accessory
-8%
$1.12
Mix MOQ : 2
 · 
61 sold recently
304 Stainless Steel Vacuum Insulated Tumbler With Metal Straw And Lid Double Wall Portable Travel Mug Coffee Cup Modern Minimalist Office Cup
304 Stainless Steel Vacuum Insulated Tumbler With Metal Straw And Lid Double Wall Portable Travel Mug Coffee Cup Modern Minimalist Office Cup
like
Find Similar
Premium 750ml light gray vacuum insulated stainless steel coffee tumbler with straw - 750ml / Coffee
White 750ml 304 stainless steel insulated vacuum coffee tumbler with matching lid and metal straw - 750ml / White
750ml gray stainless steel vacuum insulated tumbler with straw for coffee and travel - 750ml / Khaki
750ml light blue stainless steel vacuum insulated coffee tumbler with metal straw - 750ml / Light Blue
+16
304 Stainless Steel Vacuum Insulated Tumbler With Metal Straw And Lid Double Wall Portable Travel Mug Coffee Cup Modern Minimalist Office Cup
-5%
$3.43-3.56
Mix MOQ : 2
 · 
13 sold recently
World Cup National Flag Spring Headband Soccer Fan Cheering Prop Glitter Country Flag Hair Hoop For Festival Party Decoration
World Cup National Flag Spring Headband Soccer Fan Cheering Prop Glitter Country Flag Hair Hoop For Festival Party Decoration
like
Find Similar
French flag headband with springs for World Cup fans and party decoration - France Flag Style
German flag sequin headband for football fans with spring flag decor and dimensions - Germany Flag Style
Glitter Canada flag headband with springs for World Cup soccer fan cheering accessories - Canada Flag Style
2026 World Cup headband with Netherlands flag on springs for football fans - Netherlands Flag Style
+10
World Cup National Flag Spring Headband Soccer Fan Cheering Prop Glitter Country Flag Hair Hoop For Festival Party Decoration
$0.49
No MOQ
 · 
90 sold recently
Lavender Floral Butterfly Birthday Party Tableware Supplies Disposable Plastic Tablecloth Paper Plates Cups Napkins Banner Cutlery
Lavender Floral Butterfly Birthday Party Tableware Supplies Disposable Plastic Tablecloth Paper Plates Cups Napkins Banner Cutlery
like
Find Similar
Lavender purple glitter plastic cutlery set with fork knife and spoon for parties - Purple Dinner Knife / Purple
Detail view of lavender pattern rectangular plastic tablecloth measuring 137x274 cm - Lavender Tablecloth
Lavender themed Happy Birthday bunting with purple butterfly patterns and floral print - Lavender Banner
Detail of lavender themed party paper cups with Happy Birthday text and floral pattern - Lavender Paper Cup
+5
Lavender Floral Butterfly Birthday Party Tableware Supplies Disposable Plastic Tablecloth Paper Plates Cups Napkins Banner Cutlery
$0.58-1.53
Mix MOQ : 20
 · 
47 views
Retro Hand Painted Ceramic High Foot Mugs Animal Print Zebra Leopard Coffee Cup Irregular Dessert Tray Home Decor Drinkware
Retro Hand Painted Ceramic High Foot Mugs Animal Print Zebra Leopard Coffee Cup Irregular Dessert Tray Home Decor Drinkware
like
Find Similar
Handmade zebra print ceramic goblet cup with curvy handle and 290ml capacity - 290ml / Zebra Print Goblet Mug
Ceramic zebra print geometric pedestal tray 19.5x13x5.4cm for dessert or jewelry - N/A / Zebra Print Geometric Plate
Handcrafted ceramic leopard print three-legged geometric tray for jewelry and desserts - N/A / Leopard Print Geometric Plate
Ink-style geometric ceramic pedestal tray with irregular black patterns, size 19.5x13x5.4cm - N/A / Ink Pattern Geometric Plate
+4
Retro Hand Painted Ceramic High Foot Mugs Animal Print Zebra Leopard Coffee Cup Irregular Dessert Tray Home Decor Drinkware
$8.36-10.09
No MOQ
 · 
69 views
Flower Shaped Scented Candle In Glass Cup Soy Paraffin Wax Handmade Home Fragrance Decor Gift Succulent Rose Peony
Flower Shaped Scented Candle In Glass Cup Soy Paraffin Wax Handmade Home Fragrance Decor Gift Succulent Rose Peony
like
Find Similar
Pink succulent scented candle in glass jar with English Pear and Freesia aroma - Pink Anemone
Green succulent scented candle in English Pear & Freesia scent with 5.8cm diameter - Green Succulent
Deep purple rose scented candle with English Pear Freesia fragrance, 6.5cm diameter - Deep Purple Rose
Pink succulent-shaped scented candle in a glass jar with English Pear & Freesia fragrance - Pink Carnation
+1
Flower Shaped Scented Candle In Glass Cup Soy Paraffin Wax Handmade Home Fragrance Decor Gift Succulent Rose Peony
$1.72
Mix MOQ : 5
 · 
69 sold recently
Relief Bowl Silicone Mold DIY Resin Storage Box Candle Cup Mold Geometric Dot Pattern Cement Flower Pot Craft Tool
Relief Bowl Silicone Mold DIY Resin Storage Box Candle Cup Mold Geometric Dot Pattern Cement Flower Pot Craft Tool
like
Find Similar
Honeycomb bubble texture silicone mold for DIY candle jar and resin storage box - Style 1 Relief Bowl
White silicone mold for faceted relief bowl with wavy edge and green glass finished sample - Style 2 Relief Bowl
Silicone mold for faceted resin bowl with a purple finished container example - Style 3 Relief Bowl
Semi-transparent silicone mold for retro embossed bowl DIY resin storage box - Style 4 Relief Bowl
Relief Bowl Silicone Mold DIY Resin Storage Box Candle Cup Mold Geometric Dot Pattern Cement Flower Pot Craft Tool
-4%
$3.83
No MOQ
 · 
16 views
Rustic Wooden Candle Holder With Glass Cup And Tea Light Natural Driftwood Handmade Creative Table Centerpiece Decor
Rustic Wooden Candle Holder With Glass Cup And Tea Light Natural Driftwood Handmade Creative Table Centerpiece Decor
like
Find Similar
Handcrafted driftwood pillar candle holder with clear glass cup on white background - 14*14*8cm
Rustic Wooden Candle Holder With Glass Cup And Tea Light Natural Driftwood Handmade Creative Table Centerpiece Decor
-4%
$2.30
No MOQ
 · 
14 sold recently
Hand-painted Ceramic Mug Irregular Shape Cute Cartoon Strawberry Tiger Fruit Pattern Heat Resistant Breakfast Coffee Cup
Hand-painted Ceramic Mug Irregular Shape Cute Cartoon Strawberry Tiger Fruit Pattern Heat Resistant Breakfast Coffee Cup
like
Find Similar
Close-up of hand-held stackable ceramic mugs with hand-painted yellow floral and black stripes - Yellow Floral
Detail of hand-painted strawberry ceramic mug with wavy rim and chunky handle - Strawberry Small Flower
Cute hand-pinched orange ceramic mug with cartoon tiger pattern and large round handle - Orange Tiger
Detail showing the blue checkered pattern and red smiley flower on a white ceramic mug - Plaid Tulip
+2
Hand-painted Ceramic Mug Irregular Shape Cute Cartoon Strawberry Tiger Fruit Pattern Heat Resistant Breakfast Coffee Cup
-4%
$5.48
Mix MOQ : 2
 · 
45 sold recently
Plastic Food Storage Containers With Measuring Cup Lid Transparent Airtight Cereal Grain Dispenser For Kitchen Organization
Plastic Food Storage Containers With Measuring Cup Lid Transparent Airtight Cereal Grain Dispenser For Kitchen Organization
like
Find Similar
Transparent food storage container with green lid, integrated measuring cup and dimensions - Small / Nordic Green
Clear plastic food storage container with pink lid and measuring cup, 15cm height dimensions - Small / Nordic Pink
Transparent plastic dry food storage container with light blue measuring lid and dimensions - Small / Nordic Blue
Clear plastic food storage container with beige measuring cup lid and 1.9L dimensions - Small / Nordic Beige
+4
Plastic Food Storage Containers With Measuring Cup Lid Transparent Airtight Cereal Grain Dispenser For Kitchen Organization
-11%
$0.45-0.56
Mix MOQ : 2
 · 
17 sold recently
Pink Gold Dot Disposable Party Tableware Set Paper Plates Cups Napkins Cutlery Straws Tablecloth Banner Birthday Decor
Pink Gold Dot Disposable Party Tableware Set Paper Plates Cups Napkins Cutlery Straws Tablecloth Banner Birthday Decor
like
Find Similar
Pack of pink paper straws with metallic gold polka dots for party tableware decor - Straw
Set of eight gold plastic knives with serrated edges for party tableware decoration - Gold Disposable Knives
Set of eight elegant gold disposable plastic forks with stylish ribbed handle design - Gold Disposable Forks
Detail view of 8 bronze spoons with vertical striped handles for gold party tableware - Gold Disposable Spoons
+14
Pink Gold Dot Disposable Party Tableware Set Paper Plates Cups Napkins Cutlery Straws Tablecloth Banner Birthday Decor
$0.25-2.29
Mix MOQ : 5
 · 
231 sold recently
Diamond Glitter Lip Gloss Matte To Artificial Pearl Liquid Lipstick Waterproof Long Lasting Non Stick Cup Shimmer Lip Tint For Women
Diamond Glitter Lip Gloss Matte To Artificial Pearl Liquid Lipstick Waterproof Long Lasting Non Stick Cup Shimmer Lip Tint For Women
like
Find Similar
Tudaier Classic Vivid pink glitter lip gloss in a golden cap transparent tube - 19# Pale Pink Glitter
Pudaier pearly lip gloss shade 01 in rosy purple with shimmering glitter and wand - 01# Pink Purple Glitter
Pudaier matte shimmer liquid lipstick in shade 02 plum purple with glitter finish - 02# Deep Pink Purple Glitter
Classic Vivid matte lip gloss shade 03 deep red with metallic shimmer in golden tube - 03# Glitter Red
+15
Diamond Glitter Lip Gloss Matte To Artificial Pearl Liquid Lipstick Waterproof Long Lasting Non Stick Cup Shimmer Lip Tint For Women
$3.90
Mix MOQ : 3
 · 
65 views
Soccer Theme Birthday Party Decoration Set Green Football Field Tableware Paper Plates Cups Napkins Banners Party Supplies For Kids
Soccer Theme Birthday Party Decoration Set Green Football Field Tableware Paper Plates Cups Napkins Banners Party Supplies For Kids
like
Find Similar
Soccer theme party plates featuring green grass and football designs for birthday decoration - 7 Inch Plate
Disposable napkins for soccer themed party set with green field football design - Napkins
Disposable green paper cups with soccer ball design for sports themed birthday party - Paper Cup
Soccer themed birthday party cone hats featuring green background and ball pattern - Paper Hat
+29
Soccer Theme Birthday Party Decoration Set Green Football Field Tableware Paper Plates Cups Napkins Banners Party Supplies For Kids
-5%
$0.36-1.40
No MOQ
 · 
240 sold recently
Mini Shoulder Crossbody Bag Milk Tea Coffee Cup Shaped PU Leather Cute Creative Novelty Coin Purse For Kids Toddlers
Mini Shoulder Crossbody Bag Milk Tea Coffee Cup Shaped PU Leather Cute Creative Novelty Coin Purse For Kids Toddlers
like
Find Similar
Brown and beige PU leather milk tea shaped crossbody bag with pearl details for kids - Pearl Milk Tea Shape / Milk Tea
Detail of coffee cup shaped mini bag with embroidery and adjustable rope strap - Coffee Cup Shape / Coffee
Mini Shoulder Crossbody Bag Milk Tea Coffee Cup Shaped PU Leather Cute Creative Novelty Coin Purse For Kids Toddlers
$4.32
Mix MOQ : 3
 · 
25 sold recently
Van Gogh Artistic Enamel Brooch Pins For Women Men Alloy Starry Night Sunflower Skull Moon Coffee Cup Badge Pins Jewelry Gift
Van Gogh Artistic Enamel Brooch Pins For Women Men Alloy Starry Night Sunflower Skull Moon Coffee Cup Badge Pins Jewelry Gift
like
Find Similar
Artistic hourglass enamel pin featuring Van Gogh Starry Night and Sunflowers art design - Starry Night Sunflower Hourglass Style(QHXZ1593)
Creative Van Gogh sunflower skull enamel pin with colorful floral details and gold plating - Sunflower Skull Style(QHXZ1594)
Artistic Starry Night painting enamel brooch in a glass drift bottle shape design - Starry Night Drifting Bottle Style(QHXZ1595)
Cartoon enamel pin in coffee cup shape featuring Van Gogh Starry Night art style - Starry Night Coffee Cup Style(QHXZ1596)
+1
Van Gogh Artistic Enamel Brooch Pins For Women Men Alloy Starry Night Sunflower Skull Moon Coffee Cup Badge Pins Jewelry Gift
-9%
$0.55
No MOQ
 · 
31 sold recently
Free Shipping
DIY Diamond Painting Coasters Wood Mandala Landscape Christmas Pattern Handmade Rhinestone Cup Mat With Holder Art Craft
DIY Diamond Painting Coasters Wood Mandala Landscape Christmas Pattern Handmade Rhinestone Cup Mat With Holder Art Craft
like
Find Similar
Set of 6 mandala DIY diamond painting coasters with a sleek black metal holder - Colorful Mandala (BD604)
Detailed size chart showing dimensions of hexagonal diamond painting landscape coasters - Landscape Style (BD708)
DIY Christmas diamond painting coaster set with 6 winter patterns and metal holder - Christmas Theme (BD602)
DIY Mandala Diamond Painting Coaster Set of 6 with black metal holder organizer - Mandala Style (BD603)
+12
DIY Diamond Painting Coasters Wood Mandala Landscape Christmas Pattern Handmade Rhinestone Cup Mat With Holder Art Craft
$3.17-3.75
No MOQ
 · 
29 sold recently
Lobster Theme Disposable Party Tableware Paper Plates Cups Napkins Tablecloth Pennant For Summer Seaside BBQ Picnic Birthday Decorations
Lobster Theme Disposable Party Tableware Paper Plates Cups Napkins Tablecloth Pennant For Summer Seaside BBQ Picnic Birthday Decorations
like
Find Similar
7-inch disposable paper plate with red lobster print for summer seafood parties - 7 Inch Plates 10PCS / Red Lobster Pattern Paper Plates
Detailed view of a 9-inch lobster pattern paper plate for summer BBQ parties, size 23cm - 9 Inch Plates 10PCS / Red Lobster Pattern Paper Plates
Detailed view of 10 disposable paper cups with red lobster print and size measurements - Paper Cups 10pcs / Red Lobster Pattern Paper Cups
Detail of 20pcs disposable paper napkins with red lobster print for summer parties - Napkins 20PCS / Red Lobster Pattern Napkins
+8
Lobster Theme Disposable Party Tableware Paper Plates Cups Napkins Tablecloth Pennant For Summer Seaside BBQ Picnic Birthday Decorations
-6%
$0.27-2.49
No MOQ
 · 
17 sold recently
Western Cowboy Horse Floral Birthday Party Decorations Tableware Banner Balloons Cake Topper Napkins Plates Cups Tablecloth
Western Cowboy Horse Floral Birthday Party Decorations Tableware Banner Balloons Cake Topper Napkins Plates Cups Tablecloth
like
Find Similar
7-inch western cowboy horse themed paper plate with roses and golden rim decor - 7-inch Plates (10 PCS)
Western horse and flower party paper plates with brown stallion and red rose design - 9-inch Plates (10 PCS)
Detailed dimensions of cowboy horse and floral theme party paper cups in a stack - Paper Cups (10 PCS)
Western horse theme paper napkins 20pcs for girls birthday party decorations 33cm - Paper Napkins (20 PCS)
+9
Western Cowboy Horse Floral Birthday Party Decorations Tableware Banner Balloons Cake Topper Napkins Plates Cups Tablecloth
$0.52-1.59
Mix MOQ : 5
 · 
10 sold recently
American Football Theme Party Tableware Disposable Paper Plates Napkins Cups Tablecloth Banner For Birthday Game Day
American Football Theme Party Tableware Disposable Paper Plates Napkins Cups Tablecloth Banner For Birthday Game Day
like
Find Similar
Set of 10 disposable football themed 18cm paper plates for Super Bowl party decorations - 7 Inch Plates 10PCS/Pack
10-pack of 23cm American football themed paper plates for super bowl party game time decor - 9 Inch Plates 10PCS/Pack
Set of 10 American football party paper cups with green field and yard line pattern - Paper Cups Type A 10PCS
Detail of 10-piece football party paper cups with dimensions and soccer pattern design - Paper Cups Type B 10PCS
+12
American Football Theme Party Tableware Disposable Paper Plates Napkins Cups Tablecloth Banner For Birthday Game Day
$0.52-1.30
No MOQ
 · 
39 sold recently
Watercolor Butterfly Floral Birthday Party Decoration Disposable Tableware Plates Cups Napkins Banner Tablecloth Set
Watercolor Butterfly Floral Birthday Party Decoration Disposable Tableware Plates Cups Napkins Banner Tablecloth Set
like
Find Similar
Floral butterfly party tableware set with paper plates, cups, and napkins for birthdays - 4-Piece Tableware Set 50pcs (7 inch+9 inch+Napkin+Cup)
Watercolor floral birthday party set with butterfly plates, cups, and happy birthday banner - Tableware Decoration Set (Banner/Plates/Cups/Napkins/Tablecloth)
Watercolor floral and butterfly birthday party set with plates banners and cutlery - Full Party Set (Banner/Plates/Cups/Napkins/Tablecloth/Cutlery)
Floral watercolor paper plates with butterflies, 18cm 7 inch size, 10 pieces per pack - Small Paper Plates
+18
Watercolor Butterfly Floral Birthday Party Decoration Disposable Tableware Plates Cups Napkins Banner Tablecloth Set
-5%
$0.25-6.69
No MOQ
Funny Nose Mug Ceramic Coffee Cup Pig Dog Nose Design Novelty Prank Joke Drinkware For Office Home Gift
Funny Nose Mug Ceramic Coffee Cup Pig Dog Nose Design Novelty Prank Joke Drinkware For Office Home Gift
like
Find Similar
Funny white ceramic mug with pig nose bottom pattern shown in use for a humorous effect - Pig Nose Link
Funny Nose Mug Ceramic Coffee Cup Pig Dog Nose Design Novelty Prank Joke Drinkware For Office Home Gift
-4%
$1.92
Mix MOQ : 2
 · 
65 views
Miniature Bubble Tea Cup Pendants Resin Simulation Liquid With Cat Ear Lids For DIY Keychain Bag Jewelry Accessory
Miniature Bubble Tea Cup Pendants Resin Simulation Liquid With Cat Ear Lids For DIY Keychain Bag Jewelry Accessory
like
Find Similar
Mini pearl milk tea cup keychains in seven vibrant colors with cute animal lids - Mixed Colors
Set of three miniature bubble tea keychains with bear ears and straw in brown finish - Brown
Three purple bubble tea cup keychains with black pearls and straws on floral background - Purple
Three creative cat-shaped bubble tea cup keychains with white liquid and black pearls - White/Black
+4
Miniature Bubble Tea Cup Pendants Resin Simulation Liquid With Cat Ear Lids For DIY Keychain Bag Jewelry Accessory
$0.21
No MOQ
 · 
23 sold recently
Traditional Lotus Petal Frosted Liuli Glass Teacup Gradient Color Personal Drinking Master Cup Chinese Style
Traditional Lotus Petal Frosted Liuli Glass Teacup Gradient Color Personal Drinking Master Cup Chinese Style
like
Find Similar
Pink gradient lotus flower frosted glass tea cup with 70ml capacity and 8cm diameter - Gradient Pink
Frosted lotus-shaped gradient yellow glass tea cup with 70ml capacity and unique design - Gradient Yellow
Frosted gradient lotus glass tea cup in blue and white, 70ml capacity handcrafted teaware - Gradient Blue
Frosted lotus-shaped glass tea cup with a delicate white to green gradient finish - Gradient Green
+2
Traditional Lotus Petal Frosted Liuli Glass Teacup Gradient Color Personal Drinking Master Cup Chinese Style
-5%
$1.37-1.64
No MOQ
 · 
12 sold recently
World Cup 2026 Polyester Flag North America Host Theme Banner With Brass Grommets For Soccer Fans Celebration Decoration
World Cup 2026 Polyester Flag North America Host Theme Banner With Brass Grommets For Soccer Fans Celebration Decoration
like
Find Similar
2026 World Cup red commemorative banner with USA Canada Mexico soccer logos - Style 3 / Red (Single Sided Print)
Navy blue 2026 World Cup flag featuring host flags and a dynamic soccer player silhouette - Style 2 / Blue (Single Sided Print)
2026 World Cup soccer flag with creative numbers and cultural symbols for fans - Style 4 / Multicolor Creative (Single Sided Print)
2026 World Cup flag featuring USA, Canada, and Mexico logos on purple galaxy background - Style 1 / Purple Starry (Single Sided Print)
+8
World Cup 2026 Polyester Flag North America Host Theme Banner With Brass Grommets For Soccer Fans Celebration Decoration
$2.45-2.74
Mix MOQ : 3
 · 
16 sold recently
Gold Stamping Ocean Life PET Stickers Dreamy Blue Whale Dolphin Starfish Waterproof Decals For DIY Journal Scrapbooking Laptop Cup Decorative
Gold Stamping Ocean Life PET Stickers Dreamy Blue Whale Dolphin Starfish Waterproof Decals For DIY Journal Scrapbooking Laptop Cup Decorative
like
Find Similar
Close-up of gold-stamped ocean stickers featuring watercolor whales and dolphins - Marine Life Ocean Animals
Gold Stamping Ocean Life PET Stickers Dreamy Blue Whale Dolphin Starfish Waterproof Decals For DIY Journal Scrapbooking Laptop Cup Decorative
$0.93
No MOQ
 · 
21 sold recently
Mexico National Flag Car Hood Cover And Mirror Protector Polyester T-Shirt Printed Soccer Fan Supporters Gear For World Cup Sports Festive Events
Mexico National Flag Car Hood Cover And Mirror Protector Polyester T-Shirt Printed Soccer Fan Supporters Gear For World Cup Sports Festive Events
like
Find Similar
Durable Mexico car window flag with sturdy white plastic mount for football fans - Bunting Flag
Premium Mexican flag car hood cover protector for sports fans and car accessories. - Car Bonnet Cover
Detailed view of car side mirror cover featuring the vibrant Mexican flag design - Car Mirror Cover
Vibrant Mexico national flag T-shirt for football fans with stylized eagle graphics - T-Shirts
+2
Mexico National Flag Car Hood Cover And Mirror Protector Polyester T-Shirt Printed Soccer Fan Supporters Gear For World Cup Sports Festive Events
$0.72-8.79
No MOQ
 · 
150 sold recently
Portable PU Leather Coffee Cup Sleeve With Chunky Plastic Chain Handle Insulated Reusable Fashion Cup Carrier For Women
Portable PU Leather Coffee Cup Sleeve With Chunky Plastic Chain Handle Insulated Reusable Fashion Cup Carrier For Women
like
Find Similar
Morandi blue leather cup sleeve featuring a thick matte plastic chain and gold ring - Light Blue
Beige leather coffee cup sleeve with matte plastic chain handle and gold hardware - Khaki
Pink faux leather cup sleeve with trendy chunky matte resin chain and gold hardware - Rose Red
Pink faux leather cup holder sleeve featuring a chunky macaron resin chain handle - Nude Pink
+7
Portable PU Leather Coffee Cup Sleeve With Chunky Plastic Chain Handle Insulated Reusable Fashion Cup Carrier For Women
-4%
$3.15
Mix MOQ : 2
 · 
22 views
Ceramic Coffee Cup And Saucer Floral Pattern Underglaze Porcelain Afternoon Tea Coffeeware With Ribbon Gift Box
Ceramic Coffee Cup And Saucer Floral Pattern Underglaze Porcelain Afternoon Tea Coffeeware With Ribbon Gift Box
like
Find Similar
Green ceramic coffee cup set with watercolor floral patterns and gift box with ribbons - 280ml / White Gift Box Set / White
Floral ceramic cup and saucer set in black and green with matching gift box - 280ml / Black Gift Box Set / Black
Ceramic Coffee Cup And Saucer Floral Pattern Underglaze Porcelain Afternoon Tea Coffeeware With Ribbon Gift Box
-4%
$4.60
Mix MOQ : 2
 · 
12 sold recently
Vintage Zinc Alloy Enamel Brooch Coffee Cup UFO Shape Metal Badge Humorous Sarcastic English Letter Lapel Pin Jewelry
Vintage Zinc Alloy Enamel Brooch Coffee Cup UFO Shape Metal Badge Humorous Sarcastic English Letter Lapel Pin Jewelry
like
Find Similar
Cartoon UFO coffee cup enamel pin badge with We Need Coffee text in purple - UFO Sucking Coffee Cup Style(XZ8773)
Enamel coffee brooch pin with yellow 'I just need iced coffee' text on white background - I Just Need Iced Coffee Style(XZ8774)
Pink cartoon coffee cup enamel pin with Life Happens Coffee Helps text in zinc alloy - Life Happens Coffee Helps Style(XZ8775)
Creative white enamel pin with 'BUT FIRST, coffee' text and smooth metal finish - But First Coffee Style(XZ8776)
+6
Vintage Zinc Alloy Enamel Brooch Coffee Cup UFO Shape Metal Badge Humorous Sarcastic English Letter Lapel Pin Jewelry
-8%
$0.63
No MOQ
 · 
14 views
Free Shipping
World Cup Fan Support Accessories Scarf Bucket Hat Sunglasses Hand Clapper Stickers Bracelet National Flag Sports Event Gear
World Cup Fan Support Accessories Scarf Bucket Hat Sunglasses Hand Clapper Stickers Bracelet National Flag Sports Event Gear
like
Find Similar
6-piece USA fan support set with flag scarf, bucket hat, sunglasses, and patriotic accessories - USA Fan Kit
Canada fan cheering set with flag scarf, hat, sunglasses, wristbands and tattoo stickers - Canada Fan Kit
Mexico national football team fan kit with scarf, bucket hat, sunglasses, and flag accessories - Mexico Fan Kit
6-piece Brazil football fan set including scarf, bucket hat, sunglasses, and hand clapper - Brazil Fan Kit
+2
World Cup Fan Support Accessories Scarf Bucket Hat Sunglasses Hand Clapper Stickers Bracelet National Flag Sports Event Gear
$7.02
No MOQ
 · 
39 sold recently
Balloon Sticks And Cups PP Plastic Support Holders For Wedding Birthday Party Decoration Macaron Metallic Colors
Balloon Sticks And Cups PP Plastic Support Holders For Wedding Birthday Party Decoration Macaron Metallic Colors
like
Find Similar
Colorful plastic balloon sticks and heart-shaped cup holders in assorted vibrant colors - 32CM Colorful Stick and Cup Set
Detailed view of 100 white PP plastic balloon sticks with matching cups for party decor - 32CM White Stick and Cup Set
Set of 100 transparent PP plastic balloon sticks with holders for party decorations - 40CM Transparent Stick and Cup Set
Detail of 100 golden plastic balloon sticks and cup holders arranged in a heart shape - 40CM Gold Stick and Cup Set
+21
Balloon Sticks And Cups PP Plastic Support Holders For Wedding Birthday Party Decoration Macaron Metallic Colors
$0.01-0.02
Mix MOQ : 2
 · 
512 sold recently
Insulated 304 Stainless Steel Tumbler Vacuum Cup With Handle Lid And Straw Floral Print Car Travel Mug Portable
Insulated 304 Stainless Steel Tumbler Vacuum Cup With Handle Lid And Straw Floral Print Car Travel Mug Portable
like
Find Similar
304 stainless steel tumbler with purple handle and pink floral 3D print pattern - 14oz / Purple - Floral Pattern 2
304 Stainless steel floral insulated mug with handle and blue rose pattern - 14oz / Light Blue - Floral Pattern 3
Insulated 304 stainless steel tumbler with pink floral pattern and portable handle - 14oz / Pink - Floral Pattern 1
30oz stainless steel insulated tumbler with pink rose floral pattern and handle - 14oz / White - Floral Pattern 4
Insulated 304 Stainless Steel Tumbler Vacuum Cup With Handle Lid And Straw Floral Print Car Travel Mug Portable
$7.20
Mix MOQ : 2
 · 
97 views
Vintage Hand Painted Floral Ceramic Mug Crackle Glaze Coffee Cup Heat Resistant Breakfast Milk Water Drinkware With Handle
Vintage Hand Painted Floral Ceramic Mug Crackle Glaze Coffee Cup Heat Resistant Breakfast Milk Water Drinkware With Handle
like
Find Similar
Minimalist ceramic coffee mug with hand-painted orange floral pattern and beige finish - Red Sun Flower - Single Cup
Ceramic floral coffee mug with hand-painted patterns and orange rim for breakfast - Grey Peony - Single Cup
Minimalist ceramic mug featuring hand-painted pink floral patterns and a vintage crackle glaze - Red Apricot Flower - Single Cup
Ceramic cream coffee mug with sunflower pattern and reddish brown rim detail - Grey Sunflower - Single Cup
Vintage Hand Painted Floral Ceramic Mug Crackle Glaze Coffee Cup Heat Resistant Breakfast Milk Water Drinkware With Handle
$3.75
Mix MOQ : 2
 · 
24 sold recently
Plush Pen Holder Cartoon Animal Desktop Stationery Organizer Cute Soft Pencil Cup Office School Supplies
Plush Pen Holder Cartoon Animal Desktop Stationery Organizer Cute Soft Pencil Cup Office School Supplies
like
Find Similar
Detail of colorful rainbow plush pencil holder featuring an embroidered Shiba Inu face - Rainbow Dog
Detail of plush rainbow unicorn pen holder with soft texture and embroidery - Colorful Unicorn
Close-up of pink plush cat-shaped pen holder with embroidered facial features and soft texture - Pink Sheep
Detail of cute rainbow plush cat pencil holder with pink lace and embroidery - Colorful Dress Cat
+4
Plush Pen Holder Cartoon Animal Desktop Stationery Organizer Cute Soft Pencil Cup Office School Supplies
$1.99
No MOQ
 · 
25 views
Japanese Style Hammer Pattern Glass Tea Cup Irregular Handcrafted Heat Resistant Kung Fu Tea Master Cup Small Glassware
Japanese Style Hammer Pattern Glass Tea Cup Irregular Handcrafted Heat Resistant Kung Fu Tea Master Cup Small Glassware
like
Find Similar
Handmade 50ml hammered glass tea cup with irregular texture and amber tea infusion - Transparent
Frosted Japanese style glass tea cup 50ml with irregular texture and amber tea - Frosted Style
Japanese Style Hammer Pattern Glass Tea Cup Irregular Handcrafted Heat Resistant Kung Fu Tea Master Cup Small Glassware
-5%
$1.92-2.19
No MOQ
 · 
34 sold recently
Women Plus Size Seamless Minimizer Bra Wireless Bralette With Wide Straps Fixed Cup Breathable Mesh Stitching Comfort Lifting Support Underwear
Women Plus Size Seamless Minimizer Bra Wireless Bralette With Wide Straps Fixed Cup Breathable Mesh Stitching Comfort Lifting Support Underwear
like
Find Similar
Seamless plus size bra in beige with wide straps and breathable V-shaped mesh detail - M / Nude
Plus size black seamless wireless bra with V-mesh detail and supportive lift design - M / Classic Black
Seamless coffee brown bra for women with white mesh breathable panel and push-up support - M / Dark Coffee
Lime green seamless vest bra with mesh insert and wide straps for lift - M / Grass Green
+31
NewWomen Plus Size Seamless Minimizer Bra Wireless Bralette With Wide Straps Fixed Cup Breathable Mesh Stitching Comfort Lifting Support Underwear
-5%
$5.42-6.35
No MOQ
 · 
27 views
Marine Animal Floating Liquid Keychain Milk Tea Cup Quicksand Acrylic Bag Pendant With Ribbon Bow For Backpack Decoration
Marine Animal Floating Liquid Keychain Milk Tea Cup Quicksand Acrylic Bag Pendant With Ribbon Bow For Backpack Decoration
like
Find Similar
Detail of pink liquid shaker keychain featuring a beluga whale and golden heart charm - Pink Dolphin
Close-up of purple penguin milk tea keychain with floating glitter and love heart charm - Purple Penguin
Creative dolphin liquid keychain in mini blue drink cup with glitter and love charm - Blue Dolphin
Cute milk tea cup keychain with floating turtle and blue bow on a white plush surface - Green Little Turtle
+2
Marine Animal Floating Liquid Keychain Milk Tea Cup Quicksand Acrylic Bag Pendant With Ribbon Bow For Backpack Decoration
-8%
$1.12
Mix MOQ : 2
 · 
51 sold recently
Construction Vehicle Theme Party Supplies Excavator Disposable Tablecloth Paper Plates Cups Napkins For Kids Birthday Decoration
Construction Vehicle Theme Party Supplies Excavator Disposable Tablecloth Paper Plates Cups Napkins For Kids Birthday Decoration
like
Find Similar
Construction site theme napkins with yellow excavators and STOP sign for birthday party decor - Construction Vehicle Napkins 20Pcs
Three-piece yellow disposable plastic cutlery set with knife fork and spoon for party - Yellow Forks 24Pcs
Yellow and white striped paper straws for party decoration on blue background - Yellow Striped Paper Straws 10Pcs
Detailed construction vehicle patterns on disposable party napkins with yellow excavators - Construction Vehicle Napkins 24Pcs
+9
Construction Vehicle Theme Party Supplies Excavator Disposable Tablecloth Paper Plates Cups Napkins For Kids Birthday Decoration
$0.27-4.03
Mix MOQ : 10
 · 
10 sold recently
DIY Jewelry Charms Pendants Gold Plated Alloy Zircon Rhinestone Cartoon Coffee Cup Wine Bottle Cactus For Necklace Making
DIY Jewelry Charms Pendants Gold Plated Alloy Zircon Rhinestone Cartoon Coffee Cup Wine Bottle Cactus For Necklace Making
like
Find Similar
Gold coffee cup charm pendant for jewelry making with coffee engraving and dimensions - Gold-Coffee Cup coffee
Textured gold rectangle pendant 14x8mm with irregular hammered surface for DIY jewelry - Gold-Hammered Rectangle
Detail of gold rectangular jewelry pendant with white zircon stones and size dimensions - Gold-Zirconia Rectangle
Golden table lamp pendant with red and white stones for DIY jewelry 12x17mm - Gold-Table Lamp
+24
DIY Jewelry Charms Pendants Gold Plated Alloy Zircon Rhinestone Cartoon Coffee Cup Wine Bottle Cactus For Necklace Making
$1.28-5.21
No MOQ
 · 
1 reviews
Free Shipping
Enamel Brooch Black Cat Coffee Cup Book Design Quote Alloy Lapel Pin Cartoon Badge Jewelry Accessory
Enamel Brooch Black Cat Coffee Cup Book Design Quote Alloy Lapel Pin Cartoon Badge Jewelry Accessory
like
Find Similar
Black cat enamel brooch with coffee and books featuring text Life is better with coffee - Black Cat Coffee Books
Enamel Brooch Black Cat Coffee Cup Book Design Quote Alloy Lapel Pin Cartoon Badge Jewelry Accessory
-8%
$0.45
No MOQ
 · 
41 sold recently
Free Shipping
Miniature Coffee Cup Saucer Resin Gold Rim Simulation Food Play DIY Dollhouse Accessories Sweet Desktop Decor Charms
Miniature Coffee Cup Saucer Resin Gold Rim Simulation Food Play DIY Dollhouse Accessories Sweet Desktop Decor Charms
like
Find Similar
Miniature Christmas coffee cup and saucer resin model for dollhouse DIY decor, 14mm size - Gold Edged White Jade Color
Miniature dark green Christmas coffee cup with gold rim for dollhouse DIY decor - Gold Edged Green Agate Color
Miniature dark brown coffee cup and saucer set with gold trim for dollhouses, 14mm size - Gold Edged Ruby Red Color
Miniature Coffee Cup Saucer Resin Gold Rim Simulation Food Play DIY Dollhouse Accessories Sweet Desktop Decor Charms
$0.10
Mix MOQ : 10
 · 
160 sold recently
Free Shipping
Handmade Ceramic Coffee Mug With Spoon Vintage Matte Porcelain Water Cup Retro Style With Brown Spots
Handmade Ceramic Coffee Mug With Spoon Vintage Matte Porcelain Water Cup Retro Style With Brown Spots
like
Find Similar
Ceramic stoneware coffee mug in oatmeal grey with dimensions and 210ml capacity - Yellow Matte Mug 210ML
Handmade ceramic coffee spoon in off-white stoneware with vintage brown speckles - Yellow Matte Spoon 16.3CM
Handcrafted Japanese style ceramic spoon in beige with rustic speckled glaze finish - Yellow Matte Spoon 13.6CM
Handmade Ceramic Coffee Mug With Spoon Vintage Matte Porcelain Water Cup Retro Style With Brown Spots
$2.01-2.85
No MOQ
 · 
82 sold recently
Ceramic Coffee Cup Hand Painted Hydrangea Floral Gold Rim Retro Stoneware Tea Mug Square Petal Design
Ceramic Coffee Cup Hand Painted Hydrangea Floral Gold Rim Retro Stoneware Tea Mug Square Petal Design
like
Find Similar
Blue and white porcelain square coffee cup with gold-painted hydrangea and blue handle - Gold Tracing Hydrangea Cup (Simple Pack)
Vintage ceramic coffee cup with blue floral patterns and gold detailing in a gift box - Gold Tracing Hydrangea Cup (Gift Box)
Blue and white ceramic hydrangea cup with vintage green gift box and silk tassel - 2-Piece Gold Tracing Hydrangea Cup Set (Tassel Gift Box)
Ceramic tea cup set with wooden spoon and tray featuring hand-painted floral patterns - Gold Tracing Hydrangea Cup + Spoon + Tray (Simple Pack)
+1
Ceramic Coffee Cup Hand Painted Hydrangea Floral Gold Rim Retro Stoneware Tea Mug Square Petal Design
-5%
$6.57-21.63
No MOQ
 · 
49 views
Cute Cartoon Cat Enamel Brooches Zinc Alloy Heart Coffee Cup Glass Jar Badges For Backpack Clothes Hat Sweet Decoration
Cute Cartoon Cat Enamel Brooches Zinc Alloy Heart Coffee Cup Glass Jar Badges For Backpack Clothes Hat Sweet Decoration
like
Find Similar
Pink heart enamel pin with two cute cats and butterfly clasp for clothes or bags - Heart Cats
Cute white enamel cat pin with red and pink hearts for Valentine's gift decoration - Cat Holding Hearts
Cute enamel pin featuring white kittens in a jar with Full of Love label and red bow - Cats in Jar
Cute enamel brooch featuring two white cats in a mug with pink hearts and a secure back pin - Cat in Mug
Cute Cartoon Cat Enamel Brooches Zinc Alloy Heart Coffee Cup Glass Jar Badges For Backpack Clothes Hat Sweet Decoration
-9%
$0.39
Mix MOQ : 2
 · 
249 sold recently
Free Shipping
Watercolor Dinosaur Birthday Party Tableware Decorations Paper Plates Cups Napkins Tablecloth Banner For Boys Girls Green
Watercolor Dinosaur Birthday Party Tableware Decorations Paper Plates Cups Napkins Tablecloth Banner For Boys Girls Green
like
Find Similar
Cartoon dinosaur party disposable paper cups with watercolor dino illustrations for kids - Paper Cups 10pcs
Cartoon dinosaur party paper plate with volcano motif and Roar text for kids birthday - 10 x 7 Inch Plates
Detailed view of disposable paper plates with watercolor dinosaur party illustrations - 10 x 9 Inch Plates
Close-up of stacked dinosaur party napkins with watercolor tropical rainforest motifs - 20 Napkins
+6
Watercolor Dinosaur Birthday Party Tableware Decorations Paper Plates Cups Napkins Tablecloth Banner For Boys Girls Green
$0.23-1.10
Mix MOQ : 3
 · 
26 sold recently
Japanese Retro Coarse Pottery Coffee Mug Hand Painted Underglaze Ceramic Cup For Home Office Vintage Stoneware Drinkware
Japanese Retro Coarse Pottery Coffee Mug Hand Painted Underglaze Ceramic Cup For Home Office Vintage Stoneware Drinkware
like
Find Similar
Hand-painted ceramic coffee mug with vertical blue stripes and unglazed base design - Vertical Stripes Mug
Single beige ceramic mug with embossed geometric lines and natural speckled texture - Slanted Stripes Mug
Hand-painted ceramic coffee mug with black triangles on cream finish and clay base - Triangle Pattern Mug
Hand-painted ceramic star and moon coffee mug with rustic stoneware base and 400ml capacity - Small Moon Mug
+1
Japanese Retro Coarse Pottery Coffee Mug Hand Painted Underglaze Ceramic Cup For Home Office Vintage Stoneware Drinkware
$2.65-3.17
No MOQ
 · 
41 sold recently
Plush World Cup Soccer Fan Hat Carnival Costume High Top Striped Football Hat For Party Performance Stadium Cheering Accessory
Plush World Cup Soccer Fan Hat Carnival Costume High Top Striped Football Hat For Party Performance Stadium Cheering Accessory
like
Find Similar
Plush yellow and green striped soccer fan party hat with football details for festivals - Green
Striped football fan party hat with soccer ball decor for carnival and match events - Red
Blue and white striped plush fan hat with two soccer balls for festivals and soccer matches - Blue
Plush World Cup Soccer Fan Hat Carnival Costume High Top Striped Football Hat For Party Performance Stadium Cheering Accessory
-4%
$4.80
No MOQ
 · 
30 sold recently
Cow Print Party Tableware Paper Plates Cups Napkins Banner Tablecloth Straws For Farm Birthday Decorations
Cow Print Party Tableware Paper Plates Cups Napkins Banner Tablecloth Straws For Farm Birthday Decorations
like
Find Similar
Stack of round paper plates with black and white cow print for farm theme party decoration - 9 inch 10pcs
Farm cow print triangle bunting banner with black and white spots for party decor - Pennant Banner 1pc 10 flags
Three pieces of black disposable plastic knives for farm cow theme birthday party - Knives 10pcs
Three black forks set for cow themed farm birthday party decorations and tableware - Forks 10pcs
+7
Cow Print Party Tableware Paper Plates Cups Napkins Banner Tablecloth Straws For Farm Birthday Decorations
-6%
$0.30-1.10
Mix MOQ : 5
 · 
68 sold recently
Racing Checkered Flag Theme Party Tableware Banners Napkins Tablecloth Cups Straws Bags Paper Plastic Kids Birthday Decoration
Racing Checkered Flag Theme Party Tableware Banners Napkins Tablecloth Cups Straws Bags Paper Plastic Kids Birthday Decoration
like
Find Similar
Racing party paper cup featuring classic black and white checkered flag pattern design - Paper Cups 10pcs
Racing party theme black and white checkered pennant banner decoration flags - Triangle Banner 10 Flags
Racing party supplies featuring checkered black and white patterned disposable paper plates - 10 x 7 Inch Plates
Racing party favor bags with black and white checkered pattern and die-cut handles - 10pcs Goodie Bags
+3
Racing Checkered Flag Theme Party Tableware Banners Napkins Tablecloth Cups Straws Bags Paper Plastic Kids Birthday Decoration
$0.25-0.66
No MOQ
 · 
61 sold recently
Crochet Animal Coasters Cute Turtle Sheep Yarn Knit Heat Resistant Cup Mats Home Desktop Decor Gift Accessory
Crochet Animal Coasters Cute Turtle Sheep Yarn Knit Heat Resistant Cup Mats Home Desktop Decor Gift Accessory
like
Find Similar
Detailed top view showing the neat texture of a handmade crochet turtle coaster - Turtle Coaster - Grass Green
Handmade crochet turtle coaster and doll in green and brown yarn for home decor - Turtle Coaster - Cyan Green
Top view of handmade crochet turtle coaster with brown shell and vibrant green limbs - Turtle Coaster - Bud Green
Crochet Animal Coasters Cute Turtle Sheep Yarn Knit Heat Resistant Cup Mats Home Desktop Decor Gift Accessory
$1.90
Mix MOQ : 2
 · 
1 reviews
Free Shipping
Creative Simulation Bear Ice Cream Cup Keychain Cute Food Play Plastic Keychain Bag Pendant For Students Couples Gift
Creative Simulation Bear Ice Cream Cup Keychain Cute Food Play Plastic Keychain Bag Pendant For Students Couples Gift
like
Find Similar
Pink beverage cup keychain with colorful charms and metal ring for bags and keys - Purple
Pink and purple miniature bubble tea keychain with bear gummy and white cream - Pink
Cute orange and pink bear ice cream drink keychain with star charm and metal ring - Orange
Cute green and yellow gradient ice cream bear keychain with white cream topper - Green
Creative Simulation Bear Ice Cream Cup Keychain Cute Food Play Plastic Keychain Bag Pendant For Students Couples Gift
-8%
$0.79
Mix MOQ : 2
 · 
29 sold recently
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access