Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
World Cup 2026 Fan Cheering Kit With National Flag Scarf Wristband Face Paint Hand Clapper And Glasses For Football Match Support
World Cup 2026 Fan Cheering Kit With National Flag Scarf Wristband Face Paint Hand Clapper And Glasses For Football Match Support
like
Find Similar
Complete USA fan set with flag, USA wristband, scarf, sunglasses, and face paint stick - USA Fan Kit
Canada World Cup fans set with flag, scarf, sunglasses and cheering props on white background - Canada Fan Kit
6-piece Mexico football fan cheer set including flag, scarf, sunglasses and accessories - Mexico Fan Kit
Argentina football fan kit with flag, scarf, sunglasses and cheering props for world cup - Argentina Fan Kit
+10
World Cup 2026 Fan Cheering Kit With National Flag Scarf Wristband Face Paint Hand Clapper And Glasses For Football Match Support
$6.54
Mix MOQ : 2
 · 
90 sold recently
Cute Bubble Tea Plush Keychain Cartoon Fruit Milk Tea Cup Stuffed Doll Bag Pendant Toy For Girls Gift Soft Decorative Ornament
Cute Bubble Tea Plush Keychain Cartoon Fruit Milk Tea Cup Stuffed Doll Bag Pendant Toy For Girls Gift Soft Decorative Ornament
like
Find Similar
Close-up of strawberry milk tea plush keychain featuring embroidered facial details - Strawberry Milk Tea - Standard Chain / Pink
Detail of a soft boba tea plush keychain featuring a cute smiley face and metallic ring - Pearl Milk Tea - Standard Chain / Brown
Close-up of a small plush milk tea keychain with pineapple embroidery and straw - Pineapple Milk Tea - Standard Chain / Yellow
Detail of blue plush milk tea cup keychain with cute embroidery and metal ring - Apple Milk Tea - Standard Chain / Blue
+4
Cute Bubble Tea Plush Keychain Cartoon Fruit Milk Tea Cup Stuffed Doll Bag Pendant Toy For Girls Gift Soft Decorative Ornament
$0.81-1.01
No MOQ
 · 
136 sold recently
Geometric Stainless Steel Stud Earrings Heart Paw Print Ice Cream Coffee Cup Atom Star Moon Summer Minimalist For Women
Geometric Stainless Steel Stud Earrings Heart Paw Print Ice Cream Coffee Cup Atom Star Moon Summer Minimalist For Women
like
Find Similar
Detail view of silver star and moon stud earrings in polished stainless steel - Moon & Star / Steel
Minimalist silver cat paw earrings with a hollow round cutout design for women - Paw / Steel
Cute silver heart paw print stud earrings for women with 11mm by 12mm dimensions - Heart Paw / Steel
Silver rocket stud earrings with heart cutout design measuring 12mm by 5mm - Rocket / Steel
+40
Geometric Stainless Steel Stud Earrings Heart Paw Print Ice Cream Coffee Cup Atom Star Moon Summer Minimalist For Women
$0.26-0.42
No MOQ
 · 
131 sold recently
Free Shipping
Yfjy Japanese Retro Jujube Wood Water Cup Beer Cup Tea Cup Mug Solid Wood Retro Home Wooden Cup
Yfjy Japanese Retro Jujube Wood Water Cup Beer Cup Tea Cup Mug Solid Wood Retro Home Wooden Cup
like
Find Similar
Handcrafted jujube wood bowl with clear grain and vintage lacquer finish, 15x7.5cm size - Reverse-rimmed Bowl 15*7.5cm (minimum Order Of 600 Pieces)
Handcrafted barrel-shaped wooden beer mug in jujube wood with dark lacquer finish - 300ml Beer Glass
Handcrafted jujube wood tea cup with handle in dark lacquered finish, 12x8.8x10cm - 250ml Teacup
Handcrafted jujube wood beer mug with handle and curved rim in dark lacquer finish - 150ml Cup With Handle And Reverse Rim
+1
Yfjy Japanese Retro Jujube Wood Water Cup Beer Cup Tea Cup Mug Solid Wood Retro Home Wooden Cup
$1.73-5.07
No MOQ
 · 
148 sold recently
Natural Crystal Stone Aromatherapy Diffuser Essential Oil Cinnamon Stick Dried Flower Glass Cup Home Fragrance Ornament
Natural Crystal Stone Aromatherapy Diffuser Essential Oil Cinnamon Stick Dried Flower Glass Cup Home Fragrance Ornament
like
Find Similar
Aromatherapy crystal oil diffuser set with Himalayan salt rocks and cinnamon sticks in glass - Orange Cup + Pacific Sea Breeze Oil 10ml
Green crystal oil diffuser in glass jar with cinnamon sticks and plant branches - Green Cup + White Peach Oolong Oil 10ml
Gray-blue glass diffuser set with black and clear crystals, cinnamon and green foliage - Black Cup + Cold Water Scent Oil 10ml
Pink crystal stone oil diffuser in glass jar with cinnamon sticks and dried plants - Pink Cup + Pure Gardenia Oil 10ml
+5
Natural Crystal Stone Aromatherapy Diffuser Essential Oil Cinnamon Stick Dried Flower Glass Cup Home Fragrance Ornament
-5%
$1.59-3.50
No MOQ
 · 
42 sold recently
Cute Animal Bubble Tea Cup Enamel Pins Zinc Alloy Cartoon Boba Axolotl Capybara Brooches For Clothes Bags
Cute Animal Bubble Tea Cup Enamel Pins Zinc Alloy Cartoon Boba Axolotl Capybara Brooches For Clothes Bags
like
Find Similar
Cute pink axolotl bubble tea enamel pin made of zinc alloy with glossy finish - Pink Axolotl Style (QHXZ296)
Cute enamel fox bubble tea brooch accessory with orange and beige finish on white background - Orange Fox Style (QHXZ297)
Cute koala bubble tea enamel pin with green matcha liquid and gray metal details - Gray Koala Style (QHXZ298)
Creative enamel pin featuring a cute hamster and bubble tea design in pink and orange - Yellow Hamster Style (QHXZ299)
+2
Cute Animal Bubble Tea Cup Enamel Pins Zinc Alloy Cartoon Boba Axolotl Capybara Brooches For Clothes Bags
-7%
$0.58
No MOQ
 · 
87 sold recently
Free Shipping
Women's Plus Size Front Closure Wireless Bra Push Up Seamless Modal Lingerie Breathable Large Size Thin Molded Cup Bra
Women's Plus Size Front Closure Wireless Bra Push Up Seamless Modal Lingerie Breathable Large Size Thin Molded Cup Bra
like
Find Similar
Black front-closure wireless bra with wide shoulder straps and smooth seamless fabric - 36/80C / Black
Front closure wire-free push up bra in beige with wide straps and seamless finish - 36/80C / Nude
Deep brown wireless front-closure bra with smooth seamless cups and wide straps - 36/80C / Red Brown
+45
Women's Plus Size Front Closure Wireless Bra Push Up Seamless Modal Lingerie Breathable Large Size Thin Molded Cup Bra
$4.32
Mix MOQ : 2
 · 
47 views
Miniature Tea Pot Cups Plates Ceramic Floral Pattern Gold Trim Dollhouse Kitchen Accessories Kids Pretend Play Toys
Miniature Tea Pot Cups Plates Ceramic Floral Pattern Gold Trim Dollhouse Kitchen Accessories Kids Pretend Play Toys
like
Find Similar
Miniature 15-piece ceramic tea set with blue floral patterns and gold trim for dollhouses - Traditional Blue Floral
Miniature 15-piece ceramic tea set for dollhouse with pink roses and gold trim - Pink Rose
15-piece miniature ceramic tea set with blue floral patterns for dollhouse decor - Dark Blue Floral
Miniature Tea Pot Cups Plates Ceramic Floral Pattern Gold Trim Dollhouse Kitchen Accessories Kids Pretend Play Toys
$3.11
Mix MOQ : 5
 · 
46 sold recently
Smokeless Paraffin Wax Tea Light Candles Aluminum Cup Colorful Heart Round For Wedding Proposal Party Home Decor
Smokeless Paraffin Wax Tea Light Candles Aluminum Cup Colorful Heart Round For Wedding Proposal Party Home Decor
like
Find Similar
Smokeless mint green tealight candle set in aluminum cups, pack of 25 pieces - 2 Hours 50 Pieces Round - Green
Set of 25 red tea light candles in aluminum cups with clean cotton wicks - 2 Hours 100 Pieces Round - Large Red
Pink smokeless tea light candles in aluminum cups set of 25 in a craft paper box - 2 Hours 100 Pieces Round - Pink
Set of 25 purple smokeless tea lights in a box for romantic proposal decor - 4 Hours 50 Pieces Round - Purple
+18
Smokeless Paraffin Wax Tea Light Candles Aluminum Cup Colorful Heart Round For Wedding Proposal Party Home Decor
-5%
$1.42-5.45
No MOQ
 · 
58 sold recently
Smart Coffee Mug 316 Stainless Steel Vacuum Insulated Cup With Temperature Display Portable Strap Travel Car Office
Smart Coffee Mug 316 Stainless Steel Vacuum Insulated Cup With Temperature Display Portable Strap Travel Car Office
like
Find Similar
Sleek silver stainless steel coffee cup with beige lid and sunshine lanyard detail - Plain Style / Silver - White Lid
Smart 316 stainless steel coffee mug in cream white with digital temperature display - Plain Style / White - Blue Lid
Insulated smart coffee cup in cream white with digital temperature display and carrying strap - Plain Style / White - Brown Lid
White smart thermos with blue lid, digital temperature display, and coffee lanyard strap - Smart Model / White - Blue Lid
+8
Smart Coffee Mug 316 Stainless Steel Vacuum Insulated Cup With Temperature Display Portable Strap Travel Car Office
-5%
$2.46-3.01
No MOQ
 · 
63 sold recently
World Cup Fan Cheering Supplies National Flag Glasses Scarf Bracelet Clapper Face Paint Soccer Party Props For Sports Event
World Cup Fan Cheering Supplies National Flag Glasses Scarf Bracelet Clapper Face Paint Soccer Party Props For Sports Event
like
Find Similar
Complete Mexico football fan cheer kit with flag, scarf, glasses, and face paint set - Mexico
Full 2026 World Cup USA themed soccer fan cheer set including flag and accessories - United States
Spain football fan cheering set with flag, sunglasses, clapper, and face paint - Spain Style
Complete Argentina soccer fan cheering set featuring flag sunglasses and face paint - Argentina
+8
World Cup Fan Cheering Supplies National Flag Glasses Scarf Bracelet Clapper Face Paint Soccer Party Props For Sports Event
$6.80
Mix MOQ : 50
 · 
110 sold recently
Christmas Ceramic Mug Santa Claus Cartoon Red Milk Coffee Cup Holiday Gift Merry Christmas Pattern Novelty Drinkware
Christmas Ceramic Mug Santa Claus Cartoon Red Milk Coffee Cup Holiday Gift Merry Christmas Pattern Novelty Drinkware
like
Find Similar
Red ceramic Christmas mug with Santa Claus pattern and Merry Christmas text - B Sunglasses
Detail of red Christmas ceramic mugs with Santa Claus and tree patterns on lace cloth - C Driving
Red Christmas ceramic mug with Santa Claus and Merry Christmas print on lace background - D Carrying Gifts
Christmas Ceramic Mug Santa Claus Cartoon Red Milk Coffee Cup Holiday Gift Merry Christmas Pattern Novelty Drinkware
$3.11
No MOQ
 · 
625 sold recently
Food Grade Clear Grain Storage Box With Measuring Cup Lid And Handle Moisture Proof Sealed Rice Container For Kitchen Cereal Flour
Food Grade Clear Grain Storage Box With Measuring Cup Lid And Handle Moisture Proof Sealed Rice Container For Kitchen Cereal Flour
like
Find Similar
2.5L food-grade airtight storage container with white measuring lid and handle - White / Medium
Creamy white 2.5L airtight grain storage container with scale measuring cup lid - Creamy Yellow / Medium
1.75L airtight grain storage box in creamy white with measuring cup and handle - Creamy Yellow / Small
3L airtight cereal container with cream white handle lid and measuring cup for storage - Creamy Yellow / Large
Food Grade Clear Grain Storage Box With Measuring Cup Lid And Handle Moisture Proof Sealed Rice Container For Kitchen Cereal Flour
-7%
$1.31-1.73
No MOQ
 · 
194 sold recently
Electric Coffee Mug Warmer Smart Thermostatic Coaster Digital Display Ceramic Cup Heating Pad USB Desktop Office Home
Electric Coffee Mug Warmer Smart Thermostatic Coaster Digital Display Ceramic Cup Heating Pad USB Desktop Office Home
like
Find Similar
White oval thermostatic coaster with USB power supply and touch control button - Single Coaster (Gravity Sensing/USB) / White
Pink electric cup warmer with digital temperature display and tempered glass panel - Single Coaster (Digital Display/USB) / Pink
Navy blue electric cup warmer with digital temperature display and glass heating plate - Single Coaster (Digital Display/USB) / Dark Green
Black circular electric cup warmer with digital temperature display and touch control - Round Coaster (Digital Display/USB) / Black
+18
Electric Coffee Mug Warmer Smart Thermostatic Coaster Digital Display Ceramic Cup Heating Pad USB Desktop Office Home
$1.70-6.34
No MOQ
 · 
38 sold recently
Birthday Party Tableware And Decorations Banner Plates Cups Napkins Tablecloth Disposable Black Gold Pink Adult Celebration
Birthday Party Tableware And Decorations Banner Plates Cups Napkins Tablecloth Disposable Black Gold Pink Adult Celebration
like
Find Similar
Elegant black and gold Happy Birthday paper plate with stars and glitter dots design - Black Gold Small Plate
Black and gold Happy Birthday disposable paper cups with star and dot patterns for parties - Black Gold Paper Cup
Elegant black plastic dinner knife for birthday party table decoration and cutlery sets - Black Plastic Knife
Elegant single black plastic fork for birthday party decoration in black and gold theme - Black Plastic Fork
+13
Birthday Party Tableware And Decorations Banner Plates Cups Napkins Tablecloth Disposable Black Gold Pink Adult Celebration
$0.69-10.95
No MOQ
 · 
271 sold recently
French Retro Ins Style Ceramic Coffee Cup Mug Irregular Shape Twisted Handle Hand Painted Flower Heart Polka Dot For Cafe
French Retro Ins Style Ceramic Coffee Cup Mug Irregular Shape Twisted Handle Hand Painted Flower Heart Polka Dot For Cafe
like
Find Similar
Irregular white ceramic coffee cup with yellow flower and blue leaf pattern - Yellow Small Flowers Cup & Saucer Set / Cup + Saucer Set
Handcrafted ceramic coffee cup with blue dots and vintage handle on dark wood table - Irregular Polka Dots Single Mug / Single Cup
Handcrafted white ceramic coffee mug with pink floral pattern and wavy handle - Pink Large Petals Single Mug / Single Cup
Irregular handmade ceramic coffee mug with pink heart pattern and wavy texture - Hearts and Dots Single Mug / Single Cup
+39
French Retro Ins Style Ceramic Coffee Cup Mug Irregular Shape Twisted Handle Hand Painted Flower Heart Polka Dot For Cafe
$5.48-7.49
No MOQ
 · 
103 views
Crystal Nail Art Cup With Lid Glass Liquid Container For Acrylic Powder Brush Cleaning Decorative Jewelry Storage Bowl
Crystal Nail Art Cup With Lid Glass Liquid Container For Acrylic Powder Brush Cleaning Decorative Jewelry Storage Bowl
like
Find Similar
Heart-shaped clear crystal nail liquid cup with matching glass lid weighing about 320g - Transparent Heart Shaped Crystal Cup
Heart-shaped gradient glass nail crystal cup with lid showing weight of about 324g - AB Color Heart Shaped Crystal Cup
Transparent crystal nail art glass container with hexagonal base and faceted lid, 5.5cm size - Transparent Diamond Crystal Cup
Octagonal purple crystal nail art dish with diamond-cut lid and glass base - Purple Diamond Crystal Cup
+28
Crystal Nail Art Cup With Lid Glass Liquid Container For Acrylic Powder Brush Cleaning Decorative Jewelry Storage Bowl
-5%
$2.14-7.64
Mix MOQ : 2
 · 
10 sold recently
Racing Theme Birthday Party Supplies Disposable Paper Plates Cups Napkins Banner Tablecloth Sports Style Decoration
Racing Theme Birthday Party Supplies Disposable Paper Plates Cups Napkins Banner Tablecloth Sports Style Decoration
like
Find Similar
7-inch racing theme party paper plates featuring blue car and checkered flag pattern - 7 Inch Plate 10pcs
Racing party 9 inch disposable paper plate with red F1 car and checkered flag - 9 Inch Plate 10pcs
Racing themed disposable paper cups featuring blue car and checkered flag pattern, 10-pack set - Paper Cups 10pcs
Racing party napkins with F1 car design and checkered flags in 13x13 inch size - 20 Napkins
+6
Racing Theme Birthday Party Supplies Disposable Paper Plates Cups Napkins Banner Tablecloth Sports Style Decoration
-5%
$0.44-0.99
No MOQ
 · 
143 sold recently
Galaxy Starry Sky Theme Party Supplies Disposable Tableware Tablecloth Paper Plates Cups Napkins Banner Space Decoration For Kids Adults
Galaxy Starry Sky Theme Party Supplies Disposable Tableware Tablecloth Paper Plates Cups Napkins Banner Space Decoration For Kids Adults
like
Find Similar
Space-themed black plastic cutlery set with textured handles for birthday party dining - Black Fork
Disposable starry sky PE tablecloth variant featuring purple galaxy and white star patterns - Purple Small Plate
Deep blue starry night sky PE tablecloth set for kids galaxy space party decoration - Starry Sky Napkin
Starry sky theme disposable PE tablecloth for space party decor 54x108 inches size - Starry Sky Tablecloth
+19
Galaxy Starry Sky Theme Party Supplies Disposable Tableware Tablecloth Paper Plates Cups Napkins Banner Space Decoration For Kids Adults
$0.27-3.46
Mix MOQ : 10
 · 
15 sold recently
Cute Plush Milk Tea Cup Keychain Cartoon Soft Stuffed Doll Bag Pendant Hanging Strap For Women Girls Backpack Accessory Gift
Cute Plush Milk Tea Cup Keychain Cartoon Soft Stuffed Doll Bag Pendant Hanging Strap For Women Girls Backpack Accessory Gift
like
Find Similar
Cute milk tea plush keychain with a brown cup design and golden metal ring - Round Eyes / Milk Tea Brown / 10cm
Plush bubble tea keychain in beige with red strap and golden metal ring detail - Triangle Eyes / Milk Tea Brown / 10cm
White bubble tea plush keychain with cute smile and Lucky Day tag on wooden desk - Round Eyes / Milk Tea White / 10cm
Cute white milk tea plush keychain with red lucky day strap and boba embroidery - Triangle Eyes / Milk Tea White / 10cm
+8
Cute Plush Milk Tea Cup Keychain Cartoon Soft Stuffed Doll Bag Pendant Hanging Strap For Women Girls Backpack Accessory Gift
-4%
$1.81
No MOQ
 · 
181 sold recently
Measuring Cups And Spoons Stainless Steel Acacia Wood Handle Engraved Scale Kitchen Baking Tools Professional
Measuring Cups And Spoons Stainless Steel Acacia Wood Handle Engraved Scale Kitchen Baking Tools Professional
like
Find Similar
4-piece stainless steel measuring cup set with acacia wood handles on white background - Silver Measuring Cup Set of 4
4-piece stainless steel measuring spoon set with acacia wood handles on white backdrop - Silver Measuring Spoon Set of 4
4-piece gold stainless steel measuring cup set with acacia wood handles and scale marks - Gold Measuring Cup Set of 4
4-piece golden stainless steel measuring spoon set with acacia wood handles on white background - Gold Measuring Spoon Set of 4
+5
Measuring Cups And Spoons Stainless Steel Acacia Wood Handle Engraved Scale Kitchen Baking Tools Professional
$2.82-8.88
Mix MOQ : 2
 · 
112 sold recently
Wheat Straw Dinnerware Collection Bowls Plates Cups Utensils Cutlery Portable Box Reusable Eco Friendly Lightweight
Wheat Straw Dinnerware Collection Bowls Plates Cups Utensils Cutlery Portable Box Reusable Eco Friendly Lightweight
like
Find Similar
Colorful wheat straw dinnerware set with bowls, plates, cups and portable cutlery kits - 52-piece Set / Mixed Colors Round Plate 52pcs Set
Colorful wheat straw dinnerware set with cups, bowls, plates, and portable cutlery kits - 52-piece Set / Mixed Colors Square Plate 52pcs Set
Eco-friendly green wheat straw tableware set with plate bowl cup and portable cutlery kit - 9-Piece Set / Green 9pcs Set
Eco-friendly orange wheat straw tableware set including bowl, plate, cup, and cutlery - 9-Piece Set / Orange 9pcs Set
+8
Wheat Straw Dinnerware Collection Bowls Plates Cups Utensils Cutlery Portable Box Reusable Eco Friendly Lightweight
-5%
$2.19-10.62
No MOQ
 · 
70 sold recently
Pencil Cup Pen Holder Desktop Organizer Plastic Dual Compartment For Stationery Makeup Brush Nordic Style Cute 3D Patch
Pencil Cup Pen Holder Desktop Organizer Plastic Dual Compartment For Stationery Makeup Brush Nordic Style Cute 3D Patch
like
Find Similar
White desk organizer with orange fruit decor, Nordic style pen holder for cute storage - Orange
Nordic white desk organizer with cute pink pig design and grey dual compartments - Pig
White cartoon pen holder with gray double compartment lid for desk organization - Small Wings
Dark blue Nordic desk organizer with rainbow motif for pens and makeup brushes - Blue Rainbow
+8
Pencil Cup Pen Holder Desktop Organizer Plastic Dual Compartment For Stationery Makeup Brush Nordic Style Cute 3D Patch
$0.46
No MOQ
 · 
246 sold recently
Luminous Simulation Fruit Lemon Slice Goblet Keychain Colorful Straw Drink Cup Resin Bag Pendant Creative Decorative Jewelry Gift
Luminous Simulation Fruit Lemon Slice Goblet Keychain Colorful Straw Drink Cup Resin Bag Pendant Creative Decorative Jewelry Gift
like
Find Similar
Close-up of a simulation lemon drink goblet keychain with a yellow striped straw - Yellow
Detailed view of luminous simulated orange beverage goblet keychain with striped straw - Red
Luminous green beverage goblet keychain with simulation lemon slices and striped straw detail - Green
Detailed macro view of a miniature blue cocktail drink keychain with lemon slices and straw. - Blue
+1
Luminous Simulation Fruit Lemon Slice Goblet Keychain Colorful Straw Drink Cup Resin Bag Pendant Creative Decorative Jewelry Gift
$0.43
No MOQ
 · 
254 sold recently
Simulation Sundae Ice Cream Cup Keychain Resin Plastic Miniature Food Play Bag Pendant Cute Drink Bottle Decoration
Simulation Sundae Ice Cream Cup Keychain Resin Plastic Miniature Food Play Bag Pendant Cute Drink Bottle Decoration
like
Find Similar
Miniature purple sundae cup keychain dimensions showing 5.8cm height and 33.4g weight - Sundae Purple
Miniature blue sundae cup keychain with size dimensions 5.8cm height and 3.2cm width - Sundae Blue
Detailed size specifications for the miniature ice cream sundae keychain accessory - Sundae Brown
Miniature orange sundae keychain detail showing dimensions of 5.8cm height and 33.4g weight - Sundae Orange
+2
Simulation Sundae Ice Cream Cup Keychain Resin Plastic Miniature Food Play Bag Pendant Cute Drink Bottle Decoration
-13%
$1.24
Mix MOQ : 2
 · 
129 sold recently
Cartoon Enamel Brooch Pin Alloy Flamingo Ice Cream Sunglasses Coffee Cup Tropical Summer Style Accessories For Backpacks Hat
Cartoon Enamel Brooch Pin Alloy Flamingo Ice Cream Sunglasses Coffee Cup Tropical Summer Style Accessories For Backpacks Hat
like
Find Similar
Detail of a creative enamel sunglasses brooch with colorful floral patterns on a gold metal frame - Heart Sunglasses Pattern
Pink popsicle enamel pin with colorful sprinkles and golden metal edges for clothing - Pink Sprinkle Popsicle
Detail of coffee cup enamel pin featuring vibrant white and orange metal plating - Takeaway Coffee Cup
Cartoon popsicle enamel pin with red white and green colors in golden metal base - Italy Color Popsicle
+4
Cartoon Enamel Brooch Pin Alloy Flamingo Ice Cream Sunglasses Coffee Cup Tropical Summer Style Accessories For Backpacks Hat
-8%
$0.42
No MOQ
 · 
461 sold recently
Free Shipping
Astronaut Milk Tea Cup Liquid Quicksand Keychain Acrylic Floating Glitter Bag Charm Accessories Cute Cartoon Gift
Astronaut Milk Tea Cup Liquid Quicksand Keychain Acrylic Floating Glitter Bag Charm Accessories Cute Cartoon Gift
like
Find Similar
Astronaut liquid quicksand keychain with blue-pink gradient and glitter stars - Astronaut Blue
Yellow astronaut keychain with liquid glitter flow and yellow silicone hand strap - Astronaut Lemon Yellow
Pink liquid glitter keychain with bubble tea bottle charm and astronaut astronaut motif - Milk Tea Cup Red
Detail of astronaut liquid quicksand keychain with blue gradient strap and gold bell - Astronaut Green
+34
Astronaut Milk Tea Cup Liquid Quicksand Keychain Acrylic Floating Glitter Bag Charm Accessories Cute Cartoon Gift
-16%
$0.70-0.79
No MOQ
 · 
36 views
Tulip Cupcake Liners Greaseproof Paper Baking Cups Flame Muffin Liners For Cupcakes Desserts Heat Resistant Baking Supplies
Tulip Cupcake Liners Greaseproof Paper Baking Cups Flame Muffin Liners For Cupcakes Desserts Heat Resistant Baking Supplies
like
Find Similar
High-quality white tulip greaseproof cupcake liners for muffin baking paper cups - Pack of 50 / White
Stack of brown tulip-shaped greaseproof paper liners for muffins and baking cupcakes - Pack of 50 / Brown
Stack of brown tulip cupcake liners made of natural greaseproof baking paper material - Pack of 50 / Kraft Color
White tulip cupcake liner with vintage newspaper print for baking muffins and cakes - Pack of 50 / White with Letter Print
+5
Tulip Cupcake Liners Greaseproof Paper Baking Cups Flame Muffin Liners For Cupcakes Desserts Heat Resistant Baking Supplies
$0.86
No MOQ
 · 
56 sold recently
Mid-Century Hand-Painted Crystal Glass Wine Glass Vintage Floral Pattern Stemware For Red Wine Home Decor Drinking Cup Gift
Mid-Century Hand-Painted Crystal Glass Wine Glass Vintage Floral Pattern Stemware For Red Wine Home Decor Drinking Cup Gift
like
Find Similar
Vintage style hand-painted wine glass with pink floral pattern and slender stem - Pink Floral
Vintage hand-painted wine glass with purple chrysanthemum patterns, 650ml capacity - Purple Chrysanthemum Style
Vintage hand-painted wine glass featuring green lotus pattern and pink petals 650ml - Green Lotus Style
Vintage hand-painted wine glass with yellow lotus pattern and a yellow stem, 650ml - Yellow Lotus Style
Mid-Century Hand-Painted Crystal Glass Wine Glass Vintage Floral Pattern Stemware For Red Wine Home Decor Drinking Cup Gift
-4%
$4.69
No MOQ
 · 
75 sold recently
Ceramic Coffee Cup And Saucer With Gift Box Floral Iris Pattern Nordic Vintage Style Porcelain Drinkware For Home Office
Ceramic Coffee Cup And Saucer With Gift Box Floral Iris Pattern Nordic Vintage Style Porcelain Drinkware For Home Office
like
Find Similar
Black ceramic floral coffee cup and saucer set with elegant English text gift box - Black Gift Box
Ceramic coffee cup and saucer set with floral patterns and matching gift box packaging - White Gift Box Set
Ceramic Coffee Cup And Saucer With Gift Box Floral Iris Pattern Nordic Vintage Style Porcelain Drinkware For Home Office
-4%
$4.60
Mix MOQ : 2
 · 
20 sold recently
Plastic Grain Rice Storage Container With Measuring Cup Lid Handle Moisture Proof Transparent Kitchen Organizer
Plastic Grain Rice Storage Container With Measuring Cup Lid Handle Moisture Proof Transparent Kitchen Organizer
like
Find Similar
1800ml clear plastic food storage container for rice and grains with white lid and measuring cup - With Measuring Cup/Handle / 2000ml-1 Pack
Set of 2 1800ml airtight food containers with ergonomic handles and measuring scales - With Measuring Cup/Handle / 2000ml-2 Pack
Set of 3 transparent kitchen cereal dispensers with grey airtight lids and measuring cups - With Measuring Cup/Handle / 2000ml-3 Pack
Airtight cereal storage container with measurement marks and handle in cream white - With Measuring Cup/Handle / 2800ml-1 Pack
+2
Plastic Grain Rice Storage Container With Measuring Cup Lid Handle Moisture Proof Transparent Kitchen Organizer
-5%
$6.57-16.97
No MOQ
 · 
59 views
Miniature Water Cup Keychain With White Daisy Flower PVC Soft Plastic Tumbler Shape Bag Pendant For Women Girls Cute Accessories
Miniature Water Cup Keychain With White Daisy Flower PVC Soft Plastic Tumbler Shape Bag Pendant For Women Girls Cute Accessories
like
Find Similar
Mint green soft silicone cup keychain featuring white daisy pattern and metal bead chain - Keychain / Mint Green Flower Cup with Bead Chain
Pink silicone cup straw cover pendant with white daisy flower and silver ball chain - Keychain / Bright Pink Flower Cup with Bead Chain
Pink silicone cup keychain featuring daisy patterns with a silver metal ball chain - Keychain / Light Pink Flower Cup with Bead Chain
Mini yellow PVC cup keychain featuring a white daisy flower and silver bead chain link - Keychain / Beige Flower Cup with Bead Chain
+20
Miniature Water Cup Keychain With White Daisy Flower PVC Soft Plastic Tumbler Shape Bag Pendant For Women Girls Cute Accessories
-10%
$0.26-0.34
Mix MOQ : 2
 · 
129 sold recently
Ceramic Coffee Cup And Saucer Set Petal Shaped Color Glazed Flower Design French Vintage Aesthetic Tea Mug For Home
Ceramic Coffee Cup And Saucer Set Petal Shaped Color Glazed Flower Design French Vintage Aesthetic Tea Mug For Home
like
Find Similar
Elegant pink petal ceramic coffee cup and saucer set with a smooth glazed finish - 220ml / Pink Cup and Saucer
Ceramic Coffee Cup And Saucer Set Petal Shaped Color Glazed Flower Design French Vintage Aesthetic Tea Mug For Home
$4.22
No MOQ
 · 
160 sold recently
Handmade Wood Resin Coaster With Real Dried Flower Heat Resistant Cup Mat Decorative Desktop Tray Nail Art Palette
Handmade Wood Resin Coaster With Real Dried Flower Heat Resistant Cup Mat Decorative Desktop Tray Nail Art Palette
like
Find Similar
Detailed view of an oval wood resin coaster with embedded real white daisy flowers - Oval-17.5cm
Handmade wooden coaster with real dried flowers and clear resin inlay detail - Round No.1-15.5cm
Handheld wooden coaster with real dried flowers and resin coating in a garden setting - Round No.2-13cm
Macro detail of a resin coaster with real dried flowers and a natural wooden frame - Round No.3-9.5cm
+3
Handmade Wood Resin Coaster With Real Dried Flower Heat Resistant Cup Mat Decorative Desktop Tray Nail Art Palette
$3.75-4.32
No MOQ
 · 
54 views
Free Shipping
Enamel Flower Cup Handle Charm Gold Alloy Chain With Lobster Clasp Decorative Water Bottle Pendant For Insulated Tumblers
Enamel Flower Cup Handle Charm Gold Alloy Chain With Lobster Clasp Decorative Water Bottle Pendant For Insulated Tumblers
like
Find Similar
Detail of a pink flower charm with gold metal chain attached to a white tumbler handle - Pink
Golden handle chain accessory with white enamel flowers for insulated tumblers - White
Gold chain tumbler accessory with blue flower charm on a white ceramic mug handle - Blue
Enamel Flower Cup Handle Charm Gold Alloy Chain With Lobster Clasp Decorative Water Bottle Pendant For Insulated Tumblers
$0.35-0.86
No MOQ
 · 
80 sold recently
Gold Polka Dot Disposable Tableware Paper Plates Cups Napkins Straws Knives Forks Spoons For Birthday Party Wedding
Gold Polka Dot Disposable Tableware Paper Plates Cups Napkins Straws Knives Forks Spoons For Birthday Party Wedding
like
Find Similar
Pack of 25 white paper straws with gold foil polka dots for party decoration - Straw
White rectangular tablecloth with elegant gold foil polka dots for birthday party decorations - Tablecloth
Square white party napkins with elegant gold foil polka dots for birthdays - Napkins
Set of 25 disposable golden plastic knives with elegant scalloped handle and serrated edge - Gold Disposable Knives
+14
Gold Polka Dot Disposable Tableware Paper Plates Cups Napkins Straws Knives Forks Spoons For Birthday Party Wedding
$0.25-2.29
Mix MOQ : 5
 · 
184 sold recently
Pink Butterfly Party Supplies Disposable Paper Plates Cups Napkins Tablecloth Banner Birthday Decorations For Girls Floral Theme
Pink Butterfly Party Supplies Disposable Paper Plates Cups Napkins Tablecloth Banner Birthday Decorations For Girls Floral Theme
like
Find Similar
Detailed view of 18cm pink butterfly and flower party paper plates, set of 10 pieces - 7 Inch Plates 10PCS
Top view of pink floral and butterfly print 9-inch disposable party paper plates - 9 Inch Plates 10PCS
Set of 20 floral pink butterfly paper napkins 17cm for birthday party table decoration - Napkins 20PCS
Detailed dimensions of butterfly floral paper cup with height and diameter specs - Paper Cups 10pcs
+11
Pink Butterfly Party Supplies Disposable Paper Plates Cups Napkins Tablecloth Banner Birthday Decorations For Girls Floral Theme
-5%
$0.41-1.51
No MOQ
 · 
162 sold recently
Ceramic Coffee Cup And Saucer Underglaze Hand-Painted Irregular Hand-Pinched Cute Floral Cloud Pattern Home Office
Ceramic Coffee Cup And Saucer Underglaze Hand-Painted Irregular Hand-Pinched Cute Floral Cloud Pattern Home Office
like
Find Similar
White ceramic mug with pink heart patterns and unique heart-shaped rim and handle - Dark Red Heart Cup
Irregular ceramic coffee mug with hand-painted pink tulip flowers and a green leaf pattern - Flower Cup
Irregular handmade blue ceramic coffee mug with 3D white cloud patterns and chunky handle - Light Blue Cup
Irregular handmade ceramic coffee mug with green grid and orange heart patterns - Heart Cup
+63
Ceramic Coffee Cup And Saucer Underglaze Hand-Painted Irregular Hand-Pinched Cute Floral Cloud Pattern Home Office
$5.04-7.64
No MOQ
 · 
85 views
Ceramic Coffee Mug Matte Finish Nordic Style Round Body With Thick Chunky Handle Heat Resistant Minimalist Breakfast Latte Cup
Ceramic Coffee Mug Matte Finish Nordic Style Round Body With Thick Chunky Handle Heat Resistant Minimalist Breakfast Latte Cup
like
Find Similar
Minimalist matte ceramic coffee mug in cream white with a chunky handle for breakfast - 201-300ml / Creamy White
Brown matte ceramic coffee mug with large handle and dimensions 7.5x6cm for breakfast - 201-300ml / Brown
Matte dark blue ceramic coffee mug with dimensions 7.5cm width and 6cm height - 201-300ml / Fog Blue
Ceramic Coffee Mug Matte Finish Nordic Style Round Body With Thick Chunky Handle Heat Resistant Minimalist Breakfast Latte Cup
$3.95
Mix MOQ : 2
 · 
168 sold recently
Mahjong Shaped Ceramic Coffee Mug With Handle Creative Chinese Style Tea Cup Household Coffeeware Drinking Vessel
Mahjong Shaped Ceramic Coffee Mug With Handle Creative Chinese Style Tea Cup Household Coffeeware Drinking Vessel
like
Find Similar
Creative Mahjong ceramic mug in Nan Feng South Wind design with 400ml capacity box - Nan (South Wind)
400ml mahjong ceramic cup in white with green sparrow pattern and festive gift box - Yao Ji (1 of Bamboos)
Mahjong theme ceramic mug in white with red Zhong character and 400ml gift box packaging - Medium
Mahjong Fa character ceramic mug set with lucky gift box and 400ml capacity - Fa (Green Dragon)
+2
Mahjong Shaped Ceramic Coffee Mug With Handle Creative Chinese Style Tea Cup Household Coffeeware Drinking Vessel
$3.66
No MOQ
 · 
21 sold recently
Portable Bento Lunch Box Plastic Compartment Microwave Safe Sealed With Spoon Sauce Cup School Office Picnic Cute Cartoon Smile
Portable Bento Lunch Box Plastic Compartment Microwave Safe Sealed With Spoon Sauce Cup School Office Picnic Cute Cartoon Smile
like
Find Similar
Double-layer bento box in cream and pale yellow with utensils and sauce container - Single Layer / Yellow
Beige and green bento lunch box with spoon and dressing container on white background - Single Layer / Green
Creamy white bento box with yellow transparent lid, built-in spoon and smiley air vent - Double Layer / Yellow
Green divided lunch box with spoon and smiley sauce container for microwave meal prep - Double Layer / Green
+2
Portable Bento Lunch Box Plastic Compartment Microwave Safe Sealed With Spoon Sauce Cup School Office Picnic Cute Cartoon Smile
-5%
$1.86-2.14
No MOQ
 · 
19 sold recently
2026 World Cup Fan Cheering Glasses National Flag Soccer Match Party Favors For Football Game Celebration Accessories
2026 World Cup Fan Cheering Glasses National Flag Soccer Match Party Favors For Football Game Celebration Accessories
like
Find Similar
Mexico flag soccer party glasses with sombrero design for World Cup fans - Mexico Style
World Cup party glasses with football and flag designs for soccer fans and cheering - Uruguay Style
Brazil flag themed party glasses for soccer fans with moose and eagle design - Brazil Style
Germany flag themed party glasses with eagle silhouette and animal print frames - Germany Style
+6
2026 World Cup Fan Cheering Glasses National Flag Soccer Match Party Favors For Football Game Celebration Accessories
$0.55
Mix MOQ : 3
 · 
90 sold recently
Creative Mini Simulation Fruit Drink Cup Keychain Cute Resin Ice Beverage Bottle Bag Pendant Decorative Key Ring For Women Kids
Creative Mini Simulation Fruit Drink Cup Keychain Cute Resin Ice Beverage Bottle Bag Pendant Decorative Key Ring For Women Kids
like
Find Similar
Detail view of 4.2x4.8cm mini fruit tea keychain featuring pink liquid and ice cubes - Pink
Miniature lemon tea keychain with artificial ice and leaves measuring 4.2x4.8cm - Yellow
Detail shot of mini avocado drink keychain showing realistic slices and dimensions - Blue
Miniature juice bucket keychain featuring green liquid, lime slices and ice cubes in 4.2x4.8cm - Green
+2
Creative Mini Simulation Fruit Drink Cup Keychain Cute Resin Ice Beverage Bottle Bag Pendant Decorative Key Ring For Women Kids
-12%
$0.62
No MOQ
 · 
129 sold recently
Simulation Milk Tea Cup Liquid Quicksand Keychain Colorful Acrylic Floating Bottle Pendant With Gold Bell Bag Decor
Simulation Milk Tea Cup Liquid Quicksand Keychain Colorful Acrylic Floating Bottle Pendant With Gold Bell Bag Decor
like
Find Similar
Miniature bubble tea keychain with yellow liquid, colorful pearls, and a gold bell charm - Style with Bells / Lemon Yellow
Creative milk tea keychain with purple liquid and colorful beads on gold hardware - Lanyard Style / Purple
Pink bubble tea keychain with liquid glitter, pearl wristlet, and golden metal clasp - Chain Style / Pink
Blue bubble tea liquid quicksand keychain with white pearl handle and golden clasp - Chain Style / Blue
+14
Simulation Milk Tea Cup Liquid Quicksand Keychain Colorful Acrylic Floating Bottle Pendant With Gold Bell Bag Decor
-9%
$0.86-1.02
No MOQ
 · 
201 sold recently
Cute Cartoon Yellow Duck Children Tableware Melamine Divided Dinner Plate Bowl Cup Spoon For Kids Toddler Feeding
Cute Cartoon Yellow Duck Children Tableware Melamine Divided Dinner Plate Bowl Cup Spoon For Kids Toddler Feeding
like
Find Similar
Cute yellow duck cartoon baby bowl, 300ml capacity durable feeding plate for toddlers - Yellow Duck Bowl
Pink duck themed kids 4-piece tableware set with divided plate and gift box - Pink Duck 4-Piece Gift Set
Pink cartoon duck children bowl with 300ml capacity for baby feeding and snacks - Pink Duck Bowl
Cute yellow duck cartoon food tray for toddlers with 300ml capacity and 17.5cm size - Yellow Duck Plate
+10
Cute Cartoon Yellow Duck Children Tableware Melamine Divided Dinner Plate Bowl Cup Spoon For Kids Toddler Feeding
-13%
$0.58-10.16
No MOQ
 · 
1 reviews
Cartoon Creative Milk Tea Cup Quicksand Keychain With Artificial Pearl Acrylic Liquid Glitter Backpack Bag Hanging Ornament
Cartoon Creative Milk Tea Cup Quicksand Keychain With Artificial Pearl Acrylic Liquid Glitter Backpack Bag Hanging Ornament
like
Find Similar
Close-up of a bubble tea keychain with purple liquid and pearls on a metal keyring - Lobster Clasp Chain + Mini Milk Tea Cup + Pearl / Purple
Macro shot of bubble tea keychain with pink beads, gold flakes, and a large white pearl charm - Lobster Clasp Chain + Mini Milk Tea Cup + Pearl / Rose Red
Detail of DIY bubble tea keychain with pink straw, yellow beads and a large white pearl - Lobster Clasp Chain + Mini Milk Tea Cup + Pearl / Green
Bubble tea keychain with pink straw, glitter liquid, and large white pearl pendant charm - Lobster Clasp Chain + Mini Milk Tea Cup + Pearl / Lemon Yellow
+2
Cartoon Creative Milk Tea Cup Quicksand Keychain With Artificial Pearl Acrylic Liquid Glitter Backpack Bag Hanging Ornament
-9%
$0.66
No MOQ
 · 
77 sold recently
2026 World Cup Theme Trucker Hat Polyester Cotton Mesh Adjustable Breathable Flat Brim Sports Snapback Cap For Men
2026 World Cup Theme Trucker Hat Polyester Cotton Mesh Adjustable Breathable Flat Brim Sports Snapback Cap For Men
like
Find Similar
Close-up of a light blue 2026 sports cap featuring colorful football animal graphics - Sky Blue
Green 2026 World Football theme snapback hat with mesh back and flat brim style - Green
Pink and white 2026 World Cup themed trucker hat with animal graphic and breathable mesh back - Pink
Dark blue 2026 World Cup snapback cap with embroidered eagle and bear graphics - Navy Blue
+6
2026 World Cup Theme Trucker Hat Polyester Cotton Mesh Adjustable Breathable Flat Brim Sports Snapback Cap For Men
$3.46
Mix MOQ : 2
 · 
66 views
Bamboo Wood Stainless Steel Tea Tongs Chinese Kung Fu Tea Ceremony Accessories Tweezers Cup Clip Anti-Scald
Bamboo Wood Stainless Steel Tea Tongs Chinese Kung Fu Tea Ceremony Accessories Tweezers Cup Clip Anti-Scald
like
Find Similar
Bamboo tea tongs with natural wood grain finish for traditional tea ceremony - Bent Bamboo Tongs (P12-1)
Polished stainless steel curved tweezers for precision tea set maintenance and handling - Stainless Steel Tea Tongs 12.5cm (p51-1)
Bamboo and stainless steel tweezers for tea sets with a curved precision tip - Stainless Steel Tea Tongs 18cm (p50-1)
Bamboo tea tongs with wheat ear pattern and elegant dark brown decorative tassel - Tassel Straight Bamboo Tongs (PJ104-1)
+11
Bamboo Wood Stainless Steel Tea Tongs Chinese Kung Fu Tea Ceremony Accessories Tweezers Cup Clip Anti-Scald
-6%
$0.15-7.02
No MOQ
 · 
62 sold recently
Free Shipping
Ceramic Mug Heart Shaped Love Pattern Irregular Texture Romantic Coffee Water Cup With Handle Couple Anniversary Gift
Ceramic Mug Heart Shaped Love Pattern Irregular Texture Romantic Coffee Water Cup With Handle Couple Anniversary Gift
like
Find Similar
Minimalist black ceramic heart mug with red handle and inner Love text print - 330ML / Black - 1 Heart
White ceramic heart mug with red handle and black hand-drawn heart detail - 330ML / White - 1 Heart
Minimalist white ceramic heart mug with a black handle and red love graphics - 330ML / White - 2 Hearts
Red heart ceramic mug with black handle, textured finish and love text detail - 330ML / Red - 1 Heart
Ceramic Mug Heart Shaped Love Pattern Irregular Texture Romantic Coffee Water Cup With Handle Couple Anniversary Gift
$2.63
Mix MOQ : 2
 · 
21 sold recently
Ru Kiln Ceramic Teacup Ice Crackle Glaze Kung Fu Tea Master Cup Small Porcelain Tea Bowl For Home Office Use
Ru Kiln Ceramic Teacup Ice Crackle Glaze Kung Fu Tea Master Cup Small Porcelain Tea Bowl For Home Office Use
like
Find Similar
Ru-kiln ice crack ceramic teacup in pale green with 5cm diameter and 25ml capacity - 25ml / Ice Crackle Ru-ware Tasting Cup
Ru Kiln Ceramic Teacup Ice Crackle Glaze Kung Fu Tea Master Cup Small Porcelain Tea Bowl For Home Office Use
-4%
$1.92
No MOQ
 · 
44 views
Cute Cartoon Animal Coffee Cup Enamel Pin Badge Alloy Capybara Frog Cat Chick Ghost Brooch For Backpack Clothing Jacket Accessory
Cute Cartoon Animal Coffee Cup Enamel Pin Badge Alloy Capybara Frog Cat Chick Ghost Brooch For Backpack Clothing Jacket Accessory
like
Find Similar
Enamel pin of cartoon capybara in a pink coffee cup with orange details and floral vine - Capybara Coffee Cup Style (QHXZ1861)
Cute green frog sitting in a blue teacup enamel pin with lily pad detail - Frog Coffee Cup Style (QHXZ1862)
Cute white bird in a beige teacup enamel pin with pink cherry blossoms decoration - Chick Coffee Cup Style (QHXZ1863)
Halloween teacup enamel brooch featuring a bat pattern and cute white ghosts - Double Ghosts Coffee Cup Style (QHXZ1864)
+1
Cute Cartoon Animal Coffee Cup Enamel Pin Badge Alloy Capybara Frog Cat Chick Ghost Brooch For Backpack Clothing Jacket Accessory
-9%
$0.47
No MOQ
 · 
72 sold recently
Free Shipping
Large Capacity Glass Tea Mug With Handle And Stainless Steel Infuser Heat Resistant Borosilicate Glass Cup For Office
Large Capacity Glass Tea Mug With Handle And Stainless Steel Infuser Heat Resistant Borosilicate Glass Cup For Office
like
Find Similar
850ml champagne white heat-resistant glass tea mug with ergonomic handle and 304 infuser - White 800ml (High Filter)
Black 850ml high borosilicate glass tea cup with 304 stainless steel tea infuser - Black 800ml (High Filter)
850ml champagne white glass teapot with removable stainless steel filter for fruit tea - White 800ml (Low Filter)
Black 850ml high borosilicate glass tea cup with removable stainless steel strainer - Black 800ml (Low Filter)
+20
Large Capacity Glass Tea Mug With Handle And Stainless Steel Infuser Heat Resistant Borosilicate Glass Cup For Office
$4.32-6.34
No MOQ
 · 
55 views
Disposable Paper Tableware Plates Cups Napkins Straws Fruit Pattern Strawberry Lemon Gold Foil Edge Birthday Party Decor
Disposable Paper Tableware Plates Cups Napkins Straws Fruit Pattern Strawberry Lemon Gold Foil Edge Birthday Party Decor
like
Find Similar
Detailed top view of white disposable paper plate with red strawberry prints and gold edges - Small Strawberry Paper Plates
Pink paper straws with strawberry and flower patterns for birthday party tableware - Strawberry Print Straws
Macro shot of metallic gold spiral paper straws in a clear plastic package on white background - Gold Foil Straws
Detail view of twelve silver spiral patterned paper straws for party use on white background - Silver Spiral Pattern Straws
+20
Disposable Paper Tableware Plates Cups Napkins Straws Fruit Pattern Strawberry Lemon Gold Foil Edge Birthday Party Decor
-6%
$0.27-1.23
Mix MOQ : 2
 · 
209 sold recently
Lemon Birthday Party Supplies Mediterranean Style Tableware Decoration Banner Balloon Paper Plate Napkin Cup Summer Gathering
Lemon Birthday Party Supplies Mediterranean Style Tableware Decoration Banner Balloon Paper Plate Napkin Cup Summer Gathering
like
Find Similar
Pack of 10 lemon birthday party paper plates with blue tile pattern and gold text - 7 Inch Plates 10PCS
Detail of 9-inch disposable paper plates with lemon and Mediterranean tile patterns, 10 pieces - 9 Inch Plates 10PCS
Disposable paper cups for lemon party, 10pcs with blue tile and yellow citrus pattern - Paper Cups 10PCS
Lemon and blue tile pattern paper napkins for birthday parties, 20 pieces, 13-inch size - Napkins 20PCS
+10
Lemon Birthday Party Supplies Mediterranean Style Tableware Decoration Banner Balloon Paper Plate Napkin Cup Summer Gathering
-19%
$0.22-1.51
No MOQ
 · 
14 sold recently
Portable Toothbrush Case Plastic 3D Flower Embossed Travel Toothbrush Holder Cup With Lid Dustproof Storage
Portable Toothbrush Case Plastic 3D Flower Embossed Travel Toothbrush Holder Cup With Lid Dustproof Storage
like
Find Similar
Lavender portable toothbrush travel case with embossed flower pattern and cream lid - Flower Relief / Purple
Light blue floral embossed portable travel toothbrush case with beige lid and textured finish - Flower Relief / Blue
Portable blue toothbrush case with textured weave design and white lid for travel use - Butterfly Relief / Butterfly Blue
Portable beige toothbrush case featuring diamond texture and butterfly emblem - Butterfly Relief / Butterfly Beige
+4
Portable Toothbrush Case Plastic 3D Flower Embossed Travel Toothbrush Holder Cup With Lid Dustproof Storage
$0.53-0.65
Mix MOQ : 3
 · 
27 sold recently
World Cup National Flag Pinhole Sunglasses Blue Frame Mesh Lens Party Eyewear For Sports Fan Festival Events PC Frame AC Lens
World Cup National Flag Pinhole Sunglasses Blue Frame Mesh Lens Party Eyewear For Sports Fan Festival Events PC Frame AC Lens
like
Find Similar
Blue party sunglasses featuring Australian flag pattern lenses for sports events - Australia
Classic dark blue party sunglasses with American flag pattern lenses and plastic frame - United States
Dark blue party sunglasses featuring UK Union Jack flag patterns on mesh lenses - United Kingdom
Blue novelty sunglasses featuring French flag tricolor mesh lenses for sports fans - France Style
+9
World Cup National Flag Pinhole Sunglasses Blue Frame Mesh Lens Party Eyewear For Sports Fan Festival Events PC Frame AC Lens
-4%
$1.07
Mix MOQ : 2
 · 
44 sold recently
Ceramic Mug Spotted Splash Ink Irregular Coffee Cup With Circular Handle Retro Ins Style Handmade Water Tea Mug
Ceramic Mug Spotted Splash Ink Irregular Coffee Cup With Circular Handle Retro Ins Style Handmade Water Tea Mug
like
Find Similar
Artistic splash ink ceramic mug with unique round handle and wavy rim in purple finish - 250ML / Purple
Minimalist ceramic mug with black ink splatter pattern and thick ring handle on wooden desk - 250ML / Off White
Minimalist green speckled ceramic mug with round handle on a wavy light wood surface - 250ML / Green
Detailed top view of a yellow spotted ceramic mug on a sheep coaster with latte art decoration - 250ML / Yellow
Ceramic Mug Spotted Splash Ink Irregular Coffee Cup With Circular Handle Retro Ins Style Handmade Water Tea Mug
-5%
$1.64
No MOQ
 · 
99 sold recently
World Cup Soccer Football Pattern Double Sided Glass Ball Keychain Zinc Alloy Metal Key Ring Sport Fan Souvenir Gift
World Cup Soccer Football Pattern Double Sided Glass Ball Keychain Zinc Alloy Metal Key Ring Sport Fan Souvenir Gift
like
Find Similar
Soccer ball keychain with yellow and black pattern and silver metal ring - Yellow/Black Soccer (XSWX7360-1)
Soccer ball keychain with Brazil flag colors under glass dome and silver metal ring - Yellow/Green Soccer (XSWX7360-2)
Detail view of double-sided glass soccer ball keychain with silver metal ring - Yellow/Blue Soccer (XSWX7360-3)
Close-up of a soccer pattern glass ball keychain with a polished silver metal ring - Red/White Soccer (XSWX7360-4)
+5
World Cup Soccer Football Pattern Double Sided Glass Ball Keychain Zinc Alloy Metal Key Ring Sport Fan Souvenir Gift
-9%
$0.60
No MOQ
 · 
1K+ sold recently
Resin Ice Cream Cup Charms Mini Simulation Beverage Sundae Pendants For DIY Necklace Bracelet Keychain Jewelry Making Cute
Resin Ice Cream Cup Charms Mini Simulation Beverage Sundae Pendants For DIY Necklace Bracelet Keychain Jewelry Making Cute
like
Find Similar
Mini resin ice cream drink cup charms for DIY jewelry making in six assorted colors - Mixed 12pcs Resin Ice Cream Set
Close-up of blue and white gradient resin beverage cup pendants with straws for DIY jewelry - 1pc Royal Blue Resin Sundae Ice Cream Cup
Blue resin beverage cup pendant with white cream for DIY jewelry crafting - 1pc Lake Blue Resin Sundae Ice Cream Cup
Resin ice cream cone pendants in green and white swirl for DIY jewelry making - 1pc Grass Green Resin Sundae Ice Cream Cup
+3
Resin Ice Cream Cup Charms Mini Simulation Beverage Sundae Pendants For DIY Necklace Bracelet Keychain Jewelry Making Cute
-6%
$0.15-2.22
Mix MOQ : 2
 · 
91 sold recently
Free Shipping
World Cup 2026 National Flag Drawstring Bag Polyester Portable Sports Backpack Fans Cheer Gift Bag For Outdoor Travel
World Cup 2026 National Flag Drawstring Bag Polyester Portable Sports Backpack Fans Cheer Gift Bag For Outdoor Travel
like
Find Similar
Mexico flag drawstring backpack for sports fans, outdoor events and souvenir gifts - Mexico
Close-up of a portable drawstring backpack with a British Union Jack flag design for sports. - United Kingdom
High-quality white drawstring gym bag featuring South Korea national flag for sports fans - Korean Style
Red white and blue striped drawstring sport backpack for World Cup fans - Netherlands Style
+13
World Cup 2026 National Flag Drawstring Bag Polyester Portable Sports Backpack Fans Cheer Gift Bag For Outdoor Travel
$1.67
Mix MOQ : 10
 · 
40 sold recently
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access