Everful

Wholesale storage containers

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Storage Containers

Find the perfect pieces: food storage containers, kitchen storage, kitchen hooks and more

All products in storage containers

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Luxury Wall Mounted Soap Dish PET Drainage Holder Punch Free Bathroom Storage Rack With Electroplated Trim
Luxury Wall Mounted Soap Dish PET Drainage Holder Punch Free Bathroom Storage Rack With Electroplated Trim
like
Find Similar
Wall-mounted double-layer soap holder in translucent grey with silver metallic trim - Translucent Grey Silver
Wall-mounted double-layer soap dish in transparent grey gold finish with drain design - Translucent Grey Gold
Wall-mounted smoky grey soap holder with silver rabbit decor and drainage tray - Translucent Grey Silver With Rabbit
Translucent grey and gold wall-mounted soap dish with a cute silver bunny decoration - Translucent Grey Gold With Rabbit
Luxury Wall Mounted Soap Dish PET Drainage Holder Punch Free Bathroom Storage Rack With Electroplated Trim
$1.59-1.87
No MOQ
French Vintage Lace Embroidery Gauze Makeup Bag Women Handbag Canvas Lining Zippered Cosmetic Storage Pouch Simple Elegant
French Vintage Lace Embroidery Gauze Makeup Bag Women Handbag Canvas Lining Zippered Cosmetic Storage Pouch Simple Elegant
like
Find Similar
Detail of off-white lace embroidery makeup bag with simple wish label on a table - Organza Paisley Embroidery / Organza Paisley
Close-up of off-white lace pouch with floral embroidery and 'simple wish' label - Corded Lace Mesh / Bone Rope Mesh Embroidery
Elegant off-white floral lace makeup bag with matching hair accessories on wooden table - Cotton Floral Crochet / Cotton Thread Flower Embroidery
French Vintage Lace Embroidery Gauze Makeup Bag Women Handbag Canvas Lining Zippered Cosmetic Storage Pouch Simple Elegant
$4.55
No MOQ
Modern Minimalist Hemp Rope Woven Basket White And Gray Striped Storage Bin Decorative Flower Pot Cover Organizer For Home
Modern Minimalist Hemp Rope Woven Basket White And Gray Striped Storage Bin Decorative Flower Pot Cover Organizer For Home
like
Find Similar
Modern woven cotton rope storage basket with grey stripes, measuring 28cm by 28cm - White And Gray Storage Basket
Detail of woven cotton rope plant basket showing 20cm height and diameter dimensions - White And Gray Storage Basket
Detail view of woven cotton rope storage basket with grey stripes and 25cm dimensions - White And Gray Storage Basket
Modern Minimalist Hemp Rope Woven Basket White And Gray Striped Storage Bin Decorative Flower Pot Cover Organizer For Home
-12%
$2.41-5.07
No MOQ
Minimalist Black and White Cotton Rope Woven Storage Basket with Handles Round Braided Desktop Organizer for Home Bedroom Decor
Minimalist Black and White Cotton Rope Woven Storage Basket with Handles Round Braided Desktop Organizer for Home Bedroom Decor
like
Find Similar
Minimalist round cotton rope storage basket in black and white woven design - M / Black and White Patchwork
Minimalist Black and White Cotton Rope Woven Storage Basket with Handles Round Braided Desktop Organizer for Home Bedroom Decor
$2.88
No MOQ
Nordic Ceramic Jewelry Tray Gold Trim Poker Element King Spade Ace Heart Storage Dish Decorative Desktop Key Plate
Nordic Ceramic Jewelry Tray Gold Trim Poker Element King Spade Ace Heart Storage Dish Decorative Desktop Key Plate
like
Find Similar
1 option
Nordic Ceramic Jewelry Tray Gold Trim Poker Element King Spade Ace Heart Storage Dish Decorative Desktop Key Plate
$5.19
Mix MOQ : 2
 · 
11 views
Handmade Woven Seagrass Storage Basket Set With Handle Pastoral Style Decorative Flower Basket For Home Wedding Gift Packaging
Handmade Woven Seagrass Storage Basket Set With Handle Pastoral Style Decorative Flower Basket For Home Wedding Gift Packaging
like
Find Similar
Detail of two handmade seagrass woven baskets with handles for home decor and gifts - Square Style (Large and Small)
Natural seagrass woven flower basket set with round handle and rustic handmade texture - Round Style (Large and Small)
Close-up of natural seagrass woven baskets in small and large sizes for home decor - Rectangular Style (Large and Small)
Handmade Woven Seagrass Storage Basket Set With Handle Pastoral Style Decorative Flower Basket For Home Wedding Gift Packaging
$7.15
No MOQ
Large Capacity Corduroy Makeup Bag Solid Color Portable Cosmetic Pouch For Women Travel Toiletry Storage Zip Bag
Large Capacity Corduroy Makeup Bag Solid Color Portable Cosmetic Pouch For Women Travel Toiletry Storage Zip Bag
like
Find Similar
Light blue corduroy makeup bag with zipper closure shown with cosmetics inside - Light Green
Green corduroy makeup bag with soft ribbed texture and zipper closure in Morandi style - Dark Green
Pink corduroy makeup bag with internal space for brushes and cosmetics on fabric - Dusty Pink
Pink corduroy makeup pouch with zipper closure and soft striped texture - Pink
+2
Large Capacity Corduroy Makeup Bag Solid Color Portable Cosmetic Pouch For Women Travel Toiletry Storage Zip Bag
$1.59
Mix MOQ : 5
Professional Heavy Duty Oxford Cloth Tool Bag With Waterproof Base Multi Pocket Technician Electrician Storage Bag For Men
Professional Heavy Duty Oxford Cloth Tool Bag With Waterproof Base Multi Pocket Technician Electrician Storage Bag For Men
like
Find Similar
Heavy duty multifunctional tool bag with waterproof hard base and durable rubber handle - 35.6 Length x 30.5 Width x 35.6 Height / Black and Gray
Heavy duty professional tool backpack with waterproof hard base and multi-compartment storage - 35.6 Length x 30.5 Width x 35.6 Height / Dark Green
Detail view of the durable waterproof base and reinforced handle on the tool bag - 35.6 Length x 30.5 Width x 35.6 Height / Grey Orange
Detailed view of heavy-duty tool bag with reinforced handle and waterproof hard base - 35.6 Length x 30.5 Width x 35.6 Height / Grey Green
Professional Heavy Duty Oxford Cloth Tool Bag With Waterproof Base Multi Pocket Technician Electrician Storage Bag For Men
$36.02
No MOQ
Soft Lamb Wool Drawstring Storage Bag Cute Plush Cosmetic Pouch Travel Skincare Organizer Heart Polka Dot Pattern For Students
Soft Lamb Wool Drawstring Storage Bag Cute Plush Cosmetic Pouch Travel Skincare Organizer Heart Polka Dot Pattern For Students
like
Find Similar
Soft lamb wool drawstring pouch with heart pattern and purple braided cords for makeup storage - Cream with Red Heart
Detail of grey plush drawstring storage bag with heart pattern and pink cords on desk - Grey with White Polka Dots
Macro view of brown plush heart drawstring bag with beige dots and pink cord detail - Brown with Cream Polka Dots
Close-up of green fleece drawstring storage bag with heart design on a desk setup - Green with White Polka Dots
+1
Soft Lamb Wool Drawstring Storage Bag Cute Plush Cosmetic Pouch Travel Skincare Organizer Heart Polka Dot Pattern For Students
$1.70
No MOQ
Portable Velvet Jewelry Box Travel Case With Zipper Mirror For Rings Earrings Necklaces Storage Square Minimalist
Portable Velvet Jewelry Box Travel Case With Zipper Mirror For Rings Earrings Necklaces Storage Square Minimalist
like
Find Similar
Detail of pink velvet jewelry box with golden zipper showing soft texture and square shape - 10x10x5cm / Pink
Portable purple velvet jewelry box with golden zipper closure for rings and earrings - 10x10x5cm / Purple
Portable square velvet jewelry box in cream white with premium gold zipper closure - 10x10x5cm / Off-white
Portable Velvet Jewelry Box Travel Case With Zipper Mirror For Rings Earrings Necklaces Storage Square Minimalist
-8%
$1.83
No MOQ
Handmade Jute Woven Storage Basket With Lid Decorative Desktop Organizer Bin For Home Essentials Snacks Keys
Handmade Jute Woven Storage Basket With Lid Decorative Desktop Organizer Bin For Home Essentials Snacks Keys
like
Find Similar
Handwoven round cotton rope storage basket with lid and brown leather pull handle - D16*H12.5cm / Small Cylinder Lid (32652)
Handwoven khaki cotton rope storage basket with lid and brown leather handle - D20.5*H13.5cm / Large Cylinder Lid (32652)
Set of 2 nesting woven cotton rope baskets with lids and brown leather handles - Small and Large / Cylinder Lid Combination (32652)
Handmade Jute Woven Storage Basket With Lid Decorative Desktop Organizer Bin For Home Essentials Snacks Keys
$4.32-8.65
No MOQ
Iridescent Acrylic Decorative Storage Tray Irregular Moon Arch Shape Desktop Display Stand With Metal Legs Home Decor Organizer
Iridescent Acrylic Decorative Storage Tray Irregular Moon Arch Shape Desktop Display Stand With Metal Legs Home Decor Organizer
like
Find Similar
Irregular iridescent acrylic tray with silver metal stands for stylish desk organization - Iridescent Moon
Close-up of irregular wave acrylic tray with three silver metal legs for home decor - Ripple Moon
Minimalist black acrylic bean-shaped tray with silver metal feet for jewelry display - Black Matte Moon
Detail of transparent wavy acrylic tray with sleek metal legs for desktop display - Transparent Matte Moon
+4
Iridescent Acrylic Decorative Storage Tray Irregular Moon Arch Shape Desktop Display Stand With Metal Legs Home Decor Organizer
-4%
$3.29-3.83
Mix MOQ : 2
Mushroom Pattern Makeup Bag Polyester Jacquard Fabric Vintage Cosmetic Pouch For Travel Home Storage Women Organizer Zip
Mushroom Pattern Makeup Bag Polyester Jacquard Fabric Vintage Cosmetic Pouch For Travel Home Storage Women Organizer Zip
like
Find Similar
Portable beige makeup bag with yellow mushroom patterns and ATRYG brand label - Yellow
Portable mushroom jacquard woven cosmetic travel bag with zipper on a white table - Dark Green
Close-up of mushroom pattern cosmetic bag with red zipper and brand logo detail - Red
Mushroom Pattern Makeup Bag Polyester Jacquard Fabric Vintage Cosmetic Pouch For Travel Home Storage Women Organizer Zip
$2.82
No MOQ
 · 
29 views
Jewelry Organizer Travel Case Waterproof Quilted Bag For Necklaces Earrings Rings Accessory Storage
Jewelry Organizer Travel Case Waterproof Quilted Bag For Necklaces Earrings Rings Accessory Storage
like
Find Similar
Black jewelry travel organizer with diamond texture and transparent internal loose-leaf pages - Black
Pink PU leather travel jewelry organizer bag with loose-leaf pages for rings and earrings - Light Pink
Turquoise quilted fabric jewelry travel organizer bag with a textured woven pattern - Emerald Green
Jewelry Organizer Travel Case Waterproof Quilted Bag For Necklaces Earrings Rings Accessory Storage
$6.92
No MOQ
 · 
49 views
Quilted Heart Storage Pouch Polyester Fabric Small Makeup Bag For Sanitary Napkin Coin Cosmetic Organizer With Zipper
Quilted Heart Storage Pouch Polyester Fabric Small Makeup Bag For Sanitary Napkin Coin Cosmetic Organizer With Zipper
like
Find Similar
Pink quilted cotton square storage pouch with heart stitching and logo label for women - Raspberry Pink Heart Quilted Mini Bag
Quilted avocado green candy-colored cosmetic pouch with pink heart label and rope knot - Fruit Green Heart Quilted Mini Bag
Orange quilted square coin purse with heart pattern and Sound of Silence patch - Bright Orange Heart Quilted Mini Bag
Quilted mint green square pouch with pink label and soft rope knot zipper detail - Cream Blue Heart Quilted Mini Bag
Quilted Heart Storage Pouch Polyester Fabric Small Makeup Bag For Sanitary Napkin Coin Cosmetic Organizer With Zipper
$2.06
No MOQ
Cute Cartoon Puppy Makeup Bag Large Capacity Fabric Portable Handle Cosmetic Storage Case Korean Style Contrast Color Zipper
Cute Cartoon Puppy Makeup Bag Large Capacity Fabric Portable Handle Cosmetic Storage Case Korean Style Contrast Color Zipper
like
Find Similar
Brown canvas patchwork dog makeup bag with The Jolly House text and cartoon patterns - Large / Milky Yellow
Dual-tone coffee and cream toiletry bag with 'The Jolly House' print and sturdy handle - Small / Milky Yellow
Blue dog embroidery vanity bag with red handles and The Jolly House patch design - Large / Sea Salt Blue
Blue and white puppy makeup bag with red handles and The Jolly House branding - Small / Sea Salt Blue
Cute Cartoon Puppy Makeup Bag Large Capacity Fabric Portable Handle Cosmetic Storage Case Korean Style Contrast Color Zipper
$3.75-6.63
No MOQ
Large Capacity Makeup Bag Nylon Portable Quilted Toiletry Organizer For Travel Professional Cosmetic Storage Handbag
Large Capacity Makeup Bag Nylon Portable Quilted Toiletry Organizer For Travel Professional Cosmetic Storage Handbag
like
Find Similar
Pink large capacity travel makeup bag with dual compartments and brush organizer - Pink
Lavender purple large travel toiletry bag with compartments for brushes and cosmetics - Purple
Light blue quilted makeup bag with multi-layer storage and character charms - Blue
Cream white travel makeup bag with multi-layer zipper and large capacity storage - Yellow
Large Capacity Makeup Bag Nylon Portable Quilted Toiletry Organizer For Travel Professional Cosmetic Storage Handbag
$6.92
No MOQ
Bowknot Quilted Makeup Bag PU Leather Large Capacity Toiletry Bag Portable Travel Storage Case For Women Fresh Style
Bowknot Quilted Makeup Bag PU Leather Large Capacity Toiletry Bag Portable Travel Storage Case For Women Fresh Style
like
Find Similar
Detail of off-white quilted cosmetic bag with bow patterns and sturdy handle - Small Bowknot Cream White
Detailed close-up of silver quilted makeup bag with metallic bunny pattern and top handle - Small Bow Silver
Detail of pink waterproof makeup bag featuring quilted bow pattern and dual zipper closure - Small Bow Pink
Close-up of black quilted makeup bag with embossed bunny patterns and double zippers - Small Bowknot Black
Bowknot Quilted Makeup Bag PU Leather Large Capacity Toiletry Bag Portable Travel Storage Case For Women Fresh Style
$3.98
No MOQ
Drawstring Makeup Bag Quilted Puffer Pouch PU Leather Embossed Bowknot Portable Travel Cosmetic Organizer Cute Storage
Drawstring Makeup Bag Quilted Puffer Pouch PU Leather Embossed Bowknot Portable Travel Cosmetic Organizer Cute Storage
like
Find Similar
Silver metallic drawstring bag with 3D butterfly embossing and thin shoulder strap - Silver
White quilted bow drawstring makeup bag in satin-like fabric for stylish storage - White
Pink satin drawstring bag featuring 3D bow texture for cosmetics and jewelry storage - Pink
Quilted black drawstring pouch with textured bow pattern on pink tray for storage - Black
Drawstring Makeup Bag Quilted Puffer Pouch PU Leather Embossed Bowknot Portable Travel Cosmetic Organizer Cute Storage
-5%
$1.82
No MOQ
Handmade Bamboo Woven Storage Box With Artificial Orchid Flower Decorative Round Jewelry Case Oriental Style
Handmade Bamboo Woven Storage Box With Artificial Orchid Flower Decorative Round Jewelry Case Oriental Style
like
Find Similar
Bamboo woven jewelry box featuring a purple orchid flower with elegant pearl and jade jewelry - Pink
Detail of woven bamboo jewelry box with purple orchid and elegant pearl accessories - Purple
Bamboo storage box featuring a realistic orchid flower and a set of pearl jewelry - Green
Handmade Bamboo Woven Storage Box With Artificial Orchid Flower Decorative Round Jewelry Case Oriental Style
$4.18
No MOQ
Handmade Seagrass Plant Basket Woven Indoor Planter Cover For Flower Pot Straw Storage Basket With Waterproof Lining Home Decor
Handmade Seagrass Plant Basket Woven Indoor Planter Cover For Flower Pot Straw Storage Basket With Waterproof Lining Home Decor
like
Find Similar
Handwoven straw flower pot with yellow-white stripes, diameter 18cm, waterproof lining - Small Yellow Stripe (18*14)
Handwoven straw flower pot with natural fiber and yellow stripes, 23cm diameter - Medium Yellow Stripe (23*17)
Handwoven straw flower basket with yellow stripes and plastic lining, 28cm diameter - Large Yellow Stripe (28*21)
Handmade Seagrass Plant Basket Woven Indoor Planter Cover For Flower Pot Straw Storage Basket With Waterproof Lining Home Decor
$2.25-3.75
No MOQ
Christmas Makeup Bag Waterproof Linen Canvas Cosmetic Pouch Zipper Storage Case Travel Festive Gift For Women
Christmas Makeup Bag Waterproof Linen Canvas Cosmetic Pouch Zipper Storage Case Travel Festive Gift For Women
like
Find Similar
Beige cotton Merry Christmas makeup pouch with holly berries and festive patterns - Style A
Beige canvas makeup bag with BEST Wishes leaf print and secure black zipper - Style B
White Christmas cotton makeup bag with HO HO HO print and holiday berry wreath detail - Style C
White canvas Christmas makeup bag with Merry Christmas wreath print and black zipper - Style D
+2
Christmas Makeup Bag Waterproof Linen Canvas Cosmetic Pouch Zipper Storage Case Travel Festive Gift For Women
-4%
$1.92
Mix MOQ : 2
Natural Seagrass Woven Plant Basket With Waterproof Liner Handwoven Flower Pot Cover For Indoor Outdoor Home Decor Storage Basket Set
Natural Seagrass Woven Plant Basket With Waterproof Liner Handwoven Flower Pot Cover For Indoor Outdoor Home Decor Storage Basket Set
like
Find Similar
Three sizes of natural seagrass woven plant pots with striped design and plastic liners - Rice White Large
Three-piece seagrass woven planter set with waterproof liners and colorful trim - Multicolor Patchwork Set
+3
Natural Seagrass Woven Plant Basket With Waterproof Liner Handwoven Flower Pot Cover For Indoor Outdoor Home Decor Storage Basket Set
-12%
$2.03-6.85
No MOQ
Portable Square PE Film Jewelry Storage Box Suspended Anti-oxidation Jewelry Display Case For Earrings Ring Necklace Gift Box
Portable Square PE Film Jewelry Storage Box Suspended Anti-oxidation Jewelry Display Case For Earrings Ring Necklace Gift Box
like
Find Similar
Detail shot of a black PE film floating jewelry box with PUSH button for dust-proof storage - Style A Black Gift Box (7x7cm)
Portable black PE film jewelry box for anti-oxidation earring and necklace storage - Style B Black Gift Box (9x9cm)
Portable Square PE Film Jewelry Storage Box Suspended Anti-oxidation Jewelry Display Case For Earrings Ring Necklace Gift Box
$0.31-0.42
No MOQ
Handmade Woven Willow Wall Hanging Storage Basket With Cute Cartoon Animal Plush Decor For Kitchen Desktop Organization
Handmade Woven Willow Wall Hanging Storage Basket With Cute Cartoon Animal Plush Decor For Kitchen Desktop Organization
like
Find Similar
Handmade wicker storage basket featuring a cute white cow plush design for home decor - Semi-circle Wall Hanging Basket Small
Handmade Woven Willow Wall Hanging Storage Basket With Cute Cartoon Animal Plush Decor For Kitchen Desktop Organization
$6.28
No MOQ
Quilted Square Cosmetic Bag Floral Print Polyester Zipper Pouch For Sanitary Napkins Makeup Travel Storage Organizer
Quilted Square Cosmetic Bag Floral Print Polyester Zipper Pouch For Sanitary Napkins Makeup Travel Storage Organizer
like
Find Similar
Quilted floral makeup bag for women with zip closure and elegant white floral pattern - Yellow Floral
Quilted floral coin purse and cosmetic bag with zipper for compact storage - Red Floral
Quilted floral coin purse with pink flower patterns and secure silver zipper closure - Pink Floral
Quilted floral coin purse in white and navy blue with a smooth zipper closure - Dark Blue Floral
+5
Quilted Square Cosmetic Bag Floral Print Polyester Zipper Pouch For Sanitary Napkins Makeup Travel Storage Organizer
-9%
$1.30
No MOQ
Cute Sweet Bow Embroidery Makeup Bag Canvas Striped Cosmetic Pouch Portable Travel Toiletry Storage Organizer For Women
Cute Sweet Bow Embroidery Makeup Bag Canvas Striped Cosmetic Pouch Portable Travel Toiletry Storage Organizer For Women
like
Find Similar
Detailed embroidery of pink ribbon bow patterns on soft polyester cosmetic travel bag - Pink Bowknot (Large)
Close-up of light blue striped makeup bag with bow embroidery and fabric H&R BAG brand tag - Blue Bowknot (Large)
Close-up of pink makeup bag with bow embroidery and decorative flower zipper pull charm - Pink Velvet Bow (Small)
Close-up of light blue striped makeup bag with bow embroidery and flower zipper pull - Blue Bowknot (Small)
Cute Sweet Bow Embroidery Makeup Bag Canvas Striped Cosmetic Pouch Portable Travel Toiletry Storage Organizer For Women
$2.10-2.82
No MOQ
Transparent PVC Plastic Hat Support Shaper For Fedora Jazz Hats Anti-Pressure Storage Protective Stand Inner Frame
Transparent PVC Plastic Hat Support Shaper For Fedora Jazz Hats Anti-Pressure Storage Protective Stand Inner Frame
like
Find Similar
Clear PVC plastic hat support insert for Fedora hats for shape protection and display - M (56-58cm) / Transparent Fedora Support (01)
Clear PVC storage hat stand protector for straw hats and jazz hats with round dome - M (56-58cm) / Transparent Dome Support (02)
Matte black plastic PVC hat support for jazz and fedora hats with teardrop crown shape - M (56-58cm) / Black Fedora Support (03)
Transparent PVC plastic fedora hat support for maintaining shape during storage - M (56-58cm) / Transparent Fedora Shaper (04)
Transparent PVC Plastic Hat Support Shaper For Fedora Jazz Hats Anti-Pressure Storage Protective Stand Inner Frame
$0.25-0.48
No MOQ
Large Capacity Clear PVC Tote Bag Waterproof Transparent Travel Toiletry Storage Pouch For Makeup Bathroom Outdoor Beach Simple Portable
Large Capacity Clear PVC Tote Bag Waterproof Transparent Travel Toiletry Storage Pouch For Makeup Bathroom Outdoor Beach Simple Portable
like
Find Similar
Large transparent PVC tote bag with black straps and top zipper for travel and lunch - Black
Large Capacity Clear PVC Tote Bag Waterproof Transparent Travel Toiletry Storage Pouch For Makeup Bathroom Outdoor Beach Simple Portable
$1.73
No MOQ
Wall Mounted Folding Clothes Hanger Storage Rack No-Drill Plastic Space Saving Organizer For Home Bathroom Laundry Room White
Wall Mounted Folding Clothes Hanger Storage Rack No-Drill Plastic Space Saving Organizer For Home Bathroom Laundry Room White
like
Find Similar
Single white wall-mounted folding clothes hanger in durable plastic for dormitory storage - White (1PC)
Wall Mounted Folding Clothes Hanger Storage Rack No-Drill Plastic Space Saving Organizer For Home Bathroom Laundry Room White
-5%
$0.95
No MOQ
 · 
13 views
Wall Mounted Storage Shelf Gold Iron Metal Frame Wood Board Nordic Decorative Rack For Living Room Bedroom Bird Butterfly Ornament
Wall Mounted Storage Shelf Gold Iron Metal Frame Wood Board Nordic Decorative Rack For Living Room Bedroom Bird Butterfly Ornament
like
Find Similar
Creative golden bicycle wall shelf with two wood trays and metal bird details - Gold Butterfly Double Circle
Wall Mounted Storage Shelf Gold Iron Metal Frame Wood Board Nordic Decorative Rack For Living Room Bedroom Bird Butterfly Ornament
-5%
$4.65
No MOQ
 · 
43 views
Christmas Cotton Rope Woven Storage Basket Set Reindeer Snowman Pompom Decorative Desktop Organizer Gift Basket For Holiday Home
Christmas Cotton Rope Woven Storage Basket Set Reindeer Snowman Pompom Decorative Desktop Organizer Gift Basket For Holiday Home
like
Find Similar
Macro shot of woven cotton rope Christmas basket with snowman detail and 18x10cm size specs - White Snowman Pompom (Small)
Detail view of woven Christmas cotton storage basket with reindeer bear and pom-poms - White Reindeer Pompom (Medium)
Detailed view of woven cotton rope Christmas basket with cat ears and colorful pom-poms - White Gift Box Pompom (Large)
Three-piece Christmas woven cotton rope storage baskets with cute cat ear handles - White Christmas Pompom Set
Christmas Cotton Rope Woven Storage Basket Set Reindeer Snowman Pompom Decorative Desktop Organizer Gift Basket For Holiday Home
$2.85-9.51
No MOQ
Ceramic Tea Caddy Ru Kiln Small Storage Jar With Wood Lid Portable Airtight Rabbit Pattern Oriental Style Decorative
Ceramic Tea Caddy Ru Kiln Small Storage Jar With Wood Lid Portable Airtight Rabbit Pattern Oriental Style Decorative
like
Find Similar
Ru-kiln ceramic tea canister with hand-painted rabbit motif and airtight wood lid - Imperial Yellow Ru-Kiln Dandelion Rabbit Tea Caddy [Standard Pack]
Ru-kiln ceramic tea canister with cute bunny motif and bamboo lid, gift box included - Imperial Yellow Ru-Kiln Dandelion Rabbit Tea Caddy [Gift Box]
Ceramic Tea Caddy Ru Kiln Small Storage Jar With Wood Lid Portable Airtight Rabbit Pattern Oriental Style Decorative
$3.46-4.90
No MOQ
 · 
15 views
Handwoven Seagrass Storage Basket Straw Flower Pot Cover Indoor Planter With Handles Waterproof Lining Natural Beige Woven Planter For Home Decor
Handwoven Seagrass Storage Basket Straw Flower Pot Cover Indoor Planter With Handles Waterproof Lining Natural Beige Woven Planter For Home Decor
like
Find Similar
Handwoven straw storage basket with handle and waterproof liner, size 25x20cm - Beige B Small
Natural woven straw planter with handles and waterproof liner, dimensions 30x27cm - Beige B Medium
Handwoven straw planter basket with handles and plastic liner, size 35x30cm - Beige B Large
Handwoven Seagrass Storage Basket Straw Flower Pot Cover Indoor Planter With Handles Waterproof Lining Natural Beige Woven Planter For Home Decor
-5%
$4.11-7.39
No MOQ
Bento Lunch Box Wheat Straw Portable Microwaveable Leakproof Food Container With Utensils Japanese Style For Student Office
Bento Lunch Box Wheat Straw Portable Microwaveable Leakproof Food Container With Utensils Japanese Style For Student Office
like
Find Similar
Mint green double-layer 750ml bento lunch box with cutlery on wooden surface - Double Layer-Green (750ml)-Heat Shrink Film
Three-layer 900ml eco-friendly lunch box in light brown with transparent lid and utensils - Triple Layer-Beige (900ml)-Boxed
Green three-layer 900ml microwave lunch box with fork and straw texture finish - Triple Layer-Green (900ml)-Boxed
Three-layer 900ml khaki lunch box set with panda thermal bag and sauce container - Triple Layer Set-Beige (Box+Bag+Sauce Cup)
+7
Bento Lunch Box Wheat Straw Portable Microwaveable Leakproof Food Container With Utensils Japanese Style For Student Office
$1.99-4.01
No MOQ
 · 
1 reviews
Makeup Brush Storage Bag Roll Up Case Floral Print Canvas Cotton Portable Travel Pouch Ribbon Tie Organizer
Makeup Brush Storage Bag Roll Up Case Floral Print Canvas Cotton Portable Travel Pouch Ribbon Tie Organizer
like
Find Similar
Floral fabric makeup brush roll organizer with pink ribbon tie on a white surface - Twill Floral Beige
Floral fabric roll-up organizer for makeup brushes with pink ribbon tie and corduroy texture - Twill Floral Blue
Detail of floral makeup brush roll bag with pink ribbon bow on a decorative desk - Twill Floral Pink
Top view of floral fabric rolls tied with pink ribbon for makeup bag sewing - Twill Flowers
+1
Makeup Brush Storage Bag Roll Up Case Floral Print Canvas Cotton Portable Travel Pouch Ribbon Tie Organizer
$2.56
No MOQ
Wall Mounted Toilet Paper Holder Gunmetal Grey Space Aluminum Waterproof Tissue Box Storage Shelf Bathroom Flip Cover
Wall Mounted Toilet Paper Holder Gunmetal Grey Space Aluminum Waterproof Tissue Box Storage Shelf Bathroom Flip Cover
like
Find Similar
Gunmetal grey wall-mounted toilet tissue box made of space aluminum with storage shelf - Gun Grey [Large Capacity]
Gunmetal wall-mounted toilet paper holder with shelf, 20x12x12cm matte finish metal rack - Gun Grey [Square]
Wall Mounted Toilet Paper Holder Gunmetal Grey Space Aluminum Waterproof Tissue Box Storage Shelf Bathroom Flip Cover
-5%
$6.02-7.94
No MOQ
Cartoon Snowman Christmas Tree Cotton Woven Storage Basket With Lid Desktop Organizing Bin For Living Room Bedroom Household
Cartoon Snowman Christmas Tree Cotton Woven Storage Basket With Lid Desktop Organizing Bin For Living Room Bedroom Household
like
Find Similar
Detailed size view of snowman cotton rope storage basket with height and diameter markers - Width 25 Height 30 / Snowman Style
Detail of woven cotton storage basket with snowman face and size dimensions shown - Width 25 Height 30 / Superman Style Creamy White
Cartoon Snowman Christmas Tree Cotton Woven Storage Basket With Lid Desktop Organizing Bin For Living Room Bedroom Household
-11%
$3.55
No MOQ
Transparent PS PVC Paper Money Holder Set With Protective Sleeves and Storage Box Bill Currency Collection Organizer
Transparent PS PVC Paper Money Holder Set With Protective Sleeves and Storage Box Bill Currency Collection Organizer
like
Find Similar
Set of 100 transparent paper money holders with clear plastic storage box for banknote collection - Storage Box With 100 Protective Sleeves
Transparent PS PVC Paper Money Holder Set With Protective Sleeves and Storage Box Bill Currency Collection Organizer
$1.67
Mix MOQ : 2
Microfiber Jewelry Pouch Mini Suede Storage Bag With Snap Button Portable Organizer For Rings Earrings Necklaces
Microfiber Jewelry Pouch Mini Suede Storage Bag With Snap Button Portable Organizer For Rings Earrings Necklaces
like
Find Similar
Mini bean green microfiber jewelry pouch with snap button and 6x6x2.3cm dimensions - 6*6*2.3cm / Turquoise Green
Microfiber Jewelry Pouch Mini Suede Storage Bag With Snap Button Portable Organizer For Rings Earrings Necklaces
$0.85
Mix MOQ : 2
 · 
30 sold recently
Sunglasses Organizer Hanging Wall Mount Double Sided Dustproof Glasses Display Holder Oxford Cloth PVC Pockets Closet Wardrobe Storage
Sunglasses Organizer Hanging Wall Mount Double Sided Dustproof Glasses Display Holder Oxford Cloth PVC Pockets Closet Wardrobe Storage
like
Find Similar
Hanging sunglasses organizer with 16 PVC pockets and a rotating metal hook in two colors - 40*77.5CM / Black
Sunglasses Organizer Hanging Wall Mount Double Sided Dustproof Glasses Display Holder Oxford Cloth PVC Pockets Closet Wardrobe Storage
$6.05
No MOQ
Macrame Wall Hanging Storage Tapestry Handwoven Cotton Rope Wood Stick Multi Layer Magazine Rack Nordic Boho Decor
Macrame Wall Hanging Storage Tapestry Handwoven Cotton Rope Wood Stick Multi Layer Magazine Rack Nordic Boho Decor
like
Find Similar
Bohemian 3-tier woven cotton rope wall hanging shelf with fringe and wood beads - 45*120cm / Beige
Macrame Wall Hanging Storage Tapestry Handwoven Cotton Rope Wood Stick Multi Layer Magazine Rack Nordic Boho Decor
-4%
$5.48
No MOQ
 · 
13 views
Portable Glasses Storage Bag PU Leather Squeeze Open Automatic Closure Cartoon Pattern Pouch With Lanyard
Portable Glasses Storage Bag PU Leather Squeeze Open Automatic Closure Cartoon Pattern Pouch With Lanyard
like
Find Similar
Pink striped mini makeup pouch featuring a lucky bear print and wristlet strap - Pink Stripe Bear
Mini makeup pouch featuring pink and blue stripes with a cartoon dog and wrist strap - Blue Striped Dog
Mini dog pattern stripe storage bag for glasses with automatic closure and wrist strap - Khaki Striped Dog
Portable Glasses Storage Bag PU Leather Squeeze Open Automatic Closure Cartoon Pattern Pouch With Lanyard
$1.38
Mix MOQ : 2
Handmade Water Hyacinth Woven Storage Basket Round Desktop Sundries Organizer Tray For Home Decor Natural Straw Fruit Bowl
Handmade Water Hyacinth Woven Storage Basket Round Desktop Sundries Organizer Tray For Home Decor Natural Straw Fruit Bowl
like
Find Similar
Handwoven natural seagrass storage basket tray in light brown for desktop organization - Natural Large Round Tray
Handwoven round storage basket with two-tone white cotton rope and natural seagrass - White & Natural Large Round Tray
Handmade Water Hyacinth Woven Storage Basket Round Desktop Sundries Organizer Tray For Home Decor Natural Straw Fruit Bowl
$4.90
Mix MOQ : 50
Natural Rattan Storage Basket Handwoven Round Fruit Tray Wave Edge Desktop Organizer For Bread Vegetable Kitchen Home Decor
Natural Rattan Storage Basket Handwoven Round Fruit Tray Wave Edge Desktop Organizer For Bread Vegetable Kitchen Home Decor
like
Find Similar
Set of 3 handmade woven rattan storage baskets with elegant wavy edges in natural wood color - Small (22cm x 5cm) / Wood Brown
Natural Rattan Storage Basket Handwoven Round Fruit Tray Wave Edge Desktop Organizer For Bread Vegetable Kitchen Home Decor
-12%
$7.05-26.63
No MOQ
Nordic Handmade Paper Rope Woven Storage Basket Round Wave Pattern Organizer For Laundry Toys Living Room Home Decor
Nordic Handmade Paper Rope Woven Storage Basket Round Wave Pattern Organizer For Laundry Toys Living Room Home Decor
like
Find Similar
Detail showing dimensions of round woven storage basket with white wave pattern design - Small 28*23
Detail view of woven storage basket with 32cm diameter and 27cm height measurements - Medium 32*27
Detail view of woven storage basket showing dimensions 38x32cm and 1040g weight - Large 38*32
Nordic Handmade Paper Rope Woven Storage Basket Round Wave Pattern Organizer For Laundry Toys Living Room Home Decor
$8.65-12.97
No MOQ
Vintage 3-Tier Velvet Jewelry Box with Lock Large Capacity Jewelry Organizer Case for Earrings Rings Necklaces Storage
Vintage 3-Tier Velvet Jewelry Box with Lock Large Capacity Jewelry Organizer Case for Earrings Rings Necklaces Storage
like
Find Similar
Pink velvet jewelry organizer box with multi-layer storage compartments and silver lock - Pink / 24*17*11cm
Three-layer dark green velvet jewelry box with silver lock and organized compartments - Green / 24*17*11cm
Classic black velvet jewelry organizer with drawers, lock, and multi-layer storage - Black / 24*17*11cm
Vintage 3-Tier Velvet Jewelry Box with Lock Large Capacity Jewelry Organizer Case for Earrings Rings Necklaces Storage
-9%
$8.13
No MOQ
 · 
15 views
Velvet Cylindrical Drawstring Makeup Bag Portable Travel Cosmetic Storage Organizer Pouch Soft Velour Large Capacity
Velvet Cylindrical Drawstring Makeup Bag Portable Travel Cosmetic Storage Organizer Pouch Soft Velour Large Capacity
like
Find Similar
Red cylindrical velvet drawstring makeup bag with elegant white patch decoration - Red
Sky blue velvet drawstring cosmetic bag in cylindrical shape for travel storage - Blue
Deep purple velvet cylindrical drawstring makeup bag with decorative white patch - Purple
Pink velvet cylindrical drawstring makeup bag with soft fabric and wooden bead fastener - Rose Red
Velvet Cylindrical Drawstring Makeup Bag Portable Travel Cosmetic Storage Organizer Pouch Soft Velour Large Capacity
-5%
$1.45
No MOQ
Neoprene Insulated Lunch Bag Waterproof Thermal Picnic Tote For School Office Outdoor Storage With Cartoon Printing
Neoprene Insulated Lunch Bag Waterproof Thermal Picnic Tote For School Office Outdoor Storage With Cartoon Printing
like
Find Similar
Detail of black neoprene lunch bag featuring To Do List print with funny emoji icons - To Do List (WCB704)
Detail of waterproof neoprene lunch bag with cute sushi print and pink cutout handle - Sushi Banquet (WCB708)
Detail view of tie-dye neoprene lunch bag with alien print and I Come In Peace text - Peace Alien (WCB711)
Detailed view of neoprene lunch bag featuring cartoon unicorn pattern and black handle - Galaxy Unicorn (WCB712)
+1
Neoprene Insulated Lunch Bag Waterproof Thermal Picnic Tote For School Office Outdoor Storage With Cartoon Printing
$4.90
No MOQ
Cute Plush Animal Tissue Box Cover Lamb Wool Teddy Bear Dog Shape Bow Desktop Storage Holder For Home Office Bathroom
Cute Plush Animal Tissue Box Cover Lamb Wool Teddy Bear Dog Shape Bow Desktop Storage Holder For Home Office Bathroom
like
Find Similar
Plush puppy tissue box holder with black bow in a cozy home decor setting - White
Detail of cute yellow plush bear tissue box with a black bow in a cozy home setting - Yellow
Detail of cute brown plush puppy tissue box cover with a blue ribbon in home setting - Brown
Cute Plush Animal Tissue Box Cover Lamb Wool Teddy Bear Dog Shape Bow Desktop Storage Holder For Home Office Bathroom
$3.31
No MOQ
Handmade Wicker Storage Basket With Leather Handle Natural Willow Fruit Vegetable Picking Basket Rustic Pastoral Kitchen Sundries Organizer Decor
Handmade Wicker Storage Basket With Leather Handle Natural Willow Fruit Vegetable Picking Basket Rustic Pastoral Kitchen Sundries Organizer Decor
like
Find Similar
Detail of hand-woven wicker basket featuring a dark brown leather handle with gold rivets - Leather Handle Style
Close-up of wicker basket showing 24cm diameter and 29cm height dimensions - Willow Woven Basket Style
Detailed close-up of woven willow storage basket with dimensions 28x14x13cm - Willow Woven Handbag Style
Handmade Wicker Storage Basket With Leather Handle Natural Willow Fruit Vegetable Picking Basket Rustic Pastoral Kitchen Sundries Organizer Decor
$5.19-9.22
No MOQ
Cute Cartoon Big Eyes Cotton Rope Woven Bucket Handbag Niche Design Portable Storage Basket For Women Girls
Cute Cartoon Big Eyes Cotton Rope Woven Bucket Handbag Niche Design Portable Storage Basket For Women Girls
like
Find Similar
Handmade black woven bucket bag with large eye accents and a sturdy carrying handle - Black Coal Sprite
Blue woven cotton bucket bag with large eyes design and fringe handles on a table - Blue Coal Sprite
Cute Cartoon Big Eyes Cotton Rope Woven Bucket Handbag Niche Design Portable Storage Basket For Women Girls
-4%
$3.83
No MOQ
Wall Mounted Woven Storage Basket Natural Water Hyacinth Sea Grass Magazine Rack Handcrafted Rustic Home File Organizer
Wall Mounted Woven Storage Basket Natural Water Hyacinth Sea Grass Magazine Rack Handcrafted Rustic Home File Organizer
like
Find Similar
Wall-mounted natural pine wood magazine rack with woven rattan panel in 44x24cm size - 44*10*24CM / Wall Basket Octagonal Mat Style
Handwoven green corn rope wall hanging basket with artificial peony flowers for home decor - Maize Peel Hanging Basket (With Artificial Flower)
Wall Mounted Woven Storage Basket Natural Water Hyacinth Sea Grass Magazine Rack Handcrafted Rustic Home File Organizer
$6.80-10.09
Mix MOQ : 50
Quilted Cotton Floral Sanitary Napkin Storage Bag Portable Zipper Makeup Pouch Small Square Travel Organizer For Women Girls
Quilted Cotton Floral Sanitary Napkin Storage Bag Portable Zipper Makeup Pouch Small Square Travel Organizer For Women Girls
like
Find Similar
Quilted floral makeup bag in cream cotton with zipper and small woven label tag - Cream Floral
Quilted floral makeup bag in beige and blue, stylish portable small square organizer - Sea Blue Floral
Quilted Cotton Floral Sanitary Napkin Storage Bag Portable Zipper Makeup Pouch Small Square Travel Organizer For Women Girls
-5%
$2.05
No MOQ
 · 
13 views
Large Capacity Cosmetic Bag Nylon Waterproof Gingham Pattern Travel Toiletry Organizer Portable Case Makeup Storage
Large Capacity Cosmetic Bag Nylon Waterproof Gingham Pattern Travel Toiletry Organizer Portable Case Makeup Storage
like
Find Similar
Blue travel toiletry bag with red heart pattern and multi-compartment interior - Blue Heart
Macro detail of spacious blue plaid makeup bag with brush slots and mesh pockets - Blue Plaid
Large capacity white cartoon cat makeup bag with red trim and inner brush organizer - Cat and Bear
Large Capacity Cosmetic Bag Nylon Waterproof Gingham Pattern Travel Toiletry Organizer Portable Case Makeup Storage
$12.10
No MOQ
Iron Fruit Basket Metal Wire Hollow Storage Bowl Nordic Style Tabletop Decor Organizer For Kitchen Living Room
Iron Fruit Basket Metal Wire Hollow Storage Bowl Nordic Style Tabletop Decor Organizer For Kitchen Living Room
like
Find Similar
Nordic gold wire metal fruit basket minimalist hollow round storage bowl 35cm x 7cm - Large Flat Bottom (Diameter 35CM Height 7CM) / Gold
Minimalist black wire fruit basket with wavy edge, 35cm diameter metal storage bowl - Large Flat Bottom (Diameter 35CM Height 7CM) / Black
Black round wire metal fruit basket with wave edge design measuring 30cm in diameter - Small Flat Bottom (Diameter 30CM Height 6CM) / Black
NewIron Fruit Basket Metal Wire Hollow Storage Bowl Nordic Style Tabletop Decor Organizer For Kitchen Living Room
-5%
$2.74-3.56
No MOQ
Quilted Strawberry Makeup Bag Large Capacity Striped Toiletry Organizer Pouch Travel Aesthetic Cosmetic Storage Case
Quilted Strawberry Makeup Bag Large Capacity Striped Toiletry Organizer Pouch Travel Aesthetic Cosmetic Storage Case
like
Find Similar
Blue striped quilted makeup bag with red strawberry patterns and top handle strap - Pillow Bag / Blue Strawberry Pillow Bag
Quilted yellow striped makeup bag with strawberry print and side carrying handle - Pillow Bag / Yellow Strawberry Pillow Bag
Pink striped quilted makeup bag with strawberry patterns and a side carry handle - Pillow Bag / Pink Strawberry Pillow Bag
Quilted Strawberry Makeup Bag Large Capacity Striped Toiletry Organizer Pouch Travel Aesthetic Cosmetic Storage Case
$2.16
No MOQ
 · 
30 views
Mini Lipstick Storage Bag PU Leather Cross Grain Built-in Mirror Retro Sunflower Metal Clasp Portable Makeup Pouch For Women
Mini Lipstick Storage Bag PU Leather Cross Grain Built-in Mirror Retro Sunflower Metal Clasp Portable Makeup Pouch For Women
like
Find Similar
Mini black cross-grain leather makeup bag with daisy clasp held in person's hand - Black
Mini Lipstick Storage Bag PU Leather Cross Grain Built-in Mirror Retro Sunflower Metal Clasp Portable Makeup Pouch For Women
$1.70
No MOQ
 · 
31 views
Cloud Floating Wall Shelf Iron Metal Wood Decorative Storage Rack For Living Room Bedroom Nordic Style
Cloud Floating Wall Shelf Iron Metal Wood Decorative Storage Rack For Living Room Bedroom Nordic Style
like
Find Similar
Nordic gold cloud floating shelf with wooden base and dimensions in 17x12 cm size - 17x12x9.5cm / Small Cloud Shelf - Gold
Black iron cloud-shaped wall shelf with a wooden base, 17cm wide decorative storage rack - 17x12x9.5cm / Small Cloud Shelf - Black
Cloud shaped gold metal wall shelf with wooden base, size 23x15x9.5cm dimensions - 23x15x9.5cm / Medium Cloud Shelf - Gold
Cloud-shaped black iron wall shelf with wooden base, 23cm width minimalist storage rack - 23x15x9.5cm / Medium Cloud Shelf - Black
+4
Cloud Floating Wall Shelf Iron Metal Wood Decorative Storage Rack For Living Room Bedroom Nordic Style
$2.02-7.78
Mix MOQ : 2
Portable Lunch Insulation Bag Oxford Cloth Aluminum Foil Thermal Handbag For Soup Cup Food Storage Cartoon Whale Pattern
Portable Lunch Insulation Bag Oxford Cloth Aluminum Foil Thermal Handbag For Soup Cup Food Storage Cartoon Whale Pattern
like
Find Similar
Pink insulated soup cup bag with cute whale prints and portable handle for kids - Large (φ12.5*h21.5cm) / Pink Whale Style (A07-A10)
Portable insulated soup cup bag with dark blue cartoon ocean whale patterns and handle - Large (φ12.5*h21.5cm) / Blue Whale Style (A07-A10)
Portable Lunch Insulation Bag Oxford Cloth Aluminum Foil Thermal Handbag For Soup Cup Food Storage Cartoon Whale Pattern
$2.19
No MOQ
Go to

More in home & kitchen

Explore more in storage containers

storagetravelmetalsteelheartfliplayerbottlesdecorativedesign
plasticroundpethomebucketbabyholderdiywindowface

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access