Everful

Wholesale purse chains

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Purse Chains

Find the perfect pieces: handbags, shoulder bags, crossbody bags and more

All products in purse chains

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Children Flower Frame Sunglasses Plastic Resin Eyewear With Detachable Decorative Chain For Toddlers Babies
Children Flower Frame Sunglasses Plastic Resin Eyewear With Detachable Decorative Chain For Toddlers Babies
like
Find Similar
Pink flower-shaped sunglasses for kids with matte plastic frame and cute floral design - Single Frame / Pink
Kids purple flower shaped sunglasses with a stylish matte finish on a wooden display - Single Frame / Purple
Blue flower shaped children sunglasses frame for girls on a wooden display tray - Single Frame / Blue
Children's mint blue flower shaped sunglasses on a wavy wooden tray for kids - Single Frame / Green
+12
Children Flower Frame Sunglasses Plastic Resin Eyewear With Detachable Decorative Chain For Toddlers Babies
-4%
$0.96-1.92
No MOQ
Women Elegant Satin Long Silk Scarf Vintage Geometric Chain Printed Neck Neckerchief Office Lady Hair Bag Ribbon Tie Accessory
Women Elegant Satin Long Silk Scarf Vintage Geometric Chain Printed Neck Neckerchief Office Lady Hair Bag Ribbon Tie Accessory
like
Find Similar
Long silk-like scarf with geometric patterns in orange and blue tied on a white backdrop - Color Block Beige Blue
Detail of red and black abstract silk scarf tied in a knot on a white textile background - Oil Painting Rose Red
Pink and blue patterned silk scarf tied in a knot on a white textured background - Apricot Blossom Pink
Long silk scarf in orange and blue abstract patterns on a professional white background - Apricot Blossom Orange
+14
Women Elegant Satin Long Silk Scarf Vintage Geometric Chain Printed Neck Neckerchief Office Lady Hair Bag Ribbon Tie Accessory
$1.50
No MOQ
 · 
17 views
Adjustable Braided Glasses Chain With Leather Connector And Metal Buckle Anti-Loss Eyewear Neck Strap Fashion
Adjustable Braided Glasses Chain With Leather Connector And Metal Buckle Anti-Loss Eyewear Neck Strap Fashion
like
Find Similar
Detail of dark brown braided eyewear chain with leather accents and gold metal clasps - Coffee
Adjustable black and white braided glasses chain with brown leather and metal hooks - Black
Adjustable woven eyewear chain in deep blue and white with brown faux leather accents - Dark Blue
Adjustable dark brown faux leather and black woven eyewear chain with gold lobster clips - White
+6
Adjustable Braided Glasses Chain With Leather Connector And Metal Buckle Anti-Loss Eyewear Neck Strap Fashion
$5.76
No MOQ
 · 
12 views
Free Shipping
Vintage Tweed Newsboy Cap For Women Chain Decor Flat Top Beret Military Style Woven Cotton Blend Casual Fashion Painter Hat
Vintage Tweed Newsboy Cap For Women Chain Decor Flat Top Beret Military Style Woven Cotton Blend Casual Fashion Painter Hat
like
Find Similar
Light blue tweed baker boy hat with gold chain detail and black leather brim - 56-59cm / Light Blue
Detail of blue tweed newsboy cap with gold chain decoration and black leather brim - 56-59cm / Blue
Detail of caramel tweed newsboy cap with gold chain accent and black leather brim trim - 56-59cm / Caramel Orange
White tweed newsboy cap with gold chain accent and black faux leather brim detail - 56-59cm / White
+5
Vintage Tweed Newsboy Cap For Women Chain Decor Flat Top Beret Military Style Woven Cotton Blend Casual Fashion Painter Hat
$6.34
No MOQ
 · 
20 views
Straw Fedora Hat With Large Gold Metal Chain Wide Brim Sun Protection Summer Beach Jazz Panama Style For Women Men
Straw Fedora Hat With Large Gold Metal Chain Wide Brim Sun Protection Summer Beach Jazz Panama Style For Women Men
like
Find Similar
Flat top straw fedora hat in khaki with a thick decorative rose gold metal chain band - Khaki
Detail showing bright yellow straw fedora hat featuring a chunky gold metal chain link - Yellow
Detail of light blue straw boater hat featuring a thick gold chain decoration - Sky Blue
Close-up of sky blue woven straw jazz hat featuring a chunky gold chain embellishment - Lake Blue
+15
Straw Fedora Hat With Large Gold Metal Chain Wide Brim Sun Protection Summer Beach Jazz Panama Style For Women Men
$3.89
Mix MOQ : 2
Crystal Crushed Stone Glasses Chain Polymer Clay Beaded Mask Lanyard Colorful Anti-Lost Strap For Women Boho Eyewear Accessory
Crystal Crushed Stone Glasses Chain Polymer Clay Beaded Mask Lanyard Colorful Anti-Lost Strap For Women Boho Eyewear Accessory
like
Find Similar
Macro detail of beaded eyewear chain with colorful resin beads and gold-tone metal spacers - Pink
Detail of beaded eyewear chain with green stones, golden accents and silicone loops - Green
Detailed view of the handcrafted purple crystal and clay bead eyeglass chain with lobster clasps - Purple
Detail of blue lapis lazuli beaded eyewear chain with gold lobster clasps and rubber loops - Blue
+3
Crystal Crushed Stone Glasses Chain Polymer Clay Beaded Mask Lanyard Colorful Anti-Lost Strap For Women Boho Eyewear Accessory
-4%
$2.55
Mix MOQ : 10
 · 
13 views
Free Shipping
Vintage PU Leather Military Navy Hat For Men Women Fashion British Style Flat Top Cap With Metal Chain Anchor Decoration
Vintage PU Leather Military Navy Hat For Men Women Fashion British Style Flat Top Cap With Metal Chain Anchor Decoration
like
Find Similar
Side view detail of black leather military hat with silver metal chain and anchor emblem - M (56-58cm) / Chain Style Black
Detail view of black PU leather military cap with silver metal studs and smooth texture - M (56-58cm) / Metal Marker Style Black
Vintage PU Leather Military Navy Hat For Men Women Fashion British Style Flat Top Cap With Metal Chain Anchor Decoration
$5.04
No MOQ
Long Tassel Hair Chain With Star Rhinestone Alloy Braid Clips For Women Sparkly Hair Jewelry Accessory For Parties Boho Style
Long Tassel Hair Chain With Star Rhinestone Alloy Braid Clips For Women Sparkly Hair Jewelry Accessory For Parties Boho Style
like
Find Similar
Sparkling silver double-row rhinestone hair chain with black duckbill clip for women - Rhinestone Braid Chain (1pc 2 Strands)
Elegant silver star hair chain with sparkling rhinestones for braided hairstyles - Sparkling Rhinestone & Crystal Braid Chain (1pc 2 Strands)
Star-shaped silver hair chain hairpiece featuring delicate cascading metallic strands - Star Braid Chain (1pc 4 Strands)
Silver multi-layer tassel hair chain with crystal beads and sparkling fringe detail - White Faux Crystal Braid Chain (1pc 4 Strands)
+7
Long Tassel Hair Chain With Star Rhinestone Alloy Braid Clips For Women Sparkly Hair Jewelry Accessory For Parties Boho Style
-5%
$0.46-3.68
No MOQ
 · 
13 sold recently
Free Shipping
Luxury Rhinestone Gemstone Bracelet Chain Phone Case TPU Hand Strap Protective Cover Vintage Shiny For Women
Luxury Rhinestone Gemstone Bracelet Chain Phone Case TPU Hand Strap Protective Cover Vintage Shiny For Women
like
Find Similar
Black matte case for iPhone with luxury gold chain featuring large black square rhinestones - Black (with Black Gemstone Bracelet) / iPhone 13PRO
Creamy white iPhone case with luxury gold chain and sparkling rhinestones - Cream White (with White Gemstone Bracelet) / iPhone 13PRO
Black matte iPhone case featuring a luxury emerald gemstone and gold chain strap - Black (with Green Gemstone Bracelet) / iPhone 13PRO
+81
Luxury Rhinestone Gemstone Bracelet Chain Phone Case TPU Hand Strap Protective Cover Vintage Shiny For Women
-9%
$2.75
No MOQ
Transparent Rhinestone Rabbit Phone Case Luxury Rose Flower Border Protective Cover With Bead Wrist Chain Girly Style
Transparent Rhinestone Rabbit Phone Case Luxury Rose Flower Border Protective Cover With Bead Wrist Chain Girly Style
like
Find Similar
Luxury rhinestone iPhone case with sparkling bunny and pink rose crystal decorations - iPhone 7/8/SE 2020 / Pink (With Lanyard)
Detailed view of iPhone case with purple roses, luxury rhinestones and rabbit motif - iPhone 7/8/SE 2020 / Purple (With Lanyard)
+52
Transparent Rhinestone Rabbit Phone Case Luxury Rose Flower Border Protective Cover With Bead Wrist Chain Girly Style
-8%
$3.67
No MOQ
Butterfly Brooch Alloy Rhinestone Black Enamel Wrinkled Design Double Layer Tassel Chain Pins For Suits Women
Butterfly Brooch Alloy Rhinestone Black Enamel Wrinkled Design Double Layer Tassel Chain Pins For Suits Women
like
Find Similar
Fashionable black butterfly tassel brooch with silver frame for stylish suit accessories - Brooch - Black
Butterfly Brooch Alloy Rhinestone Black Enamel Wrinkled Design Double Layer Tassel Chain Pins For Suits Women
-8%
$1.55
No MOQ
 · 
10 views
Free Shipping
Women Gold Waist Chain Stainless Steel Beaded Body Jewelry For Summer Beach Bikini Sexy Trendy Accessory
Women Gold Waist Chain Stainless Steel Beaded Body Jewelry For Summer Beach Bikini Sexy Trendy Accessory
like
Find Similar
Minimalist gold tone body chain with olive shaped beads shown on model waistline - Gold Oval Beads Style (I605)
Sleek gold snake chain waist body jewelry for women made of durable stainless steel - Gold Blade Snake Chain Style (I606)
Chic golden stainless steel waist chain with beads for women's summer body jewelry - Gold Round Beads Snake Chain Style (I605)
Minimalist golden beaded waist chain for women with delicate stainless steel snake links - Gold Round Beads Cable Chain Style (I606)
Women Gold Waist Chain Stainless Steel Beaded Body Jewelry For Summer Beach Bikini Sexy Trendy Accessory
$1.78-2.05
No MOQ
 · 
14 views
Free Shipping
Handmade Beaded Glasses Chain Colorful Glass Seed Bead Eyeglass Lanyard Anti-Lost Mask Strap Bohemian Alloy Lobster Clasp
Handmade Beaded Glasses Chain Colorful Glass Seed Bead Eyeglass Lanyard Anti-Lost Mask Strap Bohemian Alloy Lobster Clasp
like
Find Similar
Detail of beaded eyewear chains featuring champagne and silver beads with metal lobster clasps - 1# (Champagne Gold & Silver White Mixed)
Close-up of colorful beaded chain with silver lobster clasps and white silicone loops - 2# (Pink Purple White Mixed)
Detail of colorful beaded eyewear chain featuring glass beads and silver lobster clasps - 3# (Navy Light Blue Red Amber Mixed)
Detail of blue beaded glasses chain with silver metal clips and rubber loop connectors - 4# (Translucent Blue)
+5
Handmade Beaded Glasses Chain Colorful Glass Seed Bead Eyeglass Lanyard Anti-Lost Mask Strap Bohemian Alloy Lobster Clasp
-4%
$0.69
No MOQ
 · 
26 sold recently
Fashion Cat Eye Sunglasses Large Square Frame With Metal Chain Temples UV400 Protection Trendy Retro Eyewear For Women
Fashion Cat Eye Sunglasses Large Square Frame With Metal Chain Temples UV400 Protection Trendy Retro Eyewear For Women
like
Find Similar
Fashion square cat-eye sunglasses in black with unique gold metal chain hollowed temples - Black Frame Black Grey Lens
Chic cat eye sunglasses with purple tortoiseshell frames and gold hollow chain temples - Purple Frame Champagne Lens
White square cat-eye sunglasses with purple gradient lenses and black chain arms - White Frame Gradient Grey Lens
Fashionable square leopard sunglasses with gradient brown lenses and gold chain arms - Leopard Frame / Tea Lens
+2
Fashion Cat Eye Sunglasses Large Square Frame With Metal Chain Temples UV400 Protection Trendy Retro Eyewear For Women
$2.88
No MOQ
 · 
16 views
Stainless Steel Butterfly Anklet For Women With Zirconia Charms Adjustable Figaro Chain Summer Beach Foot Jewelry
Stainless Steel Butterfly Anklet For Women With Zirconia Charms Adjustable Figaro Chain Summer Beach Foot Jewelry
like
Find Similar
Gold stainless steel Figaro chain anklet with butterfly charms and zircon details - Gold Butterfly Style (C5133)
Minimalist stainless steel butterfly anklet with crystals on champagne silk display - Silver Butterfly Style (C5134)
Stainless Steel Butterfly Anklet For Women With Zirconia Charms Adjustable Figaro Chain Summer Beach Foot Jewelry
$0.97-2.07
No MOQ
Free Shipping
Quilted Leather Phone Case Wallet Card Holder Camellia Artificial Pearl Crossbody Chain Strap
Quilted Leather Phone Case Wallet Card Holder Camellia Artificial Pearl Crossbody Chain Strap
like
Find Similar
Detail of black quilted leather iPhone case with pearl camellia charm and crossbody chain - Black (Camellia Pearl Chain Wallet) / iPhone 7/8/SE 2020
Detail of cream quilted iPhone case featuring camellia card holder and pearl strap - Apricot (Camellia Pearl Chain Wallet) / iPhone 7/8/SE 2020
+64
NewQuilted Leather Phone Case Wallet Card Holder Camellia Artificial Pearl Crossbody Chain Strap
-9%
$3.41
No MOQ
Folding Screen Phone Case Lychee Texture Faux Leather Rhinestone Bear Decor Alloy Chain Crossbody Shoulder Strap Elegant
Folding Screen Phone Case Lychee Texture Faux Leather Rhinestone Bear Decor Alloy Chain Crossbody Shoulder Strap Elegant
like
Find Similar
Pink lychee leather flip phone case with rhinestone bear charm and chain strap - Electroplated Rhinestone Bear-Short Chain / Pink / Samsung Z Fold3
Detail of black lychee leather folding case with gold chain strap and rhinestone bear charm - Electroplated Rhinestone Bear-Short Chain / Black / Samsung Z Fold3
Detail of apricot litchi leather case with silver bear charm and gold chain strap - Electroplated Rhinestone Bear-Short Chain / Khaki / Samsung Z Fold3
Detail of cream leather flip case featuring plush bear and gold chain crossbody strap - Electroplated Rhinestone Bear-Short Chain / Beige / Samsung Z Fold3
+71
Folding Screen Phone Case Lychee Texture Faux Leather Rhinestone Bear Decor Alloy Chain Crossbody Shoulder Strap Elegant
-9%
$3.41
No MOQ
3D Camellia Flower iPhone Case Soft TPU Wave Edge Shimmer Glitter Cover With Beaded Hand Chain Strap Elegant Women
3D Camellia Flower iPhone Case Soft TPU Wave Edge Shimmer Glitter Cover With Beaded Hand Chain Strap Elegant Women
like
Find Similar
Detail of iPhone case with white glitter fluid texture and gold rose ornament - Creamy White Camellia Style / iPhone 7/8/SE 2020
Close-up of wavy clear edge iPhone case with glitter silver marbling and gold rose charm - Silver Grey Camellia Style / iPhone 7/8/SE 2020
iPhone case with white glitter marble pattern, gold rose relief, and pearl hand chain - Creamy White Camellia With Bead Chain / iPhone 7/8/SE 2020
Luxury glitter epoxy iPhone case with 3D gold rose and iridescent pearl bead strap - Silver Grey Camellia With Bead Chain / iPhone 7/8/SE 2020
+120
3D Camellia Flower iPhone Case Soft TPU Wave Edge Shimmer Glitter Cover With Beaded Hand Chain Strap Elegant Women
-9%
$1.26-2.17
No MOQ
Plating Silver Balloon Dog Heart Phone Case For IPhone Wave Border Shockproof Luxury TPU Back Cover Faux Artificial Pearl Hand Chain
Plating Silver Balloon Dog Heart Phone Case For IPhone Wave Border Shockproof Luxury TPU Back Cover Faux Artificial Pearl Hand Chain
like
Find Similar
White marble iPhone case with silver balloon dog, heart motifs and pearl wrist chain strap - Silver With Chain / iPhone 7/8/SE 2020
Silver wavy frame phone case with balloon dog and heart for iPhone 17 Pro Max - Silver Without Chain / iPhone 7/8/SE 2020
+58
Plating Silver Balloon Dog Heart Phone Case For IPhone Wave Border Shockproof Luxury TPU Back Cover Faux Artificial Pearl Hand Chain
-9%
$1.70-2.62
No MOQ
Electroplated Silver Mirror Smartphone Case With White Camellia Rhinestone Wave Edge And Matching Beaded Chain Strap
Electroplated Silver Mirror Smartphone Case With White Camellia Rhinestone Wave Edge And Matching Beaded Chain Strap
like
Find Similar
Close-up of silver plating phone case with 3D camellia flowers and pearl bow charm - Silver Camellia + Heavy Chain / iPhone 7/8/SE 2020
Silver plated wavy phone case for iPhone with 3D camellia flower and rhinestone decor - Silver Camellia (No Chain) / iPhone 7/8/SE 2020
+56
Electroplated Silver Mirror Smartphone Case With White Camellia Rhinestone Wave Edge And Matching Beaded Chain Strap
-9%
$1.96-2.75
No MOQ
3D Artificial Pearl Butterfly Smartphone Case With Hand Strap Chain Rhinestone Glitter Luxury Resin Protective Cover For Women Girls
3D Artificial Pearl Butterfly Smartphone Case With Hand Strap Chain Rhinestone Glitter Luxury Resin Protective Cover For Women Girls
like
Find Similar
iPhone glitter case featuring 3D pearl butterflies and a matching luxury bead wrist strap - Style with Pearl Chain (Electroplated White Glitter Butterfly) / iPhone 7/8/SE 2020
Luxe 3D pearl butterfly phone case for iPhone with elegant rhinestone decorations - Basic Style (Electroplated White Glitter Butterfly) / iPhone 7/8/SE 2020
+58
3D Artificial Pearl Butterfly Smartphone Case With Hand Strap Chain Rhinestone Glitter Luxury Resin Protective Cover For Women Girls
-9%
$1.83-2.62
No MOQ
Glitter Bow Phone Case Crossbody Chain For IPhone TPU Soft Shell Rhinestone Artificial Pearl Shoulder Strap Sweet Girly Accessory
Glitter Bow Phone Case Crossbody Chain For IPhone TPU Soft Shell Rhinestone Artificial Pearl Shoulder Strap Sweet Girly Accessory
like
Find Similar
Detailed shot of transparent phone case with glitter bows and heart-shaped rhinestones - Electroplated Frame Glitter Drip Glue 3D Bow (iPhone 16E)
Glitter bow iPhone case with pearl crossbody chain strap and heart charms on clear shell - Electroplated Case + 3D Bow Back Clip + Chain (iPhone 16E)
White glitter bow phone case with pearl chain strap for iPhone, shown in hand display - (back Clip) Cute Girl Bow + Chain / Back Clip
+58
Glitter Bow Phone Case Crossbody Chain For IPhone TPU Soft Shell Rhinestone Artificial Pearl Shoulder Strap Sweet Girly Accessory
-9%
$1.44-4.06
No MOQ
Free Shipping
Phone Case Wrinkled PU Leather Artificial Pearl Heart Ornament With Elegant Wrist Strap Chain Bowknot Pendant Chic Protection
Phone Case Wrinkled PU Leather Artificial Pearl Heart Ornament With Elegant Wrist Strap Chain Bowknot Pendant Chic Protection
like
Find Similar
Detail of silver textured iPhone case featuring a pearl heart design and purple wrist strap - Pearlescent Hollow Heart Bow Pearl Chain / Silver / iPhone 16e
Detail of cream leather iPhone case with pearl heart embellishment and wrist strap - Pearlescent Hollow Heart Bow Pearl Chain / White / iPhone 16e
Detail of pink leather phone case with pearl heart and matching wristlet strap - Pearlescent Hollow Heart Bow Pearl Chain / Pink / iPhone 16e
Detail of black wrinkled leather phone case with pearl heart and large wrist strap - Large-hole Pearlescent Pattern - English Lettering Openwork Pearl Heart - Bow Pearl Strand - Black / iPhone 16e
+192
Phone Case Wrinkled PU Leather Artificial Pearl Heart Ornament With Elegant Wrist Strap Chain Bowknot Pendant Chic Protection
-9%
$2.70
No MOQ
Foldable Phone Case Wrinkled PU Leather Heart Decor Artificial Pearl Wristlet Chain Bow Knot Elegant Chic Accessory Style
Foldable Phone Case Wrinkled PU Leather Heart Decor Artificial Pearl Wristlet Chain Bow Knot Elegant Chic Accessory Style
like
Find Similar
Detail of pearl white leather case for Z Flip with pearl chain and heart charms - Pearlescent White-Cat Eye Heart Pearl Chain / Compatible for Z Flip 3
Pink lychee leather phone case with 3D heart and large faux pearl wrist strap detail - Pearlescent Pink-Cat Eye Heart Pearl Chain / Compatible for Z Flip 3
Detail of black pleated leather phone case with heart charms and large pearl wrist strap - Pearlescent Black-Cat Eye Heart Pearl Chain / Compatible for Z Flip 3
Silver pleated leather folding case for Samsung Z Flip with green heart and pearl wrist strap - Pearlescent Silver-Cat Eye Heart Pearl Chain / Compatible for Z Flip 3
+56
Foldable Phone Case Wrinkled PU Leather Heart Decor Artificial Pearl Wristlet Chain Bow Knot Elegant Chic Accessory Style
-9%
$3.35
No MOQ
Bow Leather Phone Case For iPhone 16 17 Pro Max Artificial Pearl Wrist Strap Chain Wrinkled Texture Polka Dot Fashion Style Women
Bow Leather Phone Case For iPhone 16 17 Pro Max Artificial Pearl Wrist Strap Chain Wrinkled Texture Polka Dot Fashion Style Women
like
Find Similar
Detail of light blue pleated leather iPhone case with pearl strap and bow accessory - Blue / iPhone 16e
Detail of light green leather iPhone case with bowknot and luxury pearl wrist strap - Green / iPhone 16e
Close-up of silver wrinkled leather iPhone case with polka dot bow and pearl wrist strap - Silver / iPhone 16e
Detail of purple leather phone case with white polka dot bow and pearl wrist strap - Purple / iPhone 16e
+192
Bow Leather Phone Case For iPhone 16 17 Pro Max Artificial Pearl Wrist Strap Chain Wrinkled Texture Polka Dot Fashion Style Women
-8%
$2.57
No MOQ
Free Shipping
Phone Case Crinkled Faux Leather Rhinestone Letter Decor Star Bow Charm Chain Strap
Phone Case Crinkled Faux Leather Rhinestone Letter Decor Star Bow Charm Chain Strap
like
Find Similar
Close-up of cream leather iPhone case with rhinestone logo and beaded star star charm - Pearlescent Rhinestone Letter M Star Chain - White / iPhone 17 Pro Max
Pink pleated leather iPhone case featuring rhinestone miu logo and beaded star chain strap - Pearlescent Rhinestone Letter M Star Chain - Pink / iPhone 17 Pro Max
Detail of black wrinkled leather iPhone case with rhinestone logo and beaded wrist strap - Pearlescent Rhinestone Letter M Star Chain - Black / iPhone 17 Pro Max
Detail of light blue wrinkled leather iPhone case with rhinestone MU and star chain charm - Pearlescent Rhinestone Letter M Star Chain - Blue / iPhone 17 Pro Max
+199
Phone Case Crinkled Faux Leather Rhinestone Letter Decor Star Bow Charm Chain Strap
-9%
$2.96
No MOQ
Free Shipping
Phone Case With Card Wallet PU Leather Crossbody Chain Faux Artificial Pearl Strap Wristband Protective Cover
Phone Case With Card Wallet PU Leather Crossbody Chain Faux Artificial Pearl Strap Wristband Protective Cover
like
Find Similar
Detail of black leather case with 3D bow card holder and pearl crossbody chain - iPhone 17 Pro Max / Big Eye Triangle Wrist Wallet - Pearl Leather Chain - Black
Detail of cream white phone case with pearl chain strap and integrated leather card slot - iPhone 17 Pro Max / Big Eye Triangle Wrist Wallet - Pearl Leather Chain - Rice White
+58
Phone Case With Card Wallet PU Leather Crossbody Chain Faux Artificial Pearl Strap Wristband Protective Cover
-9%
$2.62
No MOQ
Wide Brim Fedora Hat Wool Felt Texture Retro Jazz Style For Women Men Kids Chain Decor Wide Edge Fashion Accessory Outdoor
Wide Brim Fedora Hat Wool Felt Texture Retro Jazz Style For Women Men Kids Chain Decor Wide Edge Fashion Accessory Outdoor
like
Find Similar
Detail of bright green wool fedora hat featuring a chunky black chain band decoration - Adult 57-60cm / Burgundy with White Chain
Close-up of brown wool felt fedora hat featuring a stylish black chain band decoration - Adult 57-60cm / White with White Chain
Detail of dark brown wool fedora hat featuring a chunky black fashion chain decoration - Adult 57-60cm / Grey with White Chain
Close-up of brick red wool fedora hat featuring a chunky black decorative chain band - Adult 57-60cm / Yellow with White Chain
+46
Wide Brim Fedora Hat Wool Felt Texture Retro Jazz Style For Women Men Kids Chain Decor Wide Edge Fashion Accessory Outdoor
$4.18
Mix MOQ : 2
Wide Brim Fedora Hat Woolen Felt Silver Metal Chain Indented Crown Modern Retro Jazz Cap Unisex Fashion Accessory
Wide Brim Fedora Hat Woolen Felt Silver Metal Chain Indented Crown Modern Retro Jazz Cap Unisex Fashion Accessory
like
Find Similar
Detail of rust red wool fedora hat featuring a thick silver metal chain decoration - Adult 57-60cm / Caramel Hat Silver Chain
Detailed view of burgundy wool fedora hat with a decorative silver metal chain band - Adult 57-60cm / Wine Red Hat Silver Chain
Detail of fuchsia wool fedora hat featuring a shiny silver metal chain band accessory - Adult 57-60cm / Rose Red Hat Silver Chain
Macro view of bright green felt fedora hat featuring thick silver metal chain decoration - Adult 57-60cm / Grass Green Hat Silver Chain
+46
Wide Brim Fedora Hat Woolen Felt Silver Metal Chain Indented Crown Modern Retro Jazz Cap Unisex Fashion Accessory
$4.18
Mix MOQ : 2
Wide Brim Fedora Hat Wool Felt Elegant Vintage Flat Top With Pink Chain Decoration For Women Fashion
Wide Brim Fedora Hat Wool Felt Elegant Vintage Flat Top With Pink Chain Decoration For Women Fashion
like
Find Similar
Detail of black wool fedora hat featuring a chunky pink chain link band on flat brim - Adult 57-60cm / Black with Pink Chain
Detailed texture of khaki wool fedora featuring a vibrant pink chunky chain decoration - Adult 57-60cm / Khaki with Pink Chain
Detail of navy wool fedora hat featuring a bold neon pink chunky chain accessory - Adult 57-60cm / Dark Blue with Pink Chain
Detail of a beige wool fedora hat featuring a stylish pink chunky resin chain band - Adult 57-60cm / Beige with Pink Chain
+46
Wide Brim Fedora Hat Wool Felt Elegant Vintage Flat Top With Pink Chain Decoration For Women Fashion
$4.18
Mix MOQ : 2
Stainless Steel Box Chain Glasses Chain With Anti-Slip Adjustable Silicone Loops Eyewear Strap For Sunglasses
Stainless Steel Box Chain Glasses Chain With Anti-Slip Adjustable Silicone Loops Eyewear Strap For Sunglasses
like
Find Similar
1 option
Stainless Steel Box Chain Glasses Chain With Anti-Slip Adjustable Silicone Loops Eyewear Strap For Sunglasses
$1.73
No MOQ
Free Shipping
Elegant Alloy Rhinestone Butterfly Hair Claw Clip Long Tassel Chain Dangle Shark Clip Hair Jewelry Accessories For Women
Elegant Alloy Rhinestone Butterfly Hair Claw Clip Long Tassel Chain Dangle Shark Clip Hair Jewelry Accessories For Women
like
Find Similar
Detail of golden metal claw clip with long tassels and brown beads on low bun hairstyle - Rectangle
Detailed view of large golden metal shark hair claw with long amber bead tassel chains - Semicircle
Close-up of golden metal butterfly hair claw with long dangling crystal tassel chains - Hollow Butterfly C3236
Close-up of golden metal hair claw clip with tassels and amber crystal beads on dark hair - Circular B2533
+1
Elegant Alloy Rhinestone Butterfly Hair Claw Clip Long Tassel Chain Dangle Shark Clip Hair Jewelry Accessories For Women
$1.44
Mix MOQ : 2
Retro Chain Print Satin Imitation Satin Square Scarf Large Luxury Baroque Style Headscarf Hijab Hair Wrap For Women
Retro Chain Print Satin Imitation Satin Square Scarf Large Luxury Baroque Style Headscarf Hijab Hair Wrap For Women
like
Find Similar
Deep brown satin headscarf with vintage chain and rope prints shown tied on a model - Recommended Color
Navy blue and orange chain print satin headscarf in 90x90cm silk-like fabric for women - Navy Orange
90cm satin scarf with red, blue and white paisley chain print tied on hair - Red Edge Navy
Pink satin square scarf with gold chain and blue ring pattern styled on head - Pink
+25
Retro Chain Print Satin Imitation Satin Square Scarf Large Luxury Baroque Style Headscarf Hijab Hair Wrap For Women
-15%
$1.35
Mix MOQ : 2
Oversized Square Sunglasses For Women Gradient Resin Lens Metal Chain Temples UV400 Protection Fashion Eyewear
Oversized Square Sunglasses For Women Gradient Resin Lens Metal Chain Temples UV400 Protection Fashion Eyewear
like
Find Similar
Oversized geometric chain sunglasses with all grey lenses and gold metal temples - Solid Grey
Square oversized sunglasses with double grey gradient lenses and golden chain metal temples - Gradient Grey
Square oversized sunglasses featuring grey yellow gradient lenses and gold chain temples - Gray Yellow
Oversized tea pink gradient sunglasses with chain-textured ivory temples and metal rivets - Tea Pink Gradient
Oversized Square Sunglasses For Women Gradient Resin Lens Metal Chain Temples UV400 Protection Fashion Eyewear
$3.31
No MOQ
 · 
12 sold recently
Women Wide Corset Belt Elastic Faux Leather Punk Rivets Triple Layer Gold Metal Chains Fashion Waist Cinch For Dresses
Women Wide Corset Belt Elastic Faux Leather Punk Rivets Triple Layer Gold Metal Chains Fashion Waist Cinch For Dresses
like
Find Similar
1 option
Women Wide Corset Belt Elastic Faux Leather Punk Rivets Triple Layer Gold Metal Chains Fashion Waist Cinch For Dresses
$5.19
No MOQ
 · 
1 reviews
Layered Imitation Artificial Pearl Tassel Brooch Chain With Star Charm Fashion Suit Clothes Pin For Women Wedding Banquet Jewelry
Layered Imitation Artificial Pearl Tassel Brooch Chain With Star Charm Fashion Suit Clothes Pin For Women Wedding Banquet Jewelry
like
Find Similar
Elegant multi-layer pearl fringe brooch with star chain for black suit decoration - Pearl Layered Tassel Style (0081) / Gold Style 0081
Detail of layered faux pearl shoulder chain and star tassel brooch on a black blazer - Pearl Layered Tassel Style (0081) / White K Style 0081
Star charm chain brooch with faux pearls on a black blazer with layered metallic fringe - Star Chain Pearl Style (0082) / White K Style 0082
Layered Imitation Artificial Pearl Tassel Brooch Chain With Star Charm Fashion Suit Clothes Pin For Women Wedding Banquet Jewelry
-9%
$2.31-2.78
Mix MOQ : 3
Free Shipping
Fedora Hat Wide Brim Felt Jazz Cap With Plastic Chain Decor Retro Solid Color Unisex Fashion Outdoor Accessories
Fedora Hat Wide Brim Felt Jazz Cap With Plastic Chain Decor Retro Solid Color Unisex Fashion Outdoor Accessories
like
Find Similar
Detailed texture of brown wool felt boater hat with a bold green chain accent - Adult 57-60cm / Brown With Green Chain (01)
Detail of black wool fedora hat featuring a decorative light green thick chain accessory - Adult 57-60cm / Black With Green Chain (02)
Close-up of beige wool wide brim hat with a stylish green plastic chain decoration - Adult 57-60cm / Beige With Green Chain (03)
Close-up of pink wool fedora hat featuring a bold matte green chunky chain accessory - Adult 57-60cm / Pink With Green Chain (04)
+44
NewFedora Hat Wide Brim Felt Jazz Cap With Plastic Chain Decor Retro Solid Color Unisex Fashion Outdoor Accessories
$4.18
Mix MOQ : 2
Phone Case With Pleated Fabric Bow Metal Lock Crossbody Chain PU Leather Card Holder Rhinestone Smile For iPhone
Phone Case With Pleated Fabric Bow Metal Lock Crossbody Chain PU Leather Card Holder Rhinestone Smile For iPhone
like
Find Similar
Close-up of black leather case with a large bow, gold lock, and black-gold chain strap - iPhone 7/8/SE 2020 / Black
Detail of cream bow phone case with crossbody metal chain strap and Smile ornament - iPhone 7/8/SE 2020 / Apricot
+60
Phone Case With Pleated Fabric Bow Metal Lock Crossbody Chain PU Leather Card Holder Rhinestone Smile For iPhone
-9%
$3.80
No MOQ
Phone Case With Camellia Flower Decoration And Bowknot Artificial Pearl Hand Chain TPU Matte Texture Elegant Luxury For Women
Phone Case With Camellia Flower Decoration And Bowknot Artificial Pearl Hand Chain TPU Matte Texture Elegant Luxury For Women
like
Find Similar
Protective iPhone case with black camellia flower and elegant pearl bracelet handle - Black Base with Black Flower / iPhone 13 Pro
iPhone case with 3D white camellia flower, black bow and elegant pearl hand strap - Black With White Flowers / iPhone 13 Pro
+62
Phone Case With Camellia Flower Decoration And Bowknot Artificial Pearl Hand Chain TPU Matte Texture Elegant Luxury For Women
-9%
$1.91
No MOQ
Luxury Rhinestone Gemstone Chain Phone Case Transparent Acrylic TPU With Alloy Crystal Hand Strap For iPhone Series Elegant
Luxury Rhinestone Gemstone Chain Phone Case Transparent Acrylic TPU With Alloy Crystal Hand Strap For iPhone Series Elegant
like
Find Similar
Luxury transparent case for Samsung with elegant rhinestone chain and gold metal strap - Black / iPhone 6/6S
Transparent case for Samsung S21 Ultra with green emerald gemstone bracelet and rhinestones - Green / iPhone 6/6S
Clear phone case for Samsung S21 Ultra with elegant crystal gemstone chain strap - White / iPhone 6/6S
+84
Luxury Rhinestone Gemstone Chain Phone Case Transparent Acrylic TPU With Alloy Crystal Hand Strap For iPhone Series Elegant
-9%
$2.88
No MOQ
Luxury Phone Case With Metal Chain Handle Heart Charm TPU Silicone Protective Cover Chic Stylish Strap For Women
Luxury Phone Case With Metal Chain Handle Heart Charm TPU Silicone Protective Cover Chic Stylish Strap For Women
like
Find Similar
Matte black iPhone case with chunky gold chain strap and heart pendant accessory - Black (English Heart Chain) / iPhone 7/8/SE 2020
Cream silicone case for iPhone with a chunky gold chain strap and heart charm - White (English Heart Chain) / iPhone 7/8/SE 2020
+54
Luxury Phone Case With Metal Chain Handle Heart Charm TPU Silicone Protective Cover Chic Stylish Strap For Women
-8%
$1.52
No MOQ
Camellia Flower Wristband Phone Case With Crossbody Artificial Pearl Chain Lanyard TPU Back Cover Elegant Luxury For Women
Camellia Flower Wristband Phone Case With Crossbody Artificial Pearl Chain Lanyard TPU Back Cover Elegant Luxury For Women
like
Find Similar
Detail of black iPhone case with camellia pearl wrist strap and crossbody lanyard - Black (Fabric Camellia Wristband - Polyester Crossbody Rope) / iPhone 7/8/SE 2020
iPhone 16 Pro Max case with camellia flower strap and elegant pearl crossbody chain - Apricot (Fabric Camellia Wristband - Pearl Crossbody Chain) / iPhone 7/8/SE 2020
+54
Camellia Flower Wristband Phone Case With Crossbody Artificial Pearl Chain Lanyard TPU Back Cover Elegant Luxury For Women
-9%
$2.62
No MOQ
Luxury Glitter Folding Phone Case 3D Artificial Pearl Flower Rhinestone Bag Decor With Artificial Pearl Metal Chain Strap Crossbody For Women
Luxury Glitter Folding Phone Case 3D Artificial Pearl Flower Rhinestone Bag Decor With Artificial Pearl Metal Chain Strap Crossbody For Women
like
Find Similar
Detail of luxury Z Flip 6 case with purple glitter, floral charms and pearl chain - Black / Samsung ZFlip3
Detail of luxury gold rhinestone phone case with pearl flowers for Samsung Z Flip6 - Gold / Samsung ZFlip3
Detail of pink glitter phone case with pearl flower, rhinestones and metal chain strap - Pink / Samsung ZFlip3
Red glitter Samsung Z Flip 6 case with pearl flowers, rhinestones and a metal chain handle - Red / Samsung ZFlip3
+56
Luxury Glitter Folding Phone Case 3D Artificial Pearl Flower Rhinestone Bag Decor With Artificial Pearl Metal Chain Strap Crossbody For Women
-9%
$4.06
No MOQ
Luxury Quilted Faux Leather Crossbody Smartphone Case With Card Holder Wallet Mirror And Removable Chain Strap Charm Women
Luxury Quilted Faux Leather Crossbody Smartphone Case With Card Holder Wallet Mirror And Removable Chain Strap Charm Women
like
Find Similar
Detail of black quilted phone case with PARUM N°5 perfume bottle and gold chain strap - Black / iPhone 15 Promax
Close-up of beige quilted leather iPhone case with crossbody chain and perfume charm - Apricot / iPhone 15 Promax
Detail of beige quilted iPhone case with a perfume bottle charm and metal chain - Khaki / iPhone 15 Plus
+79
NewLuxury Quilted Faux Leather Crossbody Smartphone Case With Card Holder Wallet Mirror And Removable Chain Strap Charm Women
-9%
$3.88
No MOQ
Crossbody Phone Case With Wallet Card Holder Rhinestone Rabbit Tweed Fabric Smile Decor Metal Leather Chain Strap
Crossbody Phone Case With Wallet Card Holder Rhinestone Rabbit Tweed Fabric Smile Decor Metal Leather Chain Strap
like
Find Similar
Detail of crossbody phone case with tweed card holder, rhinestone rabbit and gold chain - iPhone 7/8/SE 2020 / Black
Detail of tweed card holder wallet on iPhone case with rhinestone rabbit and chain strap - iPhone 7/8/SE 2020 / Apricot
+64
Crossbody Phone Case With Wallet Card Holder Rhinestone Rabbit Tweed Fabric Smile Decor Metal Leather Chain Strap
-9%
$4.06
No MOQ
Quilted PU Leather Crossbody Phone Case Wallet With Long Chain Strap Metal Butterfly Decor For iPhone For Women
Quilted PU Leather Crossbody Phone Case Wallet With Long Chain Strap Metal Butterfly Decor For iPhone For Women
like
Find Similar
Close-up of black quilted leather iPhone case with crossbody chain and bow detail - Black / iPhone 7/8/SE 2020
Crossbody iPhone case detail featuring cream quilted wallet, gold lock and chain strap - Apricot / iPhone 7/8/SE 2020
+64
NewQuilted PU Leather Crossbody Phone Case Wallet With Long Chain Strap Metal Butterfly Decor For iPhone For Women
-9%
$3.27
No MOQ
Crossbody Phone Case With Card Holder Wallet PU Leather Chain Strap And Deer Pendant Luxury Style Cover
Crossbody Phone Case With Card Holder Wallet PU Leather Chain Strap And Deer Pendant Luxury Style Cover
like
Find Similar
Detailed view of black litchi leather phone case with gold deer pendant and crossbody chain - Black / iPhone 7/8/SE 2020
White leather iPhone wallet case with gold deer charm and long chain strap detail - Apricot / iPhone 7/8/SE 2020
+64
Crossbody Phone Case With Card Holder Wallet PU Leather Chain Strap And Deer Pendant Luxury Style Cover
-9%
$3.01
No MOQ
Crossbody Phone Case Quilted PU Leather Wallet Card Holder Artificial Pearl Rabbit Metal Chain Shoulder Strap Protective Cover Fashion Women
Crossbody Phone Case Quilted PU Leather Wallet Card Holder Artificial Pearl Rabbit Metal Chain Shoulder Strap Protective Cover Fashion Women
like
Find Similar
Crossbody black leather phone case featuring pearl bunny charm and chain strap - iPhone 7/8/SE 2020 / Big Eye Pearl Rabbit Lock Wallet Style - Black
Cream iPhone wallet case with pearl rabbit charm and crossbody chain strap - iPhone 7/8/SE 2020 / Big Eye Pearl Rabbit Lock Wallet Style - Apricot
+60
Crossbody Phone Case Quilted PU Leather Wallet Card Holder Artificial Pearl Rabbit Metal Chain Shoulder Strap Protective Cover Fashion Women
-9%
$4.06
No MOQ
Crossbody Phone Case PU Leather With Card Slot Flower Mirror Rhinestone Love Metal Chain Strap For Women Fashion
Crossbody Phone Case PU Leather With Card Slot Flower Mirror Rhinestone Love Metal Chain Strap For Women Fashion
like
Find Similar
Detail of crossbody phone case with black leather, flower mirror, and gold chain strap - Black / iPhone 7/8/SE 2020
Detail of cream leather phone case with petal mirror, love emblem and crossbody strap - Apricot / iPhone 7/8/SE 2020
Detail of nude beige crossbody iPhone case with floral mirror, love charm, and card slot - Khaki / iPhone 7/8/SE 2020
+85
Crossbody Phone Case PU Leather With Card Slot Flower Mirror Rhinestone Love Metal Chain Strap For Women Fashion
-8%
$3.54
No MOQ
Elegant Litchi Leather Crossbody Phone Case Flip Wallet Card Holder With Artificial Pearl Bow Hand Strap And Long Chain
Elegant Litchi Leather Crossbody Phone Case Flip Wallet Card Holder With Artificial Pearl Bow Hand Strap And Long Chain
like
Find Similar
Crossbody iPhone case with pearl chain, bow accent, and queen rhinestone wallet detail - Black / iPhone 7/8/SE 2020
Detail of white leather iPhone case featuring a Queen crown badge and pearl bow strap - Apricot / iPhone 7/8/SE 2020
+60
Elegant Litchi Leather Crossbody Phone Case Flip Wallet Card Holder With Artificial Pearl Bow Hand Strap And Long Chain
-9%
$3.41
No MOQ
Crossbody Wallet Phone Case Quilted PU Leather Metal Chain Strap Camellia Lock Decoration Card Holder Luxury Style
Crossbody Wallet Phone Case Quilted PU Leather Metal Chain Strap Camellia Lock Decoration Card Holder Luxury Style
like
Find Similar
Black pebbled leather crossbody iPhone case with gold crown and camellia charms - iPhone 7/8/SE 2020 / Black
Detail of cream leather iPhone case with quilted pattern, charms and crossbody chain - iPhone 7/8/SE 2020 / Apricot
+64
Crossbody Wallet Phone Case Quilted PU Leather Metal Chain Strap Camellia Lock Decoration Card Holder Luxury Style
-9%
$3.93
No MOQ
Crossbody Phone Case For iPhone With Wallet Card Holder Leather Chain Strap Rhinestone Bow Love Smile Luxury Decoration
Crossbody Phone Case For iPhone With Wallet Card Holder Leather Chain Strap Rhinestone Bow Love Smile Luxury Decoration
like
Find Similar
Detail of black leather iPhone case featuring rhinestone Smile Love and bow with gold lock - Black / iPhone 7/8/SE 2020
Detail of cream leather phone case with rhinestone bow clasp and crossbody chain strap - Apricot / iPhone 7/8/SE 2020
+62
Crossbody Phone Case For iPhone With Wallet Card Holder Leather Chain Strap Rhinestone Bow Love Smile Luxury Decoration
-9%
$3.41
No MOQ
Crossbody Phone Case Wallet Quilted Leather Metal Chain Strap Camellia Flower Flip Card Pocket For Women Fashion Elegant Accessory
Crossbody Phone Case Wallet Quilted Leather Metal Chain Strap Camellia Flower Flip Card Pocket For Women Fashion Elegant Accessory
like
Find Similar
Black leather iPhone case with mini quilted pouch and long gold metal chain strap - Black / iPhone 15 Pro Max
Quilted cream phone case for iPhone with camellia lock and crossbody gold chain strap - Apricot / iPhone 15 Pro Max
+64
Crossbody Phone Case Wallet Quilted Leather Metal Chain Strap Camellia Flower Flip Card Pocket For Women Fashion Elegant Accessory
-9%
$3.27
No MOQ
Rhinestone Cat Paw Mirror Wallet Phone Case With Crossbody Chain PU Leather Camera Protection For iPhone
Rhinestone Cat Paw Mirror Wallet Phone Case With Crossbody Chain PU Leather Camera Protection For iPhone
like
Find Similar
Detail of black leather crossbody phone case with cat paw mirror and gold chain strap - Black / iPhone 7/8/SE 2020
Crossbody phone case with rhinestone cat paw mirror and chain strap for iPhone - Apricot / iPhone 7/8/SE 2020
+64
NewRhinestone Cat Paw Mirror Wallet Phone Case With Crossbody Chain PU Leather Camera Protection For iPhone
-9%
$3.09
No MOQ
Crossbody Phone Case Wallet With Removable Chain Strap PU Leather Quilted Camellia Flower Card Holder Pocket Smile Letters For Women
Crossbody Phone Case Wallet With Removable Chain Strap PU Leather Quilted Camellia Flower Card Holder Pocket Smile Letters For Women
like
Find Similar
Detail of black leather iPhone case featuring gold camellia buckle and cross-body chain strap - iPhone 7/8/SE 2020 / Black
Detail of cream iPhone case with quilted leather wallet, gold flower and crossbody chain - iPhone 7/8/SE 2020 / Apricot
+64
Crossbody Phone Case Wallet With Removable Chain Strap PU Leather Quilted Camellia Flower Card Holder Pocket Smile Letters For Women
-8%
$3.54
No MOQ
Folding Phone Case With Artificial Pearl Hand Chain Camellia Flower Butterfly Clover Charms Leather Texture Elegant Luxury Chic Cover
Folding Phone Case With Artificial Pearl Hand Chain Camellia Flower Butterfly Clover Charms Leather Texture Elegant Luxury Chic Cover
like
Find Similar
Detail of white leather texture phone case with pearl chain and metallic floral charms - White / Samsung ZFlip3
Detail of pink leather texture phone case with pearl chain and floral charms on a desk - Pink / Samsung ZFlip3
Detail of black pleated phone case with pearl chain and elegant charm ornaments - Black / Samsung ZFlip3
Detail of purple folding phone case with pearl strap and floral charms for Galaxy Z Flip - Purple / Samsung ZFlip3
+56
Folding Phone Case With Artificial Pearl Hand Chain Camellia Flower Butterfly Clover Charms Leather Texture Elegant Luxury Chic Cover
-9%
$3.14
No MOQ
Luxury Heart Stand Phone Case Rhinestone Artificial Pearl Wrist Chain Faux Leather Crossbody Lanyard Protective Cover For IPhone
Luxury Heart Stand Phone Case Rhinestone Artificial Pearl Wrist Chain Faux Leather Crossbody Lanyard Protective Cover For IPhone
like
Find Similar
Pink iPhone case detail with heart stand, pearl strap and crossbody chain - Pink / iPhone 7/8/SE 2020
Detail of black iPhone case with pearl heart stand, pearl wrist strap and leather strap - Black / iPhone 7/8/SE 2020
Detail of cream white phone case featuring a 3D rose heart stand and pearl wrist strap - Apricot / iPhone 7/8/SE 2020
+78
Luxury Heart Stand Phone Case Rhinestone Artificial Pearl Wrist Chain Faux Leather Crossbody Lanyard Protective Cover For IPhone
-9%
$3.14
No MOQ
Crossbody Phone Case Quilted Leather Wallet With Chain Strap Love Rhinestone Design Protective Shell For Women
Crossbody Phone Case Quilted Leather Wallet With Chain Strap Love Rhinestone Design Protective Shell For Women
like
Find Similar
Crossbody iPhone case detail featuring black quilted mini wallet and silver chain strap - Black / iPhone 7/8/SE 2020
Detailed view of white quilted phone case with rhinestone Love buckle and crossbody chain - Apricot / iPhone 7/8/SE 2020
+60
Crossbody Phone Case Quilted Leather Wallet With Chain Strap Love Rhinestone Design Protective Shell For Women
-9%
$3.20
No MOQ
Luxury Glitter Folding Phone Case With Bow Artificial Pearl Leather Chain Strap Protective Cover Elegant Style For Foldable Phone
Luxury Glitter Folding Phone Case With Bow Artificial Pearl Leather Chain Strap Protective Cover Elegant Style For Foldable Phone
like
Find Similar
Close-up of pink glitter Z Flip case with rhinestone bow, tiger head and pearl chain - Pink / Samsung ZFlip3
Glittery black folding case for Samsung Z Flip with pearl bracelet and bow detail - Black / Samsung ZFlip3
Detail of red glitter phone case with pearl chain strap and rhinestone bow for Z Flip 5 - Red / Samsung ZFlip3
Detail of glitter phone case for Z Flip with pearl handle and 3D metallic charms - Gold / Samsung ZFlip3
+48
Luxury Glitter Folding Phone Case With Bow Artificial Pearl Leather Chain Strap Protective Cover Elegant Style For Foldable Phone
-9%
$4.06
No MOQ
Luxury Perfume Bottle Shaped Phone Case Full Rhinestones 3D Resin Flowers Artificial Pearls Crossbody Chain Strap Elegant Decorative
Luxury Perfume Bottle Shaped Phone Case Full Rhinestones 3D Resin Flowers Artificial Pearls Crossbody Chain Strap Elegant Decorative
like
Find Similar
Luxury iPhone case in perfume bottle shape with rhinestone roses and leather chain strap - iPhone 7/8/SE 2020 / Red
Luxury rhinestone perfume bottle phone case with floral chain for iPhone 16 Pro - iPhone 7/8/SE 2020 / Gold
Macro detail of luxury perfume bottle phone case with green floral resin and rhinestones - iPhone 7/8/SE 2020 / Green
Macro view of luxury iPhone case with 3D purple flowers, rhinestones and perfume bottle cap - iPhone 7/8/SE 2020 / Purple
+116
Luxury Perfume Bottle Shaped Phone Case Full Rhinestones 3D Resin Flowers Artificial Pearls Crossbody Chain Strap Elegant Decorative
-9%
$6.81
No MOQ
Go to

More in bags

Women's Bags
Men's Bags

Explore more in purse chains

crossbodycoineveningstylewideshapedailyfacebeadedwoven
shoulderpartyroundunderarmstarsilvertasselhangingchain keychainmagnetic buckle

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access