Everful

Wholesale heart shaped boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Heart Shaped Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

All products in heart shaped boxes

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Transparent Plastic Jewelry Box Multi Compartment Dustproof Storage Organizer For Earrings Rings Necklaces Small Parts
Transparent Plastic Jewelry Box Multi Compartment Dustproof Storage Organizer For Earrings Rings Necklaces Small Parts
like
Find Similar
Minimalist 28-grid transparent jewelry storage box for beads and earrings organized on wood - 28 Grids / Clear
Detailed view of a 28-slot colorful storage box with semi-transparent PP plastic compartments - 28 Grids / Colorful
Clear plastic jewelry organizer box with 56 separate compartments for beads and rings - 56 Compartments / Clear
Transparent self-adhesive jewelry packaging bag with red sealing tape and clear finish - Earring Packaging Bags (Set of 10)
Transparent Plastic Jewelry Box Multi Compartment Dustproof Storage Organizer For Earrings Rings Necklaces Small Parts
$0.26-2.59
No MOQ
 · 
24 views
Hollow Heart Pattern Paper Candle Shade Cover European Style Laser Cut Decorative Sleeve For LED Tea Light Wedding Party Table Decor
Hollow Heart Pattern Paper Candle Shade Cover European Style Laser Cut Decorative Sleeve For LED Tea Light Wedding Party Table Decor
like
Find Similar
Macro detail of silver openwork metal bracelet with intricate filigree scroll patterns - Reflective Silver
Pink heart cutout paper lampshade set with LED tea light candle for festive decoration - White
Golden heart hollow-out paper lampshade for LED tea light candles and wedding decoration - Reflective Gold
Detailed laser-cut pink paper candle wrap with heart patterns for LED tea lights - Pink
+5
Hollow Heart Pattern Paper Candle Shade Cover European Style Laser Cut Decorative Sleeve For LED Tea Light Wedding Party Table Decor
$0.09
Mix MOQ : 50
Pop Up Greeting Card Paper Flower Bouquet Laser Cut Floral Arrangement Mother Day Birthday Celebration Gift Decorative
Pop Up Greeting Card Paper Flower Bouquet Laser Cut Floral Arrangement Mother Day Birthday Celebration Gift Decorative
like
Find Similar
Creative 3D popup Mother's Day greeting card featuring a bouquet of roses and yellow ribbon - Rose
3D pop-up greeting card featuring a vibrant pink lily flower bouquet for Mothers Day - Lily
3D pop-up greeting card featuring a vibrant paper bouquet with bird of paradise flowers - Bird of Paradise
Close-up of a large 3D pop-up greeting card featuring a colorful tulip flower bouquet - Tulips A23
+17
Pop Up Greeting Card Paper Flower Bouquet Laser Cut Floral Arrangement Mother Day Birthday Celebration Gift Decorative
-4%
$1.78
Mix MOQ : 10
 · 
209 sold recently
Handmade Polyester Ribbon Bow Cake Toppers With Wooden Sticks For Birthday Party Mother's Day Dessert Decoration
Handmade Polyester Ribbon Bow Cake Toppers With Wooden Sticks For Birthday Party Mother's Day Dessert Decoration
like
Find Similar
Pink ribbon bow cake topper picks with wooden sticks for girls birthday party decoration - Pearl Pink
Pink ribbon bow cake toppers with bamboo sticks set of 8 pieces party decorations - Pink
Set of 8 purple satin ribbon bow cake toppers with wooden sticks and size details - Taro Purple
Set of 8 rose red polyester ribbon bow cake toppers with bamboo sticks for party decor - Rose Red
+4
Handmade Polyester Ribbon Bow Cake Toppers With Wooden Sticks For Birthday Party Mother's Day Dessert Decoration
-4%
$0.36-1.16
Mix MOQ : 50
Free Shipping
Christmas Laser Cut Paper Candle Shade Santa Claus Snowflake Hollow Out Cupcake Wrapper Merry Christmas Party Table Decoration
Christmas Laser Cut Paper Candle Shade Santa Claus Snowflake Hollow Out Cupcake Wrapper Merry Christmas Party Table Decoration
like
Find Similar
Laser-cut blue pearl paper LED candle holder with Santa Claus and Merry Christmas motifs - White
Detail of green paper LED candle cover with Merry Christmas text and Santa Claus cutout - Dark Green
Close-up of golden laser-cut Merry Christmas candle cover with Santa Claus and LED light - Gold
Detail of red laser-cut Christmas LED candle shade with Santa Claus pattern and warm glow - Pearlescent Red
+2
Christmas Laser Cut Paper Candle Shade Santa Claus Snowflake Hollow Out Cupcake Wrapper Merry Christmas Party Table Decoration
$0.09
Mix MOQ : 50
Free Shipping
Pop-up Flower Bouquet Greeting Card Cardstock With Ribbon For Mother Day Birthday Anniversary Thanksgiving Gift
Pop-up Flower Bouquet Greeting Card Cardstock With Ribbon For Mother Day Birthday Anniversary Thanksgiving Gift
like
Find Similar
Detail of 3D Mother's Day card with pink lilies and purple ribbon tied in a bow - Lily
Detail of 3D bouquet card featuring orange chrysanthemums and a silk ribbon bow knot - Chrysanthemum
Detail of pink rose 3D pop-up greeting card with a silk ribbon bow and Best Wishes gold foil - Rose
Top view of a pink tulip bouquet greeting card with mint green packaging and satin ribbon - Tulip
Pop-up Flower Bouquet Greeting Card Cardstock With Ribbon For Mother Day Birthday Anniversary Thanksgiving Gift
$0.14
No MOQ
 · 
350 sold recently
Elegant Laser Cut Hollow Paper Cupcake Wrapper Decorative Geometric Star Cake Border For Wedding Party Baking Dessert Decor
Elegant Laser Cut Hollow Paper Cupcake Wrapper Decorative Geometric Star Cake Border For Wedding Party Baking Dessert Decor
like
Find Similar
Elegant white laser-cut cupcake wrappers with geometric patterns for party decoration - 5cm / White
Pink laser-cut lace cupcake wrappers with intricate floral patterns for bakery decor - 5cm / Pink
Laser cut golden hollow lace cupcake wrapper with intricate geometric floral design - 5cm / Gold
Macro detail of red laser-cut cupcake wrapper with intricate geometric hollow patterns - 5cm / Pearlescent Red
+5
Elegant Laser Cut Hollow Paper Cupcake Wrapper Decorative Geometric Star Cake Border For Wedding Party Baking Dessert Decor
$0.09
Mix MOQ : 50
Laser Cut Hollow Eid Mubarak Candy Boxes Ramadan Moon Mosque Pattern Pearl Paper Chocolate Gift Boxes For Wedding Party Favor
Laser Cut Hollow Eid Mubarak Candy Boxes Ramadan Moon Mosque Pattern Pearl Paper Chocolate Gift Boxes For Wedding Party Favor
like
Find Similar
8 options
NewLaser Cut Hollow Eid Mubarak Candy Boxes Ramadan Moon Mosque Pattern Pearl Paper Chocolate Gift Boxes For Wedding Party Favor
$0.14
Mix MOQ : 50
Christmas Snowflake Laser Cut Cupcake Wrappers Hollow Pearl Paper Cake Edging For Wedding Birthday Party Winter Decoration
Christmas Snowflake Laser Cut Cupcake Wrappers Hollow Pearl Paper Cake Edging For Wedding Birthday Party Winter Decoration
like
Find Similar
Macro shot of red laser-cut snowflake cupcake wrappers for Christmas dessert table - Pearlescent Red
Laser-cut Tiffany blue snowflake cupcake wrapper for Christmas and winter party decor - Tiffany Blue
Elegant silver laser-cut snowflake cupcake wrappers for festive Christmas table decoration - Reflective Silver
Detail of white laser-cut cupcake wrappers with intricate snowflake patterns for holidays - White
+3
Christmas Snowflake Laser Cut Cupcake Wrappers Hollow Pearl Paper Cake Edging For Wedding Birthday Party Winter Decoration
$0.09
Mix MOQ : 50
Laser Cut Paper Lampshade Swan Heart Rose Flower Candle Wrap Decor For Wedding Christmas Valentine Party Celebration Elegant Paper Wrap
Laser Cut Paper Lampshade Swan Heart Rose Flower Candle Wrap Decor For Wedding Christmas Valentine Party Celebration Elegant Paper Wrap
like
Find Similar
Hollow rose paper lampshade with swan pattern for LED candle on wooden background - White
Macro detail of golden swan lace candle wrap with warm yellow LED flickering light - Reflective Gold
Golden laser-cut swan paper lampshade with LED candle for wedding table decor - Gold
Pink swan paper lantern shade with floral laser cut design for LED tea light candles - Pink
+3
Laser Cut Paper Lampshade Swan Heart Rose Flower Candle Wrap Decor For Wedding Christmas Valentine Party Celebration Elegant Paper Wrap
$0.09
Mix MOQ : 50
Elegant Pearlescent Paper Cupcake Wrappers Laser Cut Hollow Lace Design For Wedding Birthday Party Cake Decoration Supplies
Elegant Pearlescent Paper Cupcake Wrappers Laser Cut Hollow Lace Design For Wedding Birthday Party Cake Decoration Supplies
like
Find Similar
Macro view of white laser cut lace cupcake wrappers with intricate floral patterns - 5cm / White
Pink laser-cut cupcake wrappers with intricate floral hollow design for wedding decor - 5cm / Pink
Golden crown laser cut cupcake wrapper made of shiny pearl paper for dessert table decor - 5cm / Gold
Laser cut red lace cupcake wrappers with elegant hollow pattern for dessert table decor - 5cm / Pearlescent Red
+6
Elegant Pearlescent Paper Cupcake Wrappers Laser Cut Hollow Lace Design For Wedding Birthday Party Cake Decoration Supplies
$0.09
Mix MOQ : 50
Laser Cut Cupcake Wrappers Vine Lace Hollow Out Cake Decoration For Wedding Birthday Party Pearlescent Paper Cake Cups
Laser Cut Cupcake Wrappers Vine Lace Hollow Out Cake Decoration For Wedding Birthday Party Pearlescent Paper Cake Cups
like
Find Similar
White laser cut cupcake wrappers with classical filigree pattern for wedding decorations - 5cm / White
Pink laser-cut lace cupcake wrappers with elegant floral vine design for party decorations - 5cm / Pink
Vibrant red laser-cut cupcake wrapper with intricate filigree pattern for wedding decoration - 5cm / Pearlescent Red
Golden laser-cut lace cupcake wrappers with elegant European filigree hollow design - 5cm / Reflective Gold
+6
Laser Cut Cupcake Wrappers Vine Lace Hollow Out Cake Decoration For Wedding Birthday Party Pearlescent Paper Cake Cups
$0.09
Mix MOQ : 50
Hollow Laser Cut Paper Candle Shade Geometric Diamond Grid Pattern Wrap For Wedding Party Home Decor
Hollow Laser Cut Paper Candle Shade Geometric Diamond Grid Pattern Wrap For Wedding Party Home Decor
like
Find Similar
Elegant white laser-cut lattice candle holder with a warm glowing LED light inside - White
Pink hollow paper candle shade with diamond lattice pattern and warm glowing LED light - Pink
Golden geometric diamond lattice candle holder with a warm glowing tealight candle - Gold
Teal diamond lattice hollow lampshade with LED tea light candle for party decor - Tiffany Blue
+1
Hollow Laser Cut Paper Candle Shade Geometric Diamond Grid Pattern Wrap For Wedding Party Home Decor
$0.09
Mix MOQ : 50
 · 
150 sold recently
Free Shipping
Christmas Laser Cut Cupcake Wrappers Snowman Reindeer Tree Hollow Out Pearlescent Paper Cake Border For Holiday Party Decoration
Christmas Laser Cut Cupcake Wrappers Snowman Reindeer Tree Hollow Out Pearlescent Paper Cake Border For Holiday Party Decoration
like
Find Similar
Laser cut red Christmas tree and reindeer cupcake wrappers for holiday party decoration - Pearlescent Red
Detail of laser-cut green Christmas cupcake wrapper featuring reindeer and snowman patterns - Dark Green
Laser-cut silver Christmas cupcake wrappers with reindeer and tree patterns - Reflective Silver
Laser-cut white cupcake wrapper with reindeer and snowman hollow patterns for Christmas - White
+7
Christmas Laser Cut Cupcake Wrappers Snowman Reindeer Tree Hollow Out Pearlescent Paper Cake Border For Holiday Party Decoration
$0.09
Mix MOQ : 50
Laser Cut Halloween Owl Bat Cupcake Wrappers Pearlescent Paper Hollow Decorative Cake Borders For Halloween Birthday Party Supplies
Laser Cut Halloween Owl Bat Cupcake Wrappers Pearlescent Paper Hollow Decorative Cake Borders For Halloween Birthday Party Supplies
like
Find Similar
Laser-cut red cupcake wrapper with owl and tree branch pattern for Halloween decor - Pearlescent Red
Laser cut owl and branch Halloween cupcake wrappers in black paper for party decor - Black Khaki
Macro detail of laser cut owl cupcake wrapper with silver metallic finish and intricate pattern - Reflective Silver
Detail of laser-cut owl and tree branch pattern on white cupcake paper wrapper - White
+6
Laser Cut Halloween Owl Bat Cupcake Wrappers Pearlescent Paper Hollow Decorative Cake Borders For Halloween Birthday Party Supplies
$0.09
Mix MOQ : 50
Halloween Laser Cut Cupcake Wrappers Hollow Out Witch Castle Design Paper Cake Border For Party Dessert Table Decoration
Halloween Laser Cut Cupcake Wrappers Hollow Out Witch Castle Design Paper Cake Border For Party Dessert Table Decoration
like
Find Similar
Close-up of red laser-cut cupcake wrapper featuring Halloween witch and haunted house - Pearlescent Red
Red laser-cut Halloween cupcake wrapper with spooky castle and RIP tombstone design - Orange Red
Halloween cupcake wrappers with laser cut black witch and haunted house silhouettes - Black Khaki
Detailed laser-cut turquoise cupcake wrapper featuring a witch and Halloween castle - Tiffany Blue
+5
Halloween Laser Cut Cupcake Wrappers Hollow Out Witch Castle Design Paper Cake Border For Party Dessert Table Decoration
$0.09
Mix MOQ : 50
Gothic Halloween Laser Cut Cupcake Wrappers Hollow Out Castle Pumpkin Bat Cake Decor For Party Event Baking Paper Supplies
Gothic Halloween Laser Cut Cupcake Wrappers Hollow Out Castle Pumpkin Bat Cake Decor For Party Event Baking Paper Supplies
like
Find Similar
Detail of laser-cut orange cupcake wrapper with Halloween castle and pumpkin motifs - Orange Red
Halloween laser-cut cupcake wrappers with black castle and bat designs for party decor - Black Khaki
Silver laser-cut Halloween cupcake wrappers featuring haunted house and pumpkin silhouettes - Reflective Silver
Macro shot of white castle laser cut cupcake wrapper with a sparkling floral rhinestone detail - White
+3
Gothic Halloween Laser Cut Cupcake Wrappers Hollow Out Castle Pumpkin Bat Cake Decor For Party Event Baking Paper Supplies
$0.09
Mix MOQ : 50
Christmas Tree Snowflake Laser Cut Hollow Cupcake Wrappers For Wedding Birthday Party Cake Decoration Pearl Paper Wrapper
Christmas Tree Snowflake Laser Cut Hollow Cupcake Wrappers For Wedding Birthday Party Cake Decoration Pearl Paper Wrapper
like
Find Similar
Laser-cut red Christmas tree snowflake cupcake wrapper with Ferrero Rocher detail - Pearlescent Red
Laser-cut silver snowflake cupcake wrappers with mirror finish for Christmas party decor - Reflective Silver
Laser-cut white paper cupcake wrapper with intricate snowflake and Christmas tree patterns - White
Detail showing pink laser-cut cupcake wrapper with snowflake patterns and gold candy inside - Pink
+5
Christmas Tree Snowflake Laser Cut Hollow Cupcake Wrappers For Wedding Birthday Party Cake Decoration Pearl Paper Wrapper
$0.09
Mix MOQ : 50
Laser Cut Paper Candle Shade Hollow Out Heart Swan Pattern White Cardboard Lantern For Wedding Valentine Day Party Decor
Laser Cut Paper Candle Shade Hollow Out Heart Swan Pattern White Cardboard Lantern For Wedding Valentine Day Party Decor
like
Find Similar
3-piece set of laser-cut white paper lanterns with romantic swan and heart patterns - Valentine's Day Styles Large Medium Small
Laser Cut Paper Candle Shade Hollow Out Heart Swan Pattern White Cardboard Lantern For Wedding Valentine Day Party Decor
$11.53
Mix MOQ : 10
Laser Cut Pearlescent Paper Lampshade Sleeve Hollow Leaf Pattern Decorative Candle Cover For Wedding Party Home Decoration
Laser Cut Pearlescent Paper Lampshade Sleeve Hollow Leaf Pattern Decorative Candle Cover For Wedding Party Home Decoration
like
Find Similar
Elegant white laser-cut hollow paper lampshade with floral patterns for LED candles - White
Deep purple hollow leaf pattern paper candle shade with LED tea light decoration - Black
Golden laser-cut hollow candle holder with maple leaf patterns and LED candle - Reflective Gold
Hollow heart and leaf pattern metal paper carving lamp with LED candle in champagne gold - Reflective Silver
+5
Laser Cut Pearlescent Paper Lampshade Sleeve Hollow Leaf Pattern Decorative Candle Cover For Wedding Party Home Decoration
$0.09
Mix MOQ : 50
Halloween Cupcake Wrappers Black Laser Cut Cardboard Pumpkin Bat Witch Silhouette Holiday Party Cake Decoration Supplies
Halloween Cupcake Wrappers Black Laser Cut Cardboard Pumpkin Bat Witch Silhouette Holiday Party Cake Decoration Supplies
like
Find Similar
Black laser-cut Halloween cupcake wrappers with pumpkin, bat, and witch silhouette patterns - 5*5*8CM / Black
Halloween Cupcake Wrappers Black Laser Cut Cardboard Pumpkin Bat Witch Silhouette Holiday Party Cake Decoration Supplies
$0.09
Mix MOQ : 50
Halloween Ghost Bat Laser Cut Cupcake Wrappers Tomb Of Love Hollow Out Paper Cake Border Decoration Party Supplies
Halloween Ghost Bat Laser Cut Cupcake Wrappers Tomb Of Love Hollow Out Paper Cake Border Decoration Party Supplies
like
Find Similar
Detail of red laser-cut cupcake wrappers with ghost motifs and The Tomb of Love text - Pearlescent Red
Laser-cut red Halloween cupcake wrapper with ghost, bat elements and gothic text - Orange Red
Halloween ghost and tombstone laser-cut black paper cupcake liners party decoration - Black
Detail of laser-cut teal cupcake wrapper featuring ghost patterns and Tomb of Love text - Teal Blue
+5
Halloween Ghost Bat Laser Cut Cupcake Wrappers Tomb Of Love Hollow Out Paper Cake Border Decoration Party Supplies
$0.09
Mix MOQ : 50
Handbag Shape Wedding Candy Gift Box Paper Ribbon Bow Thank You Gold Stamping Party Favor
Handbag Shape Wedding Candy Gift Box Paper Ribbon Bow Thank You Gold Stamping Party Favor
like
Find Similar
Detail of pink and red handbag style wedding candy box with silk ribbon and gold foil - Small 6.3*13*9.5cm / Red with Wine Red Ribbon
Elegant white wedding candy gift box with green leaf patterns and silk ribbon bow - Small 6.3*13*9.5cm / Green
Pink creative wedding favor gift boxes with golden marble texture and silk ribbons - Small 6.3*13*9.5cm / Pink with Pink Ribbon
Pink handbag style wedding candy box with red patterns and a gold ribbon bow tie - Small 6.3*13*9.5cm / Red with Gold Ribbon
+6
Handbag Shape Wedding Candy Gift Box Paper Ribbon Bow Thank You Gold Stamping Party Favor
$0.10-0.22
No MOQ
 · 
62 views
Hollow Heart Scroll Laser Cut Paper Candle Shade Wrappers Gold Silver Lace Decoration For Wedding Party Tea Light LED Candle
Hollow Heart Scroll Laser Cut Paper Candle Shade Wrappers Gold Silver Lace Decoration For Wedding Party Tea Light LED Candle
like
Find Similar
Laser cut hollow butterfly paper napkin ring in metallic gold for wedding table decor - Reflective Gold
Silver laser-cut hollow napkin ring with heart pattern for wedding and hotel decor - Reflective Silver
Detail view of laser-cut white heart napkin rings with elegant floral hollow patterns - White
Detailed laser-cut ivory white paper napkin ring with heart scroll pattern for weddings - Ivory
+4
Hollow Heart Scroll Laser Cut Paper Candle Shade Wrappers Gold Silver Lace Decoration For Wedding Party Tea Light LED Candle
$0.09
Mix MOQ : 50
Laser Cut Floral Hollow Wedding Confetti Cones Cardboard Paper Flower Petal Cones For Marriage Party Celebration Decoration
Laser Cut Floral Hollow Wedding Confetti Cones Cardboard Paper Flower Petal Cones For Marriage Party Celebration Decoration
like
Find Similar
Detailed close-up of white laser-cut paper wedding cones with elegant floral patterns - 120g / White
Light blue lace wedding petal cone with intricate laser cut floral hollow design - 120g / Light Blue
Elegant black laser-cut confetti cone with floral hollow pattern for wedding celebrations - 120g / Black
Laser Cut Floral Hollow Wedding Confetti Cones Cardboard Paper Flower Petal Cones For Marriage Party Celebration Decoration
$0.11
Mix MOQ : 50
Portable Jewelry Box PU Leather Travel Organizer Case With Mirror Square Storage For Rings Earrings Necklaces Simple Luxury Compact
Portable Jewelry Box PU Leather Travel Organizer Case With Mirror Square Storage For Rings Earrings Necklaces Simple Luxury Compact
like
Find Similar
Pink PU leather travel jewelry box with golden lock and decorative white stitching - Rose Pink
Pink PU leather square jewelry travel case with a secure gold metal buckle closure - Light Pink
Caramel brown PU leather jewelry box with golden metal clasp and visible stitching - Brown & Yellow
White PU leather travel jewelry box with square design and gold metal latch - Off-white
+1
Portable Jewelry Box PU Leather Travel Organizer Case With Mirror Square Storage For Rings Earrings Necklaces Simple Luxury Compact
$3.93
No MOQ
 · 
28 views
Customizable
Laser Cut Pearlescent Paper Electronic Candle Lampshade Vintage Floral Hollow Led Tea Light Shade For Wedding Party Decor
Laser Cut Pearlescent Paper Electronic Candle Lampshade Vintage Floral Hollow Led Tea Light Shade For Wedding Party Decor
like
Find Similar
Detail of red hollow laser-cut rose pattern paper wrap with LED tealight candle - Pearlescent Red
Detail showing laser-cut silver flower tea light wrap with white LED electronic candle - Reflective Silver
Detailed laser cut rose gold floral lantern with internal white flickering LED tea light - Pink
Detail of LED tea light candle with silver hollow carved floral pattern lampshade - Pearlescent Silver White
+5
NewLaser Cut Pearlescent Paper Electronic Candle Lampshade Vintage Floral Hollow Led Tea Light Shade For Wedding Party Decor
$0.09
Mix MOQ : 50
Halloween Cupcake Wrapper Laser Cut Paper Cake Wrappers Castle Witch Bat Spooky Party Dessert Decorative Lace Wrappers
Halloween Cupcake Wrapper Laser Cut Paper Cake Wrappers Castle Witch Bat Spooky Party Dessert Decorative Lace Wrappers
like
Find Similar
Detailed laser-cut Halloween cupcake wrapper featuring a white witch and castle silhouette - 5cm / White
Detailed laser-cut pink Halloween cupcake wrapper with witch and castle silhouettes - 5cm / Pink
Laser-cut golden Halloween cupcake wrapper featuring witch, pumpkin and withered tree patterns - 5cm / Reflective Gold
Laser-cut silver mirror Halloween cupcake wrappers with witch and pumpkin patterns - 5cm / Reflective Silver
+4
Halloween Cupcake Wrapper Laser Cut Paper Cake Wrappers Castle Witch Bat Spooky Party Dessert Decorative Lace Wrappers
$0.09
Mix MOQ : 50
3D Pop Up Greeting Card Box Special Paper Laser Cut Flower Butterfly Heart For Birthday Mothers Day Valentine Anniversary Gift
3D Pop Up Greeting Card Box Special Paper Laser Cut Flower Butterfly Heart For Birthday Mothers Day Valentine Anniversary Gift
like
Find Similar
Detail of 3D pop-up card featuring colorful watercolor flowers and a small pink note card - Pink Wildflowers
3D popup greeting card with vibrant sunflowers and colorful butterflies in a wooden box - Sunflower
3D butterfly pop-up surprise box card with colorful paper butterflies and floral patterns - Gold Butterfly
3D pop-up card featuring purple cosmos flowers and butterflies in a decorative gift box - Purple Daisy
+12
3D Pop Up Greeting Card Box Special Paper Laser Cut Flower Butterfly Heart For Birthday Mothers Day Valentine Anniversary Gift
$2.10
Mix MOQ : 10
 · 
100 sold recently
Mother's Day Cake Topper Glitter Paper Felt MOM Letter Heart Crown Angel Wings Decoration For Birthday Party Mothers Gift
Mother's Day Cake Topper Glitter Paper Felt MOM Letter Heart Crown Angel Wings Decoration For Birthday Party Mothers Gift
like
Find Similar
Silver glitter MOM cake topper with white daisies and green leaves for Mother's Day - MOM Green Leaves and Flowers
Glittering I Love MOM cake topper dimensions 18.1cm height and 13.1cm width floral heart - I Love MOM Heart
Glittery heart and black I LOVE MOM cake topper for Mother's Day party decoration - I Love MOM Classic
Pink glitter MOM cake topper with silver wings and product dimensions specifications - Crown and Angel Wings
+2
Mother's Day Cake Topper Glitter Paper Felt MOM Letter Heart Crown Angel Wings Decoration For Birthday Party Mothers Gift
-3%
$0.31-0.42
Mix MOQ : 2
Laser Cut Vine Lace Cupcake Wrappers Pearlescent Paper Decorative Liners For Wedding Birthday Party Cake Decoration
Laser Cut Vine Lace Cupcake Wrappers Pearlescent Paper Decorative Liners For Wedding Birthday Party Cake Decoration
like
Find Similar
Detailed laser-cut white cupcake wrapper with elegant vine patterns on a black background - White / 5cm
Pink laser-cut vine cupcake wrapper with elegant floral hollow patterns for party decor - Pink / 5cm
Red laser cut vine lace cupcake wrappers for wedding decorations and party desserts - Pearlescent Red / 5cm
Elegant gold laser-cut vine cupcake wrapper in metallic finish for wedding parties - Reflective Gold / 5cm
+7
Laser Cut Vine Lace Cupcake Wrappers Pearlescent Paper Decorative Liners For Wedding Birthday Party Cake Decoration
$0.09
Mix MOQ : 50
Easter Rabbit Hollow Out Kraft Paper Gift Box For Candy Bakery Party Favors DIY Folding Treat Box Brown Packaging Box
Easter Rabbit Hollow Out Kraft Paper Gift Box For Candy Bakery Party Favors DIY Folding Treat Box Brown Packaging Box
like
Find Similar
Four kraft paper Easter gift boxes with bunny cutouts and rustic texture on white background - Rabbit Hollow Style
Easter Rabbit Hollow Out Kraft Paper Gift Box For Candy Bakery Party Favors DIY Folding Treat Box Brown Packaging Box
$2.02-4.03
Mix MOQ : 10
Heart Shaped Confetti Paper Valentine's Day Wedding Party Desktop Decoration Romantic Colorful Laser Mixed
Heart Shaped Confetti Paper Valentine's Day Wedding Party Desktop Decoration Romantic Colorful Laser Mixed
like
Find Similar
Pink and red heart-shaped confetti in various shades for Valentine's wedding decor - 100Pcs / Mixed Colors
NewHeart Shaped Confetti Paper Valentine's Day Wedding Party Desktop Decoration Romantic Colorful Laser Mixed
$1.21
No MOQ
Valentine's Day Wooden LOVE Letter Heart Ornaments Desktop Decoration For Home Wedding St Patrick's Day Luck Clover Blocks Set
Valentine's Day Wooden LOVE Letter Heart Ornaments Desktop Decoration For Home Wedding St Patrick's Day Luck Clover Blocks Set
like
Find Similar
Wooden LOVE heart blocks table decor with clover leaf and red heart patterns for home gifts - LOVE Shamrock Style (4 Pieces/Set)
Valentine's Day Wooden LOVE Letter Heart Ornaments Desktop Decoration For Home Wedding St Patrick's Day Luck Clover Blocks Set
$4.73
Mix MOQ : 2
Laser Cut Hollow Paper Candle Shade For LED Light Wedding Party Table Decoration Romantic Leaf Vine Design Wrap Candle Holder
Laser Cut Hollow Paper Candle Shade For LED Light Wedding Party Table Decoration Romantic Leaf Vine Design Wrap Candle Holder
like
Find Similar
Detailed view of silver laser-cut paper candle wrap with intricate vine and leaf patterns - Reflective Silver
Close-up of golden laser-cut hollow rings with intricate leaf and vine patterns - Reflective Gold
Red laser-cut vine pattern paper candle cover with glowing purple LED light inside - Pearlescent Red
Matte black laser cut candle shade with nature leaf and vine filigree pattern - Black Khaki
+6
Laser Cut Hollow Paper Candle Shade For LED Light Wedding Party Table Decoration Romantic Leaf Vine Design Wrap Candle Holder
-11%
$0.08
Mix MOQ : 50
Free Shipping
Red Glitter Valentine's Day Hanging Swirls Heart Kiss XOXO Letter Hollow Out Foil Ceiling Hangers Romantic Party Decor
Red Glitter Valentine's Day Hanging Swirls Heart Kiss XOXO Letter Hollow Out Foil Ceiling Hangers Romantic Party Decor
like
Find Similar
Detailed size chart of Valentine PVC spiral swirls with red heart and love letter pendants - Heart Letters / Red
Detail view of 6-piece red heart swirl decorations showing size dimensions and 4.2g weight - Open Heart Style / Red
Red Glitter Valentine's Day Hanging Swirls Heart Kiss XOXO Letter Hollow Out Foil Ceiling Hangers Romantic Party Decor
-3%
$0.77-0.78
Mix MOQ : 2
Chinese New Year Gold Ingot Shape Candy Gift Box Creative Folding Cardstock Packaging Box For Festival Party Favors
Chinese New Year Gold Ingot Shape Candy Gift Box Creative Folding Cardstock Packaging Box For Festival Party Favors
like
Find Similar
Golden sycee shaped gift box with traditional auspicious patterns and a small pink tag - Peace and Joy
Creative folding golden ingot candy box with embossed Rich tag for New Year gifts - Fortune
Golden ingot shaped New Year candy box with cute cartoon rabbit card insert - All the Best
Chinese New Year Gold Ingot Shape Candy Gift Box Creative Folding Cardstock Packaging Box For Festival Party Favors
-5%
$0.19
No MOQ
Halloween Cupcake Wrappers Laser Cut Paper Cake Decoration Hollow Spider Web Witch Castle Bat Ghost Party Favors Gothic Dessert Decor
Halloween Cupcake Wrappers Laser Cut Paper Cake Decoration Hollow Spider Web Witch Castle Bat Ghost Party Favors Gothic Dessert Decor
like
Find Similar
Macro detail of laser-cut bat pattern cupcake wrapper with witch hat pumpkin topper - Bat And Pumpkin Style (WB-4)
Detail of laser-cut Halloween cupcake wrapper featuring spooky ghost and tombstone designs - Ghost Tombstone Style (WB-229)
Laser-cut Halloween cupcake wrapper with black silhouettes of a witch, pumpkin, and castle - Witch And Castle Style (WB-221)
Halloween black laser-cut cupcake wrapper featuring a hollowed-out pumpkin face design - Pumpkin Face Style (WB-268)
+8
NewHalloween Cupcake Wrappers Laser Cut Paper Cake Decoration Hollow Spider Web Witch Castle Bat Ghost Party Favors Gothic Dessert Decor
-11%
$0.08
Mix MOQ : 50
Creative Soccer Ball Shaped Jewelry Box Flocking Velvet Ring Earring Necklace Gift Display Case Portable Sport Novelty
Creative Soccer Ball Shaped Jewelry Box Flocking Velvet Ring Earring Necklace Gift Display Case Portable Sport Novelty
like
Find Similar
1 option
Creative Soccer Ball Shaped Jewelry Box Flocking Velvet Ring Earring Necklace Gift Display Case Portable Sport Novelty
-13%
$1.87
No MOQ
Laser Cut Crown Cupcake Wrappers Hollow Pearlescent Paper Cake Liners For Wedding Birthday Party Decorative Cupcake Wrappers
Laser Cut Crown Cupcake Wrappers Hollow Pearlescent Paper Cake Liners For Wedding Birthday Party Decorative Cupcake Wrappers
like
Find Similar
Elegant white laser cut cupcake wrapper with intricate vine hollow pattern for party decor - 5cm / White
Detailed laser-cut pink crown pattern cupcake wrapper with gold foil chocolate detail - 5cm / Pink
Close-up of red laser-cut crown pattern cupcake wrapper with a chocolate inside - 5cm / Pearlescent Red
Close-up of golden laser-cut crown cupcake wrappers with elegant hollowed-out patterns - 5cm / Reflective Gold
+9
Laser Cut Crown Cupcake Wrappers Hollow Pearlescent Paper Cake Liners For Wedding Birthday Party Decorative Cupcake Wrappers
$0.09
Mix MOQ : 50
Laser Cut Grapevine Cupcake Wrappers Pearlescent Paper Cake Decoration For Wedding Birthday Party Banquet Hollow Out Decor
Laser Cut Grapevine Cupcake Wrappers Pearlescent Paper Cake Decoration For Wedding Birthday Party Banquet Hollow Out Decor
like
Find Similar
Laser cut white cupcake wrapper with grape vine pattern on a solid black background - White
Pink laser cut cupcake wrappers with hollow grape vine design for cake decoration - Pink
Laser cut red cupcake wrappers featuring elegant grape vines and leaf patterns - Pearlescent Red
Golden laser-cut cupcake wrapper with grape vine hollow design for party cake decor - Reflective Gold
+3
Laser Cut Grapevine Cupcake Wrappers Pearlescent Paper Cake Decoration For Wedding Birthday Party Banquet Hollow Out Decor
$0.09
Mix MOQ : 50
Christmas Paper Gift Box Folding Apple Candy Box With Satin Ribbon Bow Santa Claus Snowman Gingerbread Man Pattern Holiday Party Favor Packaging Box
Christmas Paper Gift Box Folding Apple Candy Box With Satin Ribbon Bow Santa Claus Snowman Gingerbread Man Pattern Holiday Party Favor Packaging Box
like
Find Similar
Pink Christmas gift box with snowman and tree illustrations and a red ribbon bow - Pink
Red Christmas apple gift box with cartoon gingerbread man and festive ribbon bow - Red
Green Christmas gift box with Santa and snowman patterns and decorative green ribbon bow - Green
Orange Christmas gift box with Santa illustration, snowflakes and yellow silk ribbon - Orange Yellow
Christmas Paper Gift Box Folding Apple Candy Box With Satin Ribbon Bow Santa Claus Snowman Gingerbread Man Pattern Holiday Party Favor Packaging Box
$0.16
Mix MOQ : 50
Glitter Heart Paper Straws Valentine's Day Wedding Party Decoration Red White Striped Polka Dot Love Straw Toppers Set
Glitter Heart Paper Straws Valentine's Day Wedding Party Decoration Red White Striped Polka Dot Love Straw Toppers Set
like
Find Similar
8-piece red and white Valentine's Day party straws with glittery love heart toppers - Glitter Heart Style
NewGlitter Heart Paper Straws Valentine's Day Wedding Party Decoration Red White Striped Polka Dot Love Straw Toppers Set
$1.10
Mix MOQ : 5
Halloween Cupcake Wrappers Laser Cut Witch Ghost Pumpkin Spider Web Silhouette Paper Lace Decorative Cake Wrappers Halloween Party Supplies
Halloween Cupcake Wrappers Laser Cut Witch Ghost Pumpkin Spider Web Silhouette Paper Lace Decorative Cake Wrappers Halloween Party Supplies
like
Find Similar
Macro view of red laser-cut Halloween cupcake wrapper featuring witch and pumpkin motifs - 5x5x8CM / Orange Red
Laser cut Halloween cupcake wrappers in silver mirror finish with witch and castle design - 5x5x8CM / Reflective Silver
Laser cut black Halloween cupcake wrappers featuring witch, pumpkin and spider web motifs - 5x5x8CM / Black
Laser cut Halloween cupcake wrappers in shiny gold featuring witch, pumpkin and bat motifs - 5x5x8CM / Reflective Gold
+9
Halloween Cupcake Wrappers Laser Cut Witch Ghost Pumpkin Spider Web Silhouette Paper Lace Decorative Cake Wrappers Halloween Party Supplies
$0.09
No MOQ
Cartoon Christmas Candy Gift Boxes Cone Shape Paper Santa Claus Reindeer Treat Packaging For Holiday Party Decoration
Cartoon Christmas Candy Gift Boxes Cone Shape Paper Santa Claus Reindeer Treat Packaging For Holiday Party Decoration
like
Find Similar
Christmas gift packaging kit featuring Santa Claus red card and gold text ring set - Santa Claus Style
Christmas Reindeer Paper Cup Sleeve Set with Merry Christmas labels in orange and red - Reindeer Style
NewCartoon Christmas Candy Gift Boxes Cone Shape Paper Santa Claus Reindeer Treat Packaging For Holiday Party Decoration
-5%
$0.92
No MOQ
Halloween Cupcake Wrappers Laser Cut Black Cardboard Gothic Castle Wizard Hollow Out Silhouette Party Cake Decoration
Halloween Cupcake Wrappers Laser Cut Black Cardboard Gothic Castle Wizard Hollow Out Silhouette Party Cake Decoration
like
Find Similar
Detailed laser-cut black castle silhouettes on Halloween cupcake wrappers - 5*5*8CM / Black
Halloween Cupcake Wrappers Laser Cut Black Cardboard Gothic Castle Wizard Hollow Out Silhouette Party Cake Decoration
$0.09
No MOQ
Halloween Laser Cut Cupcake Wrappers Hollow Castle Skull Design Cardstock Cake Decor For Party Supplies Black Gold Silver
Halloween Laser Cut Cupcake Wrappers Hollow Castle Skull Design Cardstock Cake Decor For Party Supplies Black Gold Silver
like
Find Similar
Detail of laser-cut golden castle cupcake wrapper with skull and tower silhouettes - 5x5x8CM / Reflective Gold
Macro detail of laser-cut Halloween cupcake wrapper with castle and skull motifs - 5x5x8CM / Reflective Silver
Intricate laser-cut castle and skull cupcake wrapper for Halloween party decoration - 5x5x8CM / Black
Detailed laser-cut cupcake wrapper featuring a red Halloween castle and skull motif - 5x5x8CM / Red
Halloween Laser Cut Cupcake Wrappers Hollow Castle Skull Design Cardstock Cake Decor For Party Supplies Black Gold Silver
$0.09
Mix MOQ : 50
DIY Explosion Box Scrapbook Hexagon Photo Album Gift Paper Box For Valentine Day Birthday Proposal Romantic Surprise Gift
DIY Explosion Box Scrapbook Hexagon Photo Album Gift Paper Box For Valentine Day Birthday Proposal Romantic Surprise Gift
like
Find Similar
1 option
DIY Explosion Box Scrapbook Hexagon Photo Album Gift Paper Box For Valentine Day Birthday Proposal Romantic Surprise Gift
$3.11
No MOQ
 · 
48 views
3D Pop Up Greeting Cards Laser Cut Specialty Paper Handmade Christmas Tree Reindeer Santa For Holiday Gift Invitation
3D Pop Up Greeting Cards Laser Cut Specialty Paper Handmade Christmas Tree Reindeer Santa For Holiday Gift Invitation
like
Find Similar
Blue 3D pop-up Christmas card featuring snowman and sleigh scene, size 11x11cm - Christmas Mini Card - Blue
3D Pop-up Christmas card featuring Santa and reindeer with memo paper 11x11cm - Santa and Deer
3D pop-up Christmas card featuring surfing Santa Claus with dimensions 11x11cm - Surfing Santa
3D pop-up Christmas card with Santa Claus motif and 15x10cm base dimensions - Santa Claus
+16
3D Pop Up Greeting Cards Laser Cut Specialty Paper Handmade Christmas Tree Reindeer Santa For Holiday Gift Invitation
-4%
$0.69-6.17
Mix MOQ : 3
 · 
41 sold recently
Free Shipping
Easter Cupcake Toppers Set Cardstock Rabbit Carrot Egg Cake Decorations For Easter Birthday Party Favors Supplies
Easter Cupcake Toppers Set Cardstock Rabbit Carrot Egg Cake Decorations For Easter Birthday Party Favors Supplies
like
Find Similar
Easter cake toppers with bunny, carrot, and egg designs for festive dessert decoration - Easter Mixed Styles
Detail view of carrot cake toppers arranged in a 2x3 grid on cupcakes for Easter parties - Carrot Shape
Easter Cupcake Toppers Set Cardstock Rabbit Carrot Egg Cake Decorations For Easter Birthday Party Favors Supplies
$0.86-0.92
No MOQ
Candy Shape Christmas Gift Boxes Glitter Striped Cardboard Paper Wedding Party Favors New Year Holiday Decorative Containers
Candy Shape Christmas Gift Boxes Glitter Striped Cardboard Paper Wedding Party Favors New Year Holiday Decorative Containers
like
Find Similar
Three-piece red candy-shaped gift box set with gold stripes for Christmas and New Year - Red 3-Piece Set
Golden candy-shaped gift box set with glitter stripes in small medium and large sizes - Gold 3-Piece Set
Three deep blue candy-shaped gift boxes with silver glitter stripes in three sizes - Blue 3-Piece Set
Three-piece rose red candy-shaped gift boxes with silver glitter stripes and metallic finish - Rose Red 3-Piece Set
+1
Candy Shape Christmas Gift Boxes Glitter Striped Cardboard Paper Wedding Party Favors New Year Holiday Decorative Containers
$2.88
Mix MOQ : 2
Glitter Frosted Christmas Decorative Gift Boxes With Ribbon Bow For Holiday Party Mall Window Display Ornament
Glitter Frosted Christmas Decorative Gift Boxes With Ribbon Bow For Holiday Party Mall Window Display Ornament
like
Find Similar
Pink frosted glitter Christmas gift box with silver ribbon bow decor, 15x15x15cm size - Pink / 15CM
Pink frosted glitter gift box with silver ribbon for Christmas and holiday decoration - Pink / 20cm
Frosted pink Christmas gift box with silver glitter bow, 25cm decorative holiday ornament - Pink / 25cm
Pink frosted glitter gift box with silver bow, 30x30x30cm festive Christmas decoration - Pink / 30cm
+20
Glitter Frosted Christmas Decorative Gift Boxes With Ribbon Bow For Holiday Party Mall Window Display Ornament
-5%
$3.70-6.99
No MOQ
 · 
10 views
Rectangular Watch Box PU Leather Jewelry Bracelet Storage Organizer Case With Velvet Lining And Contrast Stitching
Rectangular Watch Box PU Leather Jewelry Bracelet Storage Organizer Case With Velvet Lining And Contrast Stitching
like
Find Similar
Single black PU leather watch box with rectangle shape and white decorative stitching - Black Sheepskin Pattern External Beige Velvet Internal
Rectangle black PU leather watch gift box with white stitching for jewelry storage - Black Crystal Pattern External Beige Velvet Internal
Rectangular navy blue PU leather watch box with elegant white contrast stitching - Blue Sheepskin Pattern External Beige Velvet Internal
Rectangular Watch Box PU Leather Jewelry Bracelet Storage Organizer Case With Velvet Lining And Contrast Stitching
-9%
$3.09
Mix MOQ : 2
 · 
23 views
Customizable
Romantic Swan Heart Laser Cut Paper Candle Wrap Lampshade For Wedding Valentine's Day Party Decoration Hollow Candle Holder Cover
Romantic Swan Heart Laser Cut Paper Candle Wrap Lampshade For Wedding Valentine's Day Party Decoration Hollow Candle Holder Cover
like
Find Similar
LED candle with romantic laser-cut paper lampshade featuring swan heart and rose patterns - White
Pink swan heart hollow paper lampshade for romantic Valentine's Day LED tea light decor - Pink
Golden swan heart laser cut paper sleeve with warm LED candle light for romantic decor - Reflective Gold
Golden laser cut swan heart tea light candle holder with romantic hollow floral pattern - Gold
+3
Romantic Swan Heart Laser Cut Paper Candle Wrap Lampshade For Wedding Valentine's Day Party Decoration Hollow Candle Holder Cover
-11%
$0.08
Mix MOQ : 50
Christmas Reindeer Snowflake Hollow Out Paper Lampshade Festive LED Tea Light Candle Cover Decoration For Xmas Party Home Ornament
Christmas Reindeer Snowflake Hollow Out Paper Lampshade Festive LED Tea Light Candle Cover Decoration For Xmas Party Home Ornament
like
Find Similar
Silver metal Christmas candle holder with hollow reindeer and snowflake patterns and LED tea light - Reflective Silver
Close-up of white paper candle lampshade featuring hollowed reindeer and tree patterns - White
Christmas LED tea light with golden snowflake hollow metal sleeve and white candle base - Reflective Gold
Detail of pink laser-cut paper sleeve with reindeer and tree for LED tealight - Pink
+4
Christmas Reindeer Snowflake Hollow Out Paper Lampshade Festive LED Tea Light Candle Cover Decoration For Xmas Party Home Ornament
$0.09
Mix MOQ : 50
Free Shipping
3D Pop Up Greeting Card Floral Laser Cut Cardboard Kraft Paper Envelope Sticker Christmas Birthday Wedding Handmade Watercolor
3D Pop Up Greeting Card Floral Laser Cut Cardboard Kraft Paper Envelope Sticker Christmas Birthday Wedding Handmade Watercolor
like
Find Similar
3D floral pop-up greeting card set with kraft envelope and decorative sticker - Style B - Peach Blossom
3D pop-up cherry blossom greeting card set with envelope and sticker for festivals - Style C - Violet
Set D 3D pop-up flower greeting card with kraft envelope and floral sticker set - Style D - Hydrangea
3D pop-up floral greeting card set with kraft envelope and flower seal sticker - Style F - Daisy
+1
3D Pop Up Greeting Card Floral Laser Cut Cardboard Kraft Paper Envelope Sticker Christmas Birthday Wedding Handmade Watercolor
$0.58-3.46
No MOQ
 · 
58 sold recently
Acrylic Jewelry Storage Box Set With PVC Anti-Oxidation Bags Clear Compartmentalized Organizer For Earrings Rings Necklaces
Acrylic Jewelry Storage Box Set With PVC Anti-Oxidation Bags Clear Compartmentalized Organizer For Earrings Rings Necklaces
like
Find Similar
Acrylic jewelry box set with 20 colored PVC anti-oxidation bags for organizing earrings - Individually Packed in OPP Bag / Clear Box + Multicolor Bags
Acrylic Jewelry Storage Box Set With PVC Anti-Oxidation Bags Clear Compartmentalized Organizer For Earrings Rings Necklaces
$6.00-6.52
Mix MOQ : 2
 · 
12 views
Halloween Laser Cut Cupcake Wrappers Hollow Castle Witch Spider Web Pattern Paper Cake Decoration Party Supplies
Halloween Laser Cut Cupcake Wrappers Hollow Castle Witch Spider Web Pattern Paper Cake Decoration Party Supplies
like
Find Similar
Laser cut Halloween cupcake wrappers featuring witch and castle patterns for party decor - 5cm / White
Pink laser-cut Halloween cupcake wrapper with witch, castle and bat silhouettes - 5cm / Pink
Orange laser cut Halloween cupcake wrappers featuring witch, haunted house and pumpkin designs - 5cm / Pearlescent Red
Intricate laser-cut gold cupcake wrapper featuring a witch on a broom and pumpkin design - 5cm / Reflective Gold
+4
Halloween Laser Cut Cupcake Wrappers Hollow Castle Witch Spider Web Pattern Paper Cake Decoration Party Supplies
$0.09
Mix MOQ : 50
Halloween Owl Laser Cut Cupcake Wrappers Pearlescent Paper Hollow Out Cake Decorations For Party Wedding Birthday Dessert Table
Halloween Owl Laser Cut Cupcake Wrappers Pearlescent Paper Hollow Out Cake Decorations For Party Wedding Birthday Dessert Table
like
Find Similar
Laser-cut red cupcake wrapper with owl and tree branch pattern for Halloween decor - Pearlescent Red
Laser cut owl and branch Halloween cupcake wrappers in black paper for party decor - Black Khaki
Macro detail of laser cut owl cupcake wrapper with silver metallic finish and intricate pattern - Reflective Silver
Detail of laser-cut owl and tree branch pattern on white cupcake paper wrapper - White
+6
Halloween Owl Laser Cut Cupcake Wrappers Pearlescent Paper Hollow Out Cake Decorations For Party Wedding Birthday Dessert Table
$0.09
Mix MOQ : 100
Laser Cut Hollow Out Lamp Shade Pearlescent Paper Candle Wrap Maple Leaf Pattern For Thanksgiving Christmas Party Wedding Home Decor LED Candle Light
Laser Cut Hollow Out Lamp Shade Pearlescent Paper Candle Wrap Maple Leaf Pattern For Thanksgiving Christmas Party Wedding Home Decor LED Candle Light
like
Find Similar
Red laser-cut butterfly leaf pattern paper lamp shade with white LED candle - Pearlescent Red
Hollow heart and leaf pattern metal paper carving lamp with LED candle in champagne gold - Reflective Silver
Elegant white laser-cut hollow paper lampshade with floral patterns for LED candles - White
Pink laser-cut paper candle wrap with butterfly and heart patterns for LED tealight - Pink
+7
Laser Cut Hollow Out Lamp Shade Pearlescent Paper Candle Wrap Maple Leaf Pattern For Thanksgiving Christmas Party Wedding Home Decor LED Candle Light
$0.09
Mix MOQ : 50
Go to

More in party supplies

Explore more in heart shaped boxes

hearthollowgoldwindoweveningartificial pearldiyhomeday giftearrings necklaces
partycrossbodyartificialmetaldesigngirlskidsstyletravelbands

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access