Everful

Wholesale flower clips

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Flower Clips

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Sweet Fabric Rose Flower Hair Clip Elegant Red Floral Duckbill Hairpin Aesthetic Spring Summer Accessory For Women
Sweet Fabric Rose Flower Hair Clip Elegant Red Floral Duckbill Hairpin Aesthetic Spring Summer Accessory For Women
like
Find Similar
Detailed close-up of a realistic red fabric rose hair clip with green leaves - Red Rose Duckbill Clip
Sweet Fabric Rose Flower Hair Clip Elegant Red Floral Duckbill Hairpin Aesthetic Spring Summer Accessory For Women
$0.80
No MOQ
Vintage Rhinestone Flower Hair Clip Alloy Spring Barrette Ponytail Holder For Women Elegant Retro Headpiece
Vintage Rhinestone Flower Hair Clip Alloy Spring Barrette Ponytail Holder For Women Elegant Retro Headpiece
like
Find Similar
Vintage floral hair clip with blue rhinestones and pink resin rose on silver base - Rhinestone Spring Clip / Blue
Vintage Rhinestone Flower Hair Clip Alloy Spring Barrette Ponytail Holder For Women Elegant Retro Headpiece
$1.01
No MOQ
 · 
11 views
Sweet Acrylic Printed Flower Heart Hair Claw Clip Large Floral Hair Clip For Women Daily Dating Fashion Hair Accessories
Sweet Acrylic Printed Flower Heart Hair Claw Clip Large Floral Hair Clip For Women Daily Dating Fashion Hair Accessories
like
Find Similar
Large light blue square hair claw clip with white daisy petals and red heart patterns - Light Blue Floral Style (D1-1-16)
Pink floral hair claw clip with heart patterns and glossy finish for women's hairstyling - Pink Floral Style (D1-1-19)
Navy blue large hair claw clip with white daisy patterns and red heart centers - Navy Blue Floral Style (D1-1-17)
Magenta hair claw clip with white daisy patterns and tiny red heart details - Rose Red Floral Style (D1-1-18)
NewSweet Acrylic Printed Flower Heart Hair Claw Clip Large Floral Hair Clip For Women Daily Dating Fashion Hair Accessories
$0.98
Mix MOQ : 2
Sweet Pink Acetate Hair Claw Clip Heart Flower Arc Shaped Shark Clip Fashion Hair Accessory For Women Girls Daily Styling
Sweet Pink Acetate Hair Claw Clip Heart Flower Arc Shaped Shark Clip Fashion Hair Accessory For Women Girls Daily Styling
like
Find Similar
Detail view of heart-shaped pink hair claw clip in glossy finish on white table - Heart Shape Hair Claw
Pink floral acetate hair claw clip with heart-shaped curve design for women's hairstyles - Flower Style Claw
Pink acetate flower claw clip with minimalist curved design and secure grip teeth - Arc Hair Claw
NewSweet Pink Acetate Hair Claw Clip Heart Flower Arc Shaped Shark Clip Fashion Hair Accessory For Women Girls Daily Styling
$1.44-1.73
No MOQ
Handmade Mesh Flower Rhinestone Spring Hair Clip Elegant Alloy Leaf Floral Hairpin For Women Sweet Daily Hair Accessories
Handmade Mesh Flower Rhinestone Spring Hair Clip Elegant Alloy Leaf Floral Hairpin For Women Sweet Daily Hair Accessories
like
Find Similar
Handmade flower spring clip with brown gauze petals and rhinestones on rose gold base - Champagne
Blue handmade flower hair clip with teal water-drop crystals and white rhinestones - Blue
Rose gold floral spring clip with luxury rhinestones and crystal leaf detail - White
Handmade Mesh Flower Rhinestone Spring Hair Clip Elegant Alloy Leaf Floral Hairpin For Women Sweet Daily Hair Accessories
-5%
$1.14
Mix MOQ : 2
Elegant Bow Rhinestone Flower Hair Clip With Imitation Artificial Pearl Alloy Spring Hairpin Vintage Hair Accessories For Women Wedding
Elegant Bow Rhinestone Flower Hair Clip With Imitation Artificial Pearl Alloy Spring Hairpin Vintage Hair Accessories For Women Wedding
like
Find Similar
Golden bow hair clip featuring elegant white rhinestones, pearls and mother-of-pearl flowers - Wusi Style
Elegant gold bow hair clip with rhinestones, pearls and white flowers on dark base - Jindai Style
Elegant gold bow hair clip with white pearls and sparkling rhinestones on grey background - Ribbon
Elegant Bow Rhinestone Flower Hair Clip With Imitation Artificial Pearl Alloy Spring Hairpin Vintage Hair Accessories For Women Wedding
-4%
$1.91
Mix MOQ : 2
Free Shipping
Flower Hair Clips Acrylic Resin Marble Texture Bangs Side Clip Korean Style Elegant Sweet Headwear For Women Girls
Flower Hair Clips Acrylic Resin Marble Texture Bangs Side Clip Korean Style Elegant Sweet Headwear For Women Girls
like
Find Similar
Detail view of flower hair clips with amber and cream marble acrylic texture on a white plate - Amber
Close-up of two pink flower hair clips with marble texture on a ceramic plate - Sakura Pink
Close-up of cream floral acetate hair clips with marble texture on a white plate - Glazed White
Flower Hair Clips Acrylic Resin Marble Texture Bangs Side Clip Korean Style Elegant Sweet Headwear For Women Girls
$0.15
Mix MOQ : 2
Cute Children Brown Fabric Covered Water Drop Hair Clips Cartoon Bear Star Flower Checkered Bow BB Clips Girls Hair Accessories
Cute Children Brown Fabric Covered Water Drop Hair Clips Cartoon Bear Star Flower Checkered Bow BB Clips Girls Hair Accessories
like
Find Similar
Pair of cute brown plush bear hair clips for girls on a white branded display card - Knitted Bear
Detailed macro of two brown plush star hair clips on a white display card backing - Dotted Star
Detailed view of brown velvet teardrop hair clips with plaid buttons and pink bows - Checkered Bow
Cute Children Brown Fabric Covered Water Drop Hair Clips Cartoon Bear Star Flower Checkered Bow BB Clips Girls Hair Accessories
$0.58-0.72
Mix MOQ : 2
Korean Sweet Acrylic Flower Hair Clips For Women Elegant Alloy Rhinestone Side Clip Floral Hairpin Girls Hair Accessories
Korean Sweet Acrylic Flower Hair Clips For Women Elegant Alloy Rhinestone Side Clip Floral Hairpin Girls Hair Accessories
like
Find Similar
Detail of three grey-green floral hair clips with crystals on a golden metal base - Handmade / Elegant Green
Close-up of lavender flower hair clip with golden metal base and sparkling rhinestones - Handmade / Taro Purple
Detail showing three yellow floral hair clips with rhinestones on a gold alloy base - Handmade / Champagne
Korean Sweet Acrylic Flower Hair Clips For Women Elegant Alloy Rhinestone Side Clip Floral Hairpin Girls Hair Accessories
$1.01
No MOQ
Free Shipping
Handmade Rhinestone Flower Hair Clip Alloy Artificial Pearl Duckbill Clip For Wedding Bridal Party Hair Accessories
Handmade Rhinestone Flower Hair Clip Alloy Artificial Pearl Duckbill Clip For Wedding Bridal Party Hair Accessories
like
Find Similar
Handmade silver floral hair clip with rhinestones and pearls for bridal hairstyles - Silver (HS-J7457S)
Detailed close-up of handmade bridal flower hair clip with crystals and pearls - Gold (HS-J7457G)
Detail showing handmade rhinestone plum blossom hair clip with red crystals and pearls - Christmas Red Green Rhinestone (HS-J7457GCAI)
Handmade Rhinestone Flower Hair Clip Alloy Artificial Pearl Duckbill Clip For Wedding Bridal Party Hair Accessories
$3.17
Mix MOQ : 3
Alloy Rhinestone Flower Hair Clips For Women Kids Fashion Sweet Sparkling Crystal Duckbill Clips For Daily Party Jewelry
Alloy Rhinestone Flower Hair Clips For Women Kids Fashion Sweet Sparkling Crystal Duckbill Clips For Daily Party Jewelry
like
Find Similar
Detail view of sparkling crystal flower hair clips with size 4cm and weight 16g data - Silver
Sparkling blue crystal flower hair clip pair featuring elegant rhinestone marquise petals - Silver Blue
Pink and peach rhinestone flower clip on earrings with a diameter of 4cm and 16g weight - Silver Pink
Alloy Rhinestone Flower Hair Clips For Women Kids Fashion Sweet Sparkling Crystal Duckbill Clips For Daily Party Jewelry
-5%
$2.19
Mix MOQ : 3
Free Shipping
Luxurious Crystal Flower Hair Clip Rectangular Rhinestone Barrettes Women Elegant Korean Style Bangs Side Hair Accessory
Luxurious Crystal Flower Hair Clip Rectangular Rhinestone Barrettes Women Elegant Korean Style Bangs Side Hair Accessory
like
Find Similar
Detailed macro shot of a crystal floral hair clip featuring 3D petals and rhinestones - White (B82-103)
Handheld amber beaded square hair clip with floral accents and sparkling rhinestones - Champagne (B82-103)
Sparkling crystal rhinestone rectangular hair clip with star motif in deep grey and silver - Gray (B82-103)
Luxurious Crystal Flower Hair Clip Rectangular Rhinestone Barrettes Women Elegant Korean Style Bangs Side Hair Accessory
$2.28
No MOQ
Free Shipping
Elegant Crystal Flower Mini Hair Claw Clip With Tassel Artificial Pearl Rhinestone Hairpins Fresh Fairy Style Hair Accessories For Women
Elegant Crystal Flower Mini Hair Claw Clip With Tassel Artificial Pearl Rhinestone Hairpins Fresh Fairy Style Hair Accessories For Women
like
Find Similar
Mini floral crystal hair claw clip with teardrop pendants and gold spring detail - Light Blue
Elegant mini flower hair claw with grey crystals and long pearl tassel charms - Gray
Champagne crystal flower hair claw with pearl tassels and golden spring detail - Purple Pink
Elegant Crystal Flower Mini Hair Claw Clip With Tassel Artificial Pearl Rhinestone Hairpins Fresh Fairy Style Hair Accessories For Women
$3.31
No MOQ
Free Shipping
Sweet Gauze Flower Hair Clips Elegant 3D Floral Duckbill Clips Side Ponytail Hairpins For Women Vacation Hair Accessory
Sweet Gauze Flower Hair Clips Elegant 3D Floral Duckbill Clips Side Ponytail Hairpins For Women Vacation Hair Accessory
like
Find Similar
Elegant purple 3D fabric flower hair clip with delicate sheer organza petals for women - Purple
Close-up of a pink handcrafted 3D fabric flower clip on a wooden display board - Pink
Detailed macro view of Morandi blue chiffon fabric flower on dark walnut and burlap - Blue
Sweet Gauze Flower Hair Clips Elegant 3D Floral Duckbill Clips Side Ponytail Hairpins For Women Vacation Hair Accessory
-5%
$0.55
No MOQ
Vintage Tweed Artificial Pearl Hair Clip For Women Alloy Rhinestone Duckbill Clip Sweet Flower Animal Hair Accessories
Vintage Tweed Artificial Pearl Hair Clip For Women Alloy Rhinestone Duckbill Clip Sweet Flower Animal Hair Accessories
like
Find Similar
Detail of tweed flower hair clip with pearls and rhinestones on a display card - Tweed Black
Detail of tweed hair clip with imitation pearls, white flower, and shiny rhinestones - Camellia Style Coffee
Detailed close-up of a tweed hair clip with white pearls, flower and sparkling crystals - Pink Tweed Style
Vintage Tweed Artificial Pearl Hair Clip For Women Alloy Rhinestone Duckbill Clip Sweet Flower Animal Hair Accessories
-4%
$0.69
No MOQ
French Vintage Moth Orchid Flower Hair Clip With Artificial Pearl Ombre Simulation Floral Duckbill Clip For Women Sweet Headwear
French Vintage Moth Orchid Flower Hair Clip With Artificial Pearl Ombre Simulation Floral Duckbill Clip For Women Sweet Headwear
like
Find Similar
Elegant yellow orchid hair clip with faux pearl detail on a creamy jewelry tray - Yellow
Elegant gradient pink butterfly orchid hair clip with pearl center on jewelry tray - White Pink Gradient
Elegant gradient pink orchid hair clip with pearl center in a wooden jewelry tray - Pink Gradient
French Vintage Moth Orchid Flower Hair Clip With Artificial Pearl Ombre Simulation Floral Duckbill Clip For Women Sweet Headwear
$0.40
No MOQ
Korean Autumn Winter Faux Mink Fur Flower BB Hair Clips For Girls Women Sweet Floral Waterdrop Plush Hairpins Accessories
Korean Autumn Winter Faux Mink Fur Flower BB Hair Clips For Girls Women Sweet Floral Waterdrop Plush Hairpins Accessories
like
Find Similar
Set of two pink faux mink fur BB hair clips featuring yellow 3D floral accents - Pink
Set of two purple faux mink fur BB hair clips with pink plastic flower decor on card - Purple
Pair of mint green faux mink fur drop hair clips with green flower accents for girls - Green
Korean Autumn Winter Faux Mink Fur Flower BB Hair Clips For Girls Women Sweet Floral Waterdrop Plush Hairpins Accessories
$0.92
Mix MOQ : 2
Free Shipping
Elegant Tulip Flower Bow Hair Clip For Women Satin Fabric Bowknot Hair Accessories Floral Hairpin For Daily Party Wedding
Elegant Tulip Flower Bow Hair Clip For Women Satin Fabric Bowknot Hair Accessories Floral Hairpin For Daily Party Wedding
like
Find Similar
Macro detail of tulip bow hair clip with black satin fabric and pink floral bud accents - Black Tulip Bow Style / Black
Elegant pink ribbon bow hair clip featuring tulip floral charms and green ribbon accents - Pink Tulip Bow Style / Pink
Elegant white bow hair clip with pink tulip pendants and green accents for women - White Tulip Bow Style / White
Elegant Tulip Flower Bow Hair Clip For Women Satin Fabric Bowknot Hair Accessories Floral Hairpin For Daily Party Wedding
$1.30
Mix MOQ : 2
Sweet Satin Bow Hair Clip With Fabric Rose Elegant French Style Duckbill Clip Handmade Flower Hair Accessories For Women
Sweet Satin Bow Hair Clip With Fabric Rose Elegant French Style Duckbill Clip Handmade Flower Hair Accessories For Women
like
Find Similar
Detail of a black satin bow hair clip with a pink fabric rose against a wooden background - Black
Detail of pink satin bow hair clip with textured rose flower and elegant ribbon finish - Pink
Detail of a white silk bow hair clip featuring a delicate pink organza rose embellishment - White
Sweet Satin Bow Hair Clip With Fabric Rose Elegant French Style Duckbill Clip Handmade Flower Hair Accessories For Women
$1.10
Mix MOQ : 2
Elegant French Vintage Embroidery Rose Bow Hair Clip Satin Flower Duckbill Clip For Women Ethnic Handmade Hair Accessories
Elegant French Vintage Embroidery Rose Bow Hair Clip Satin Flower Duckbill Clip For Women Ethnic Handmade Hair Accessories
like
Find Similar
Pink Chinese embroidery flower bow hair clip in a vintage style jewelry display box - Pink
Close-up of cream bow hair clip with silk rose and gold floral embroidery pattern - Beige
Macro detail of Chinese style purple satin bow hair clip with handmade 3D fabric rose flower - Purple
Elegant French Vintage Embroidery Rose Bow Hair Clip Satin Flower Duckbill Clip For Women Ethnic Handmade Hair Accessories
$0.86
Mix MOQ : 2
Vintage Alloy Enamel Rose Flower Round Hair Clip Elegant Korean Ins Style Duckbill Clip Side Clip For Women Daily Accessories
Vintage Alloy Enamel Rose Flower Round Hair Clip Elegant Korean Ins Style Duckbill Clip Side Clip For Women Daily Accessories
like
Find Similar
Floral alloy hair clip with white enamel circles and gold rose relief design - Round White
Alloy hair clip with light blue floral discs in gold finish, measuring 4.9cm by 1.5cm - Round Blue
Pink enamel flower hair clip with golden rose details and alloy frame, 4.9CM length - Round Pink
Vintage Alloy Enamel Rose Flower Round Hair Clip Elegant Korean Ins Style Duckbill Clip Side Clip For Women Daily Accessories
-5%
$1.26
No MOQ
Free Shipping
Korean Style Black Acetate Hair Clips Rhinestone Inlaid Geometric Bow Flower Hairpins Frog Clips For Women Elegant Hair Accessories
Korean Style Black Acetate Hair Clips Rhinestone Inlaid Geometric Bow Flower Hairpins Frog Clips For Women Elegant Hair Accessories
like
Find Similar
Elegant black acetate hair clip with high-quality rhinestones measuring 6.3cm in length - Stripes
Elegant black acetate bow hair clip with white rhinestones and anti-slip metal grip - Hollow Bowknot
Elegant black acetate hair clip featuring premium sparkling rhinestone flower design - Plum Blossom
Korean Style Black Acetate Hair Clips Rhinestone Inlaid Geometric Bow Flower Hairpins Frog Clips For Women Elegant Hair Accessories
$1.84-2.42
Mix MOQ : 2
Free Shipping
Handmade Rhinestone Flower Bridal Hair Clip Luxury Alloy Crystal Floral Leaf Hair Accessories For Wedding Photography Women Jewelry
Handmade Rhinestone Flower Bridal Hair Clip Luxury Alloy Crystal Floral Leaf Hair Accessories For Wedding Photography Women Jewelry
like
Find Similar
Exquisite silver bridal hair clip featuring handmade rhinestones and white pearls - Silver Style (HS-J7457S)
Elegant gold bridal hair clip with sparkling marquise crystals and white pearls - Gold Style (HS-J7457G)
Handmade bridal hair clip with red and green crystals, gold wire flowers and pearls - Red Green Multicolor Style (HS-J7457GCAI)
Handmade Rhinestone Flower Bridal Hair Clip Luxury Alloy Crystal Floral Leaf Hair Accessories For Wedding Photography Women Jewelry
$3.11
Mix MOQ : 2
Free Shipping
French Vintage Knitted Flower Hair Clip For Women Handmade Velvet Wrapped Duckbill Clip Floral Hair Accessories Jewelry
French Vintage Knitted Flower Hair Clip For Women Handmade Velvet Wrapped Duckbill Clip Floral Hair Accessories Jewelry
like
Find Similar
French style knitted orange flower hair clip with pearl and golden love charm - Orange
Detail of French knit flower hair clip with navy flocking texture on wooden tray - Blue
French style knitted beige flower hair clip with amber bead and gold Love tag - Dark Coffee
French Vintage Knitted Flower Hair Clip For Women Handmade Velvet Wrapped Duckbill Clip Floral Hair Accessories Jewelry
-5%
$1.04
No MOQ
Handmade White Gauze Flower Hairpin And Hair Clip With Artificial Pearl Elegant Bridal Wedding Hair Accessories For Women
Handmade White Gauze Flower Hairpin And Hair Clip With Artificial Pearl Elegant Bridal Wedding Hair Accessories For Women
like
Find Similar
Elegant white mesh flower hair pins with pearls and golden metal U-shaped clip - Gold Floral Hair Pin (HS-J7355G) / 2Pcs/Set
Elegant white organza flower hair pins set with pearls on dark blue silk background - Silver Floral Hair Pin (HS-J7350S) / 2Pcs/Set
Detail view of 3-piece white mesh flower hair clips with gold beads and rhinestones - Gold Floral Duckbill Clip (HS-J7353G) / 3pcs
NewHandmade White Gauze Flower Hairpin And Hair Clip With Artificial Pearl Elegant Bridal Wedding Hair Accessories For Women
$0.75-2.59
No MOQ
Free Shipping
Korean Style Flower Hair Clip For Women Alloy Pearlescent Rhinestone Sweet Elegant Small Side Clip Hair Accessory
Korean Style Flower Hair Clip For Women Alloy Pearlescent Rhinestone Sweet Elegant Small Side Clip Hair Accessory
like
Find Similar
Detailed close-up of golden wavy hair clip with pearly white flowers and sparkling crystals - Double Flower Pearlescent Gold Clip (Model A)
Elegant gold teardrop hair clip with a white resin flower and sparkling rhinestones - Single Flower Rhinestone BB Clip (Model B)
Detailed close-up of a gold-plated bow bear flower hair clip with rhinestones and enamel - Triple Flower Linear Rhinestone Clip (Model C)
Korean Style Flower Hair Clip For Women Alloy Pearlescent Rhinestone Sweet Elegant Small Side Clip Hair Accessory
$2.19
No MOQ
Free Shipping
Pink Blue Contrast Color Sweet Hair Clip Alloy Drip Oil Flower Heart Star Pattern Hair Accessory Duckbill Clip For Women
Pink Blue Contrast Color Sweet Hair Clip Alloy Drip Oil Flower Heart Star Pattern Hair Accessory Duckbill Clip For Women
like
Find Similar
Sweet pink and blue contrast duckbill hair clip with polished finish on a ceramic plate - Blue Heart Pink Strip
Close-up of pink and blue contrast star hair clip with rhinestone in a ceramic dish - Blue Flower Pink Strip
Detailed view of pink and blue contrast duckbill hair clip on a textured ceramic plate - Colorful Polka Dot Pink Strip
Pink Blue Contrast Color Sweet Hair Clip Alloy Drip Oil Flower Heart Star Pattern Hair Accessory Duckbill Clip For Women
-4%
$1.92-2.52
No MOQ
Free Shipping
Sweet Butterfly Camellia Hair Clip For Women Fabric 3D Flower Side Clip Handmade Embroidered Pastoral Vacation Hair Accessories
Sweet Butterfly Camellia Hair Clip For Women Fabric 3D Flower Side Clip Handmade Embroidered Pastoral Vacation Hair Accessories
like
Find Similar
Apricot fabric rose hair clip with purple embroidered mesh butterfly accessory - 3# Yellow Flower Hair Clip
Blue-tinted camellia hair clip with silk fabric petals and a delicate embroidered butterfly - 1# Orange Flower Hair Clip
Close-up of intricate blue embroidered butterfly hair clip on a purple flower - 2# Green Flower Hair Clip
Sweet Butterfly Camellia Hair Clip For Women Fabric 3D Flower Side Clip Handmade Embroidered Pastoral Vacation Hair Accessories
-4%
$0.97
No MOQ
Handmade Pink Satin Rose Flower Hair Clips For Women Girls Sweet Rhinestone Ribbon Bow Hairpins Bangs Clip Hair Accessories
Handmade Pink Satin Rose Flower Hair Clips For Women Girls Sweet Rhinestone Ribbon Bow Hairpins Bangs Clip Hair Accessories
like
Find Similar
Detailed macro view of pink fabric bow hair clip with a multifaceted gemstone center - Rose Pink Feather Clip Style
Detail view of handmade pink satin rose hair clips with crystal center and frayed ribbons - Rose Pink Flower Duckbill Clip Style
Handmade pink ribbon bow hair clip with satin rose flower and crystal for girls - Rose Pink Flower Green Bow Style
Handmade Pink Satin Rose Flower Hair Clips For Women Girls Sweet Rhinestone Ribbon Bow Hairpins Bangs Clip Hair Accessories
-5%
$1.88-2.34
No MOQ
Elegant Satin Ribbon Bow Hair Clip With Artificial Crystal Beaded Flower Handmade Duckbill Clip For Women Daily Hair Accessory
Elegant Satin Ribbon Bow Hair Clip With Artificial Crystal Beaded Flower Handmade Duckbill Clip For Women Daily Hair Accessory
like
Find Similar
Detail of sweet pink ribbon bow hair clip with transparent beaded floral accents on box - Pink Bow Pink Crystal Hair Clip
Detail of a black satin ribbon bow hair clip with decorative transparent faceted beads - Black Bow White Crystal Hair Clip
Handmade cream ribbon bow hair clip with transparent beads on elegant book background - Creamy White Bow White Crystal Hair Clip
Elegant Satin Ribbon Bow Hair Clip With Artificial Crystal Beaded Flower Handmade Duckbill Clip For Women Daily Hair Accessory
-4%
$2.19
No MOQ
Free Shipping
Sweet Flower Acetate Hair Clip Elegant Duckbill Clip Fashion Commute Side Clip For Women Daily Styling Hair Accessory
Sweet Flower Acetate Hair Clip Elegant Duckbill Clip Fashion Commute Side Clip For Women Daily Styling Hair Accessory
like
Find Similar
Sweet acetate flower hair clip with vintage tortoiseshell pattern and duckbill design - Acetate Material (1#) / Tortoiseshell Blue Flower Hair Clip
Chic acetic acid flower hair clip with black and white cow pattern for women - Acetate Material (2#) / Black and White Texture Flower Hair Clip
Elegant lotus root pink acetate flower hair clip with yellow-green gradient petals - Acetate Material (3#) / Green Tortoiseshell Splicing Flower Hair Clip
Sweet Flower Acetate Hair Clip Elegant Duckbill Clip Fashion Commute Side Clip For Women Daily Styling Hair Accessory
-4%
$0.77
No MOQ
Elegant Acetate Hair Claw Clip For Women French Style Rhinestone Bowknot Flower Cloud Shaped Shark Clip Hair Accessories
Elegant Acetate Hair Claw Clip For Women French Style Rhinestone Bowknot Flower Cloud Shaped Shark Clip Hair Accessories
like
Find Similar
Pink acetate bow hair claw clip with rhinestones displayed on a premium jewelry tray - Pink Bow Style / Pink Rhinestone Bowknot Claw Clip
Elegant cream acetate bow hair claw clip with pink gradient flowers and rhinestones - Milk White Flower Style / Milk White Rhinestone Flower Claw Clip
Elegant cream and pink acetate bow hair claw clip for a French style half-up hairstyle - Cream White Cloud Style / Cloud Hair Clip
Elegant Acetate Hair Claw Clip For Women French Style Rhinestone Bowknot Flower Cloud Shaped Shark Clip Hair Accessories
-4%
$2.68-2.88
No MOQ
Sweet Organza Bow Rose Flower Hair Clip For Women Girls Handmade Duckbill Clip Elegant Mesh Side Fringe Clip Hair Accessories
Sweet Organza Bow Rose Flower Hair Clip For Women Girls Handmade Duckbill Clip Elegant Mesh Side Fringe Clip Hair Accessories
like
Find Similar
Close-up of a delicate mesh bow hair clip featuring a small pink fabric rose flower - Pink Flower
Elegant white mesh bow hair clip featuring a beige fabric rose and translucent organza fabric - Brown Flower
Elegant mesh bow hair clip with a cream rose, held against a wooden background - Off-white Floral
NewSweet Organza Bow Rose Flower Hair Clip For Women Girls Handmade Duckbill Clip Elegant Mesh Side Fringe Clip Hair Accessories
$0.81
Mix MOQ : 2
Free Shipping
Vintage Alloy Rhinestone Bow Butterfly Flower Hair Clips For Women Elegant Gunmetal Duckbill Side Clips Fashion Hair Accessories
Vintage Alloy Rhinestone Bow Butterfly Flower Hair Clips For Women Elegant Gunmetal Duckbill Side Clips Fashion Hair Accessories
like
Find Similar
Bow knot hair clip with champagne rhinestones on dark silver frame 2.5x5cm - Butterfly
Grey alloy flower hair clip with rhinestones and black pearl on white display card - Flower
Bow hair clip with purple and grey rhinestones in a gunmetal finish alloy setting - Double Bow
NewVintage Alloy Rhinestone Bow Butterfly Flower Hair Clips For Women Elegant Gunmetal Duckbill Side Clips Fashion Hair Accessories
$1.01-1.13
No MOQ
Alloy Rhinestone Hair Clip Butterfly Flower Bear Sweet Cool Style Duckbill Clip For Women Silver Color Hair Jewelry
Alloy Rhinestone Hair Clip Butterfly Flower Bear Sweet Cool Style Duckbill Clip For Women Silver Color Hair Jewelry
like
Find Similar
Detail of silver alloy bear hair clip with sparkling rhinestones on an elegant background - Bear
Detail shot of a silver floral hair clip with pearl petals and sparkling rhinestones - Flower
Detailed close-up of a silver bow-shaped metal hair clip with pearls and rhinestones - Butterfly
Alloy Rhinestone Hair Clip Butterfly Flower Bear Sweet Cool Style Duckbill Clip For Women Silver Color Hair Jewelry
$0.98
No MOQ
Korean Fashion Artificial Pearl Fabric Flower Hair Comb Elegant French Vintage Anti-Slip Hair Insert Clip For Women
Korean Fashion Artificial Pearl Fabric Flower Hair Comb Elegant French Vintage Anti-Slip Hair Insert Clip For Women
like
Find Similar
Detail of elegant hair comb featuring a soft pink fabric rose and three glossy white pearls - Beige Flower Hair Comb
Detail of floral hair comb with a grey fabric rose and three elegant white pearls - Gray Flower Hair Comb
Detail of elegant camellia flower hair comb with large pearls on textured fabric - Coffee Flower Hair Comb
Korean Fashion Artificial Pearl Fabric Flower Hair Comb Elegant French Vintage Anti-Slip Hair Insert Clip For Women
$1.59
No MOQ
Luxurious Korean Style Velvet Rhinestone Hair Clip For Women Butterfly Flower Alloy Bobby Pin Elegant Hair Accessories
Luxurious Korean Style Velvet Rhinestone Hair Clip For Women Butterfly Flower Alloy Bobby Pin Elegant Hair Accessories
like
Find Similar
Detail of Korean style velvet hair clip with four grey rhinestones on a display card - Square Diamond Style
Detailed close-up of a crystal butterfly hair clip with velvet base on a display card - Butterfly Style
Macro view of velvet hair clip with gray crystals and elegant floral alloy base - Flower Style
NewLuxurious Korean Style Velvet Rhinestone Hair Clip For Women Butterfly Flower Alloy Bobby Pin Elegant Hair Accessories
$2.16-3.11
No MOQ
Free Shipping
Handmade Vintage Dried Flower Hair Clip Plant Specimen Resin Duckbill Clip Gold Alloy Artificial Pearl Floral Side Clip
Handmade Vintage Dried Flower Hair Clip Plant Specimen Resin Duckbill Clip Gold Alloy Artificial Pearl Floral Side Clip
like
Find Similar
Handmade hair clip with dried red rose petal, pearls and gold base on white background - Rose Flower
Handmade clear resin hair clip with real green hydrangea petals and gold foil flakes - Hydrangea Style
Handmade resin hair clip with dried yellow flowers and golden vintage metal base - Plum Shape
Handmade Vintage Dried Flower Hair Clip Plant Specimen Resin Duckbill Clip Gold Alloy Artificial Pearl Floral Side Clip
-5%
$4.65
Mix MOQ : 2
Free Shipping
Vintage Korean Style Alloy Rhinestone Artificial Pearl Hair Clip For Women Bear Note Flower Bow Duckbill Clip Accessory
Vintage Korean Style Alloy Rhinestone Artificial Pearl Hair Clip For Women Bear Note Flower Bow Duckbill Clip Accessory
like
Find Similar
Detail of a butterfly hair clip with sparkling rhinestones and a white heart pearl - Gold Bear
Detailed shot of golden hair clip featuring elegant pearls and sparkling rhinestones - Gold Musical Note
Vintage Korean Style Alloy Rhinestone Artificial Pearl Hair Clip For Women Bear Note Flower Bow Duckbill Clip Accessory
-4%
$0.47
No MOQ
Sweet Kids Knitted Fabric Flower Bow Hair Clips Multiple Colorful Embroidery Handmade Girls Hair Accessories For Daily Use
Sweet Kids Knitted Fabric Flower Bow Hair Clips Multiple Colorful Embroidery Handmade Girls Hair Accessories For Daily Use
like
Find Similar
Detailed macro view of 3-piece floral fabric hair clips with crochet flowers and beads - Pink Yellow Purple
Close-up of three sweet bubble fabric hair clips in yellow, pink, and purple for girls - Yellow Pink Purple
Sweet Kids Knitted Fabric Flower Bow Hair Clips Multiple Colorful Embroidery Handmade Girls Hair Accessories For Daily Use
$2.10
Mix MOQ : 2
Free Shipping
Sweet Korean Style Spring Clip Artificial Pearl Colorful Rhinestone Hairpin Alloy Rainbow Flower Side Clip Women Hair Accessories
Sweet Korean Style Spring Clip Artificial Pearl Colorful Rhinestone Hairpin Alloy Rainbow Flower Side Clip Women Hair Accessories
like
Find Similar
Elegant gold metal hair clip with colorful marquise rhinestones and white pearls - Gold
Rainbow crystal and pearl spring hair clip with colorful rhinestones on silver metal - Silver
Sweet Korean Style Spring Clip Artificial Pearl Colorful Rhinestone Hairpin Alloy Rainbow Flower Side Clip Women Hair Accessories
$1.21
Mix MOQ : 2
Baby Girls Hair Clips Flower Bow Rabbit Princess Hairpins For Toddlers Kids Cute Fabric Sweet Infant Hair Accessories
Baby Girls Hair Clips Flower Bow Rabbit Princess Hairpins For Toddlers Kids Cute Fabric Sweet Infant Hair Accessories
like
Find Similar
Detail of 5-piece pink floral baby girl hair clip set with bows and fabric flowers - 5B Pink Style
Detail view of 5-piece girls' hair clip set with floral bows and embroidered clips - 5D Green Blue Style
Baby Girls Hair Clips Flower Bow Rabbit Princess Hairpins For Toddlers Kids Cute Fabric Sweet Infant Hair Accessories
-5%
$1.51
Mix MOQ : 10
Vintage Leopard Print Rose Flower Hair Accessory For Women Fabric Hair Tie And Hair Clip With Artificial Pearl Embellishment
Vintage Leopard Print Rose Flower Hair Accessory For Women Fabric Hair Tie And Hair Clip With Artificial Pearl Embellishment
like
Find Similar
Close-up of leopard print rose hair tie with white pearl pendants in vintage box - Leopard Scrunchie
Detail of leopard print fabric rose hair claw with black ribbon bow and pearl accent - Hair Bow
Vintage Leopard Print Rose Flower Hair Accessory For Women Fabric Hair Tie And Hair Clip With Artificial Pearl Embellishment
$0.81-0.86
No MOQ
Sweet Polka Dot Fabric Hair Clips For Women Girls Cute Black Flower Red Cherry BB Clips Handmade Korean Hair Accessories
Sweet Polka Dot Fabric Hair Clips For Women Girls Cute Black Flower Red Cherry BB Clips Handmade Korean Hair Accessories
like
Find Similar
White fabric hair clip with black polka dots and a flocked flower on a shell plate - Black Flower Style (1# White Clip Black Polka Dot Black Flower)
Polka dot cherry BB hair clip with red fruit decor on white shell jewelry tray - Red Cherry Style (2# White Clip Black Polka Dot Red Cherry)
Sweet Polka Dot Fabric Hair Clips For Women Girls Cute Black Flower Red Cherry BB Clips Handmade Korean Hair Accessories
-5%
$0.52
No MOQ
Gothic Red Rose Hair Clip With Black Lace Ribbon Long Tassel Handmade Satin Flower Bow Lolita Headwear For Women Cosplay
Gothic Red Rose Hair Clip With Black Lace Ribbon Long Tassel Handmade Satin Flower Bow Lolita Headwear For Women Cosplay
like
Find Similar
Close-up of red satin rose hair clip with black lace bow and long ribbon tassels - Gothic Rose Clip - Basic Bow
Detail of dark gothic hair clip with black lace tassels and a deep red rose flower - Gothic Rose Clip - Long Ribbon Bow
Gothic Red Rose Hair Clip With Black Lace Ribbon Long Tassel Handmade Satin Flower Bow Lolita Headwear For Women Cosplay
$0.86-0.92
No MOQ
Elegant Flower Hair Claw Clip Marble Texture Hair Clamp Sweet Floral Headpiece For Women Fresh Style Hair Accessories
Elegant Flower Hair Claw Clip Marble Texture Hair Clamp Sweet Floral Headpiece For Women Fresh Style Hair Accessories
like
Find Similar
Macro detail of Frangipani hair claw clip with green and blue marble texture - Blue & Green
Elegant marble grey acetate flower hair claw clip on a minimalist display tray - Brown-Black Series
Elegant purple and blue marble pattern plumeria hair claw clip for women's hairstyles - Purple-Blue Series
Pink and green marble textured flower hair claw clip displayed on a luxury jewelry tray - Pink-Green Series
Elegant Flower Hair Claw Clip Marble Texture Hair Clamp Sweet Floral Headpiece For Women Fresh Style Hair Accessories
-4%
$0.41
No MOQ
Minimalist Matte Acrylic Flower Hair Claw Clip For Women Simple Solid Color Shark Clip Daily Hair Accessory
Minimalist Matte Acrylic Flower Hair Claw Clip For Women Simple Solid Color Shark Clip Daily Hair Accessory
like
Find Similar
Minimalist matte cream yellow flower hair claw clip for elegant women styling - 4cm / Beige
Matte olive green flower hair claw clip with elegant minimalist 5-petal summer design - 4cm / Brown
Matte black flower hair claw clip in medium size held by hand for scale display - 4cm / Black
Minimalist Matte Acrylic Flower Hair Claw Clip For Women Simple Solid Color Shark Clip Daily Hair Accessory
$0.35
No MOQ
Elegant Butterfly Flower Alloy Hair Clip With Rhinestone And Artificial Pearl Gold Silver Electroplated Side Clip Women Headwear
Elegant Butterfly Flower Alloy Hair Clip With Rhinestone And Artificial Pearl Gold Silver Electroplated Side Clip Women Headwear
like
Find Similar
Elegant gold butterfly hair clip with white pearls on a minimalist white background - Gold, Artificial Pearl Style
Elegant silver flower hair clip with central large pearl and small pearl outlines - Silver, Artificial Pearl Style
Elegant gold butterfly hair clip with sparkling rhinestones and a central crystal accent - Gold Tone Rhinestone Style
Sparkling silver flower hair clip with rhinestones and central pearl on white background - Silver Rhinestone Style
NewElegant Butterfly Flower Alloy Hair Clip With Rhinestone And Artificial Pearl Gold Silver Electroplated Side Clip Women Headwear
$0.81
Mix MOQ : 2
Elegant Metal Flower Hair Claw Sweet Floral Shark Clip Large Small Gold Silver Electroplated Hair Accessory For Women
Elegant Metal Flower Hair Claw Sweet Floral Shark Clip Large Small Gold Silver Electroplated Hair Accessory For Women
like
Find Similar
4 options
Elegant Metal Flower Hair Claw Sweet Floral Shark Clip Large Small Gold Silver Electroplated Hair Accessory For Women
$1.15-1.44
No MOQ
Luxury Alloy Rhinestone Leaf Flower Hair Clips For Women Vintage Fashion Bobby Pins Side Fringe Clips Wedding Party Hair Accessories
Luxury Alloy Rhinestone Leaf Flower Hair Clips For Women Vintage Fashion Bobby Pins Side Fringe Clips Wedding Party Hair Accessories
like
Find Similar
Detail showing dimensions of rhinestone leaf hair clips set with silver alloy base - Silver Leaf Style (ZUHE-216) / Silver
Set of 8 gold alloy hair clips with crystal rhinestones in floral and leaf designs - Gold Floral Vine (ZUHE-017) / Gold
Detailed view of three luxury rhinestone hair clips in gold, silver, and rose gold floral leaf designs - Mixed Color Leaf Butterfly Style (ZUHE-030) / Multicolor
Detailed view of six rhinestone hair clips with bow and leaf motifs in gold and silver - Combination Butterfly Leaf Style (ZUHE-030-2) / Multicolor
Luxury Alloy Rhinestone Leaf Flower Hair Clips For Women Vintage Fashion Bobby Pins Side Fringe Clips Wedding Party Hair Accessories
-5%
$6.35-16.26
No MOQ
Free Shipping
Summer Fresh Sweet Handmade Fabric Rose Flower Hair Clip For Women Floral Duckbill Clip Side Fringe Clip Photo Shoot Travel Jewelry Accessories
Summer Fresh Sweet Handmade Fabric Rose Flower Hair Clip For Women Floral Duckbill Clip Side Fringe Clip Photo Shoot Travel Jewelry Accessories
like
Find Similar
Close-up of artificial fabric rose hair clip in vintage dusty green and pink gradients - Green Rose
Close-up of a pink fabric rose hair clip with detailed petals and green leaves - Light Pink Rose
Macro detail of dusky pink fabric rose hair clip with green leaves on ceramic tray - Dark Pink Rose
Detail of a creamy white silk rose hair clip with green leaves on a ceramic tray - Khaki with Rose Embroidery
Summer Fresh Sweet Handmade Fabric Rose Flower Hair Clip For Women Floral Duckbill Clip Side Fringe Clip Photo Shoot Travel Jewelry Accessories
$0.92
No MOQ
Daisy Flower Hair Clip Cellulose Acetate Sweet Floral Hairpin Korean Style Headwear For Women Daily Dating Accessories
Daisy Flower Hair Clip Cellulose Acetate Sweet Floral Hairpin Korean Style Headwear For Women Daily Dating Accessories
like
Find Similar
Detail view of red and yellow daisy hair clip on an open book for aesthetic display - Red
Daisy flower hair clip in pink and amber colors for a sweet Korean style look - Pink
Sweet light blue daisy hair clip with golden center on amber base for women - Blue
Detailed shot of yellow daisy flower hair clip on tortoise shell resin clip with magazine - Yellow
NewDaisy Flower Hair Clip Cellulose Acetate Sweet Floral Hairpin Korean Style Headwear For Women Daily Dating Accessories
$1.24
No MOQ
Free Shipping
French Retro Flower Hair Claw Clip Acetate Elegant Faux Artificial Pearl Shark Clip Ponytail Hairpin For Women
French Retro Flower Hair Claw Clip Acetate Elegant Faux Artificial Pearl Shark Clip Ponytail Hairpin For Women
like
Find Similar
Elegant tortoiseshell acetate hair claw clip with a central pearl in French vintage style - 3# Light Leopard
French Retro Flower Hair Claw Clip Acetate Elegant Faux Artificial Pearl Shark Clip Ponytail Hairpin For Women
$1.35
No MOQ
Free Shipping
Exaggerated Oversized Satin Flower Brooch Hair Clip For Women Vintage Rose Camellia Corsage Accessory For Wedding Party
Exaggerated Oversized Satin Flower Brooch Hair Clip For Women Vintage Rose Camellia Corsage Accessory For Wedding Party
like
Find Similar
Elegant burgundy oversized satin flower brooch pinned to a dark suit lapel - Burgundy
Exaggerated Oversized Satin Flower Brooch Hair Clip For Women Vintage Rose Camellia Corsage Accessory For Wedding Party
$2.33
No MOQ
Sweet Candy Color Matte Flower Hair Clips Korean Style Simple Floral Side Hairpins For Women Girls Daily Hair Decoration
Sweet Candy Color Matte Flower Hair Clips Korean Style Simple Floral Side Hairpins For Women Girls Daily Hair Decoration
like
Find Similar
Detail of two matte flower hair clips in pink and rose on a white display card - Pink Series Flower
Close-up of candy-colored floral hair clips in yellow and orange on a white card - Yellow Flower Set
Close-up of matte floral hair pins in green and blue on display card for hair styling - Green Flower Set
Detail of two floral matte hair clips in purple and pink on a stylish display card - Purple Flower Set
Sweet Candy Color Matte Flower Hair Clips Korean Style Simple Floral Side Hairpins For Women Girls Daily Hair Decoration
-4%
$0.41
Mix MOQ : 2
Vintage Chinese Style Red Flower Banana Clip Elegant Satin Rose Twist Hair Clip For Women New Year Celebration Headwear
Vintage Chinese Style Red Flower Banana Clip Elegant Satin Rose Twist Hair Clip For Women New Year Celebration Headwear
like
Find Similar
Elegant red velvet rose hair claw clip for women, Chinese style floral hair accessory - Floral Style A
Detail of red velvet camellia flower on a black hair clip with textured background - Floral Style B
Detailed macro of a handmade red satin rose and black lace on an elegant hair clip - Flower Style C
Detail view of handmade wine red satin rose hair clip with black lace and plastic base - Floral Style D
Vintage Chinese Style Red Flower Banana Clip Elegant Satin Rose Twist Hair Clip For Women New Year Celebration Headwear
$1.07-1.12
No MOQ
PU Leather Rose Flower Hair Clip Hair Tie Silver Black Metallic Floral Hair Accessory For Women Fashion Commuter Hairwear
PU Leather Rose Flower Hair Clip Hair Tie Silver Black Metallic Floral Hair Accessory For Women Fashion Commuter Hairwear
like
Find Similar
Detail of silver metallic foil rose hair clip with black velvet ribbon on linen texture - Silver Rose Black Duckbill Clip
Detail of a black leather rose hair clip with a silver X metal accent on a beige linen base - Black Rose Black Duckbill Clip
Minimalist black faux leather rose hair tie with elastic band on beige fabric background - Black Rose Hair Rope
Elegant black elastic hair tie with a vintage silver metallic 3D rose flower ornament - Silver Rose Hair Rope
PU Leather Rose Flower Hair Clip Hair Tie Silver Black Metallic Floral Hair Accessory For Women Fashion Commuter Hairwear
-4%
$0.52-0.64
No MOQ
Vintage Denim Rose Flower Hair Claw Clip For Women Blue Camellia Hairpin With Artificial Pearl Denim Hair Accessories
Vintage Denim Rose Flower Hair Claw Clip For Women Blue Camellia Hairpin With Artificial Pearl Denim Hair Accessories
like
Find Similar
Denim rose hair claw clip with blue fabric flowers and pearl accents for women - Denim Flower Claw Clip
Detailed macro view of the denim rose hair claw with a white pearl and frayed edge finish - Small Denim Pearl Hair Clip
Detail of blue denim rose hair claw with frayed petals and a white pearl accent - Large Denim Pearl Hair Clip
Detailed close-up of blue denim camellia hair clip with vintage frayed edges and petals - Large Flower Denim Hair Clip
Vintage Denim Rose Flower Hair Claw Clip For Women Blue Camellia Hairpin With Artificial Pearl Denim Hair Accessories
-5%
$0.58-1.53
No MOQ
Black Velvet Flocked Hair Clip Scrunchie Set Korean Vintage Creamy Flower Design Elegant Hair Accessories For Women Daily Wear
Black Velvet Flocked Hair Clip Scrunchie Set Korean Vintage Creamy Flower Design Elegant Hair Accessories For Women Daily Wear
like
Find Similar
Close-up of black satin scrunchie with a cream flower pendant on a clean white surface - Hair Tie / Black
Detail of a black velvet rectangular hair clip with a classic white and black resin flower - Square Snap Clip / Black
Close-up of black velvet hair claw clip with white cream flower detail for women - Cross Claw Clip / Black
Detail of a black flocked hair claw clip featuring a minimalist cream flower design - Square Claw / Black
Black Velvet Flocked Hair Clip Scrunchie Set Korean Vintage Creamy Flower Design Elegant Hair Accessories For Women Daily Wear
-5%
$1.10-1.86
No MOQ
Artificial Pearl Alloy Geometric Hair Clips For Women Gold Plated Star Flower Oval Shape Elegant Hairpin Hair Accessories
Artificial Pearl Alloy Geometric Hair Clips For Women Gold Plated Star Flower Oval Shape Elegant Hairpin Hair Accessories
like
Find Similar
Close-up of elegant star-shaped gold hair clips with white pearls on a minimalist background - Pentagram
Elegant gold alloy oval hair clips with white pearls set against white feathers - Oval
Elegant gold flower hair clips with white pearls set for women with minimalist floral design - Flower
Detailed view of elegant gold hair clips with white pearls and spring clip design - Diamond
Artificial Pearl Alloy Geometric Hair Clips For Women Gold Plated Star Flower Oval Shape Elegant Hairpin Hair Accessories
-4%
$0.79
No MOQ
Go to

More in accessories

Explore more in flower clips

clawartificialsharkkidsshapeenamelmetalsmallgoldclip hair
stylealloyshark cliphearthandmadedesigntasselresin hairponytailgirls hair accessories

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access