Everful

Wholesale dragon decor

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Dragon Decor

Find the perfect pieces: home decor accents & accessories, artificial decorations, artificial flowers and more

CarPets, Floor Mats & Protectants

All products in dragon decor

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Wooden Christmas Hanging Ornaments Hollow Laser Cut Santa Snowman Reindeer Painted Decorative Pendant For Home Festival Christmas Tree Decor
Wooden Christmas Hanging Ornaments Hollow Laser Cut Santa Snowman Reindeer Painted Decorative Pendant For Home Festival Christmas Tree Decor
like
Find Similar
Hollow wooden snowman Christmas ornament with red beads and natural hemp rope - Hollow Wooden Snowman Hanging Ornament
Wooden Christmas reindeer ornament with hollow-out design and festive red accents - Hollow Wooden Reindeer Hanging Ornament
Wooden Santa Claus ornament with cutout design featuring red candles and green pine sprigs - Hollow Wooden Santa Hanging Ornament
NewWooden Christmas Hanging Ornaments Hollow Laser Cut Santa Snowman Reindeer Painted Decorative Pendant For Home Festival Christmas Tree Decor
$0.66
Mix MOQ : 2
Natural Crystal Gemstone Bone Shaped Carved Stone Miniature Desktop Ornament Polished Healing Quartz Agate DIY Decor
Natural Crystal Gemstone Bone Shaped Carved Stone Miniature Desktop Ornament Polished Healing Quartz Agate DIY Decor
like
Find Similar
Dalmatian jasper bone-shaped crystal stone carving on a rustic wooden base - Dalmatian Jasper
Aventurine green crystal bone carving displayed on a round wooden base and green turf - Green Aventurine
Pink and purple natural crystal bone carving with black veins on wooden tray - Rhodonite
Blue and white spotted bone-shaped agate stone figurine on a wooden stand - Sodalite
+21
Natural Crystal Gemstone Bone Shaped Carved Stone Miniature Desktop Ornament Polished Healing Quartz Agate DIY Decor
$1.14-1.30
Mix MOQ : 2
 · 
265 sold recently
Top 10% Best Sellers
in Home Decor
Free Shipping
Christmas Wooden Hanging Ornament Red Truck Reindeer Mittens Happy Holidays Sign Xmas Tree Pendant Home Festive Party Decor
Christmas Wooden Hanging Ornament Red Truck Reindeer Mittens Happy Holidays Sign Xmas Tree Pendant Home Festive Party Decor
like
Find Similar
Detailed view of wooden Christmas reindeer ornament with dimensions and weight info - White Faux Fur Reindeer With Branch
Christmas red truck wood hanging ornament with green trees and Happy Holidays sign - Red Car With Christmas Tree
Detailed specs of red and white Christmas glove wooden ornament with size dimensions - White Glove With Faux Fur
Christmas Wooden Hanging Ornament Red Truck Reindeer Mittens Happy Holidays Sign Xmas Tree Pendant Home Festive Party Decor
-4%
$0.99
Mix MOQ : 2
Watercolor Cartoon Dinosaur Castle Wall Stickers Removable PVC Self-Adhesive Decals For Kids Nursery Room Bedroom Decor
Watercolor Cartoon Dinosaur Castle Wall Stickers Removable PVC Self-Adhesive Decals For Kids Nursery Room Bedroom Decor
like
Find Similar
Cartoon colorful dinosaur and castle wall stickers set with watercolor art style design - Cartoon Dinosaur Castle Style (KSA-10) / 30x90cmx2 Sheets
Watercolor Cartoon Dinosaur Castle Wall Stickers Removable PVC Self-Adhesive Decals For Kids Nursery Room Bedroom Decor
$1.87
Mix MOQ : 2
Christmas Plush Skiing Doll Ornaments Pink Gold Sequins Santa Claus Snowman Reindeer Figurine For Home Holiday Decoration
Christmas Plush Skiing Doll Ornaments Pink Gold Sequins Santa Claus Snowman Reindeer Figurine For Home Holiday Decoration
like
Find Similar
Detailed view of Santa plush with sequined gold hat and pink suit on miniature skis - Santa Claus / Pink Gold
Pink sequin knit snowman doll skiing ornament for home Christmas decoration and gift - Snowman / Pink Gold
Close-up of pink sequined Christmas reindeer plush doll with golden hat and skis - Elk / Pink Gold
Christmas Plush Skiing Doll Ornaments Pink Gold Sequins Santa Claus Snowman Reindeer Figurine For Home Holiday Decoration
$5.04
Mix MOQ : 3
Halloween Spiral Hanging Decorations Cartoon Ghost Pumpkin Bat Witch Paper PVC Swirl Ornaments For Party Mall Home Ceiling Decor
Halloween Spiral Hanging Decorations Cartoon Ghost Pumpkin Bat Witch Paper PVC Swirl Ornaments For Party Mall Home Ceiling Decor
like
Find Similar
Halloween spiral swirl hanging decorations featuring paper cartoon ghost and owl set - Mixed Style Set (Halloween Spiral Pendant)
Halloween spiral hanging set with cartoon witch bat cat and ghost party decorations - Spiral Mixed (Halloween Spiral Pendant)
Halloween Spiral Hanging Decorations Cartoon Ghost Pumpkin Bat Witch Paper PVC Swirl Ornaments For Party Mall Home Ceiling Decor
-4%
$0.88
Mix MOQ : 2
Elegant Glitter Christmas Reindeer Ornament Plastic Elk Statue Desktop Figurine For Holiday Home Party Decoration White Gold Silver
Elegant Glitter Christmas Reindeer Ornament Plastic Elk Statue Desktop Figurine For Holiday Home Party Decoration White Gold Silver
like
Find Similar
Brown glitter Christmas reindeer figurines pair with gold antlers holiday decor - Coffee
Pair of golden glitter reindeer figurines for Christmas tree and tabletop decoration - Gold
Pair of white glitter reindeer ornaments with detailed dimensions for Christmas decor - White
Pair of silver glitter elk ornaments for Christmas tree decor, size 4.72 inches high - Silver
Elegant Glitter Christmas Reindeer Ornament Plastic Elk Statue Desktop Figurine For Holiday Home Party Decoration White Gold Silver
$3.46
No MOQ
Halloween Witch Agate Crystal Wind Chime Dream Catcher Hanging Ornament Tree Of Life Magic Wand Home Decor Gift For Women
Halloween Witch Agate Crystal Wind Chime Dream Catcher Hanging Ornament Tree Of Life Magic Wand Home Decor Gift For Women
like
Find Similar
1 option
Halloween Witch Agate Crystal Wind Chime Dream Catcher Hanging Ornament Tree Of Life Magic Wand Home Decor Gift For Women
$14.06
No MOQ
 · 
16 views
LED Light Up Christmas Snowman Doll Decoration With Red Black Plaid Hat Scarf Pine Needles Holiday Home Desktop Ornament
LED Light Up Christmas Snowman Doll Decoration With Red Black Plaid Hat Scarf Pine Needles Holiday Home Desktop Ornament
like
Find Similar
Luminous snowman decoration with red black plaid knit hat and branch arms in white background - Pointed Hat
LED Light Up Christmas Snowman Doll Decoration With Red Black Plaid Hat Scarf Pine Needles Holiday Home Desktop Ornament
$4.03
No MOQ
Halloween Miniature Figurines Resin Glow In The Dark Pumpkin Ghost Mummy Witch Hat Micro Landscape Decor Desk Ornaments
Halloween Miniature Figurines Resin Glow In The Dark Pumpkin Ghost Mummy Witch Hat Micro Landscape Decor Desk Ornaments
like
Find Similar
Miniature orange pumpkin figurine for Halloween decor, size 2.1cm by 2.2cm height - Pumpkin
Pink cartoon rabbit resin figurine for Halloween miniatures, height 2.1cm and width 2.2cm - Pink Bat
Blue rabbit-eared miniature figurine with pumpkin lamp for Halloween decor, 2.1cm tall - Blue Bat
Glow-in-the-dark blue animal miniature for Halloween, 2.1cm height, creative decor - Cute Blue Bat
+15
Halloween Miniature Figurines Resin Glow In The Dark Pumpkin Ghost Mummy Witch Hat Micro Landscape Decor Desk Ornaments
$0.06-0.23
Mix MOQ : 3
 · 
1K+ sold recently
Halloween 3D Paper Honeycomb Hanging Decoration Spider Pumpkin Bat Black Cat Witch Pendant For Haunted House Party Props
Halloween 3D Paper Honeycomb Hanging Decoration Spider Pumpkin Bat Black Cat Witch Pendant For Haunted House Party Props
like
Find Similar
3D Halloween black cat honeycomb ball with purple wizard hat for party decoration - Big Cat Single-sided Honeycomb
3D Halloween honeycomb paper spider hanging decoration in classic orange and black - Spider Double-sided Honeycomb
Halloween black bat pendant with purple accents and 3D paper honeycomb sphere ball - Bat Single-sided Honeycomb
Halloween pumpkin honeycomb decoration with black wizard hat for party scenes - Pumpkin Hat Honeycomb Pendant
+2
Halloween 3D Paper Honeycomb Hanging Decoration Spider Pumpkin Bat Black Cat Witch Pendant For Haunted House Party Props
-4%
$0.77-0.88
Mix MOQ : 2
3D Christmas Stocking Red Flannel Plaid Cuff Santa Snowman Reindeer Gift Bag Hanging Ornament For Christmas Party Fireplace
3D Christmas Stocking Red Flannel Plaid Cuff Santa Snowman Reindeer Gift Bag Hanging Ornament For Christmas Party Fireplace
like
Find Similar
Red velvet Christmas stocking with 3D Santa, plaid trim, and bells for holiday decor - Santa Claus
Red velvet Christmas stocking with 3D snowman and plaid cuff hanging on a fireplace - Snowman
Plaid Christmas stocking with 3D reindeer decor and snowflake embroidery detail - Reindeer
3D Christmas Stocking Red Flannel Plaid Cuff Santa Snowman Reindeer Gift Bag Hanging Ornament For Christmas Party Fireplace
-5%
$2.05
No MOQ
Realistic Simulation Black Crow Halloween Decoration Prop Feathered Raven Bird For Haunted House Party Yard Outdoor Decor
Realistic Simulation Black Crow Halloween Decoration Prop Feathered Raven Bird For Haunted House Party Yard Outdoor Decor
like
Find Similar
Realistic black feathered crow decoration for Halloween spooky themed home decor - Straight Head Style / Black
Realistic black feathered crow prop for Halloween decoration on a clean white background - Crooked Head Style / Black
Realistic black feathered crow prop for Halloween decor with lifelike texture and beak - Spreading Wings Style / Black
Realistic Simulation Black Crow Halloween Decoration Prop Feathered Raven Bird For Haunted House Party Yard Outdoor Decor
$1.96
Mix MOQ : 2
 · 
12 sold recently
Glitter Butterfly Christmas Tree Picks Hollow Sparkle Butterfly Stakes For Xmas Tree Decorations Floral Arrangement DIY Crafts Holiday Party Ornaments
Glitter Butterfly Christmas Tree Picks Hollow Sparkle Butterfly Stakes For Xmas Tree Decorations Floral Arrangement DIY Crafts Holiday Party Ornaments
like
Find Similar
Silver glitter butterfly pick ornament for Christmas tree decoration with dimensions - Hollow Butterfly (ACC40-1) / Silver
Red glitter butterfly ornament with dimensions showing 18cm width and long support stem - Hollow Butterfly (ACC40-2) / Red
Champagne gold glitter butterfly ornament with cutout design for Christmas decor - Hollow Butterfly (ACC40-3) / Champagne
Sparkling gold butterfly stem decoration with glitter for Christmas tree floral decor - Hollow Butterfly (ACC40-4) / Gold
Glitter Butterfly Christmas Tree Picks Hollow Sparkle Butterfly Stakes For Xmas Tree Decorations Floral Arrangement DIY Crafts Holiday Party Ornaments
$1.01
No MOQ
Christmas Reindeer Bell Pendant Ornaments Plastic Glitter Reindeer Hanging Decoration With Bowknot Bells For Xmas Tree Home Party Holiday Decor
Christmas Reindeer Bell Pendant Ornaments Plastic Glitter Reindeer Hanging Decoration With Bowknot Bells For Xmas Tree Home Party Holiday Decor
like
Find Similar
Christmas gold jumping reindeer ornament with red bows, bells, and Merry Christmas sign - Gold
Sparkling red Christmas reindeer bell ornament with golden Merry Christmas text detail - Red
Silver Christmas reindeer hanging ornament with blue bows and Merry Christmas text - Silver
Christmas Reindeer Bell Pendant Ornaments Plastic Glitter Reindeer Hanging Decoration With Bowknot Bells For Xmas Tree Home Party Holiday Decor
-5%
$0.74
Mix MOQ : 2
Christmas Telescopic Leg Plush Doll Ornament Santa Snowman Reindeer Festive Home Decor Plaid Pattern Holiday Figurine
Christmas Telescopic Leg Plush Doll Ornament Santa Snowman Reindeer Festive Home Decor Plaid Pattern Holiday Figurine
like
Find Similar
Christmas gnome doll in brown plaid hat with long legs and snowflake design decoration - Santa Claus
Extendable Christmas snowman doll with brown plaid hat and scarf for holiday decoration - Snowman
Standing Christmas reindeer plush toy with beige knit hat and plaid scarf holiday decor - Elk
Christmas Telescopic Leg Plush Doll Ornament Santa Snowman Reindeer Festive Home Decor Plaid Pattern Holiday Figurine
$6.63
No MOQ
Christmas Stocking Snowflake Pattern With 3D Santa Snowman Reindeer Polar Bear Pompom Christmas Tree Hanging Decor Bag
Christmas Stocking Snowflake Pattern With 3D Santa Snowman Reindeer Polar Bear Pompom Christmas Tree Hanging Decor Bag
like
Find Similar
Red Christmas stocking with green cuff and Santa Claus 3D face design for gift bag - Santa Claus
Christmas stocking gift bag with white snowflakes and plush snowman for tree hanging decor - Snowman
Olive green Christmas stocking with red faux fur cuff and 3D reindeer embroidery detail - Elk Style
Green Christmas stocking with 3D plush polar bear and snowflake prints on white background - Bear Style
Christmas Stocking Snowflake Pattern With 3D Santa Snowman Reindeer Polar Bear Pompom Christmas Tree Hanging Decor Bag
-4%
$0.60
Mix MOQ : 2
Christmas Knitted Plush Ornaments Santa Claus Snowman Reindeer Hanging Pendants For Christmas Tree Holiday Home Decor Gift
Christmas Knitted Plush Ornaments Santa Claus Snowman Reindeer Hanging Pendants For Christmas Tree Holiday Home Decor Gift
like
Find Similar
Knitted Christmas gnome plush pendant with plaid hat and white beard hanging ornament - European Style Hanging Santa Gnome
Knitted snowman Christmas ornament with brown hat and embroidered snowflake detail - European Style Hanging Snowman
Knitted reindeer Christmas tree hanging ornament with snowflake embroidery - European Style Hanging Reindeer
Christmas Knitted Plush Ornaments Santa Claus Snowman Reindeer Hanging Pendants For Christmas Tree Holiday Home Decor Gift
$2.59
No MOQ
Miniature Resin Farm Animal Figurines Sheep Chicken Fence Tree Stump For Fairy Garden Micro Landscape DIY Terrarium Decor
Miniature Resin Farm Animal Figurines Sheep Chicken Fence Tree Stump For Fairy Garden Micro Landscape DIY Terrarium Decor
like
Find Similar
Miniature white sheep figurine with black head for DIY moss landscape decor - Miniature White Sheep (No.1)
Miniature white fence with green grass base for micro landscape and garden decor - Two-post White Fence (No.5)
Miniature white chicken resin figurine with red comb for moss micro landscape decor - White Chicken Profile (No.6)
Miniature white resin rooster figurine on green lawn for micro landscape decoration - White Chicken Front (No.7)
+4
Miniature Resin Farm Animal Figurines Sheep Chicken Fence Tree Stump For Fairy Garden Micro Landscape DIY Terrarium Decor
$0.10-1.59
No MOQ
 · 
461 sold recently
Top 10% Best Sellers
in Home Decor
Glitter Christmas Tree Butterfly Ornaments Mesh Artificial Butterfly Decoration With Metal Clip For Festive Holiday Party
Glitter Christmas Tree Butterfly Ornaments Mesh Artificial Butterfly Decoration With Metal Clip For Festive Holiday Party
like
Find Similar
6-piece glitter Christmas butterfly ornaments set in assorted colors with pearls and box - Colorful Butterfly Style A
Set of six colorful glitter butterfly ornaments with metal clips in a white gift box - Colorful Butterfly Style B
Pink glitter Christmas butterfly ornaments set of 3 in box, 20x13.3x2cm holiday decoration - Butterfly Style / Pink
Three red glitter mesh butterfly clips for Christmas tree decor in a packaging box - Butterfly Style / Red
+16
Glitter Christmas Tree Butterfly Ornaments Mesh Artificial Butterfly Decoration With Metal Clip For Festive Holiday Party
-5%
$3.23-6.79
No MOQ
Christmas Wooden Dog Car Tree Hanging Ornaments Cartoon Animal Wood Pendant For Home Party Wall Decor Xmas Gift
Christmas Wooden Dog Car Tree Hanging Ornaments Cartoon Animal Wood Pendant For Home Party Wall Decor Xmas Gift
like
Find Similar
Wooden Christmas dog ornament with a red holiday hat and scarf on a snowy tree branch - Black Face Dog (P-Z34)
Rustic wooden long-eared puppy Christmas hanging ornament with red hat and scarf - Green Bowtie Dog (P-Z35)
Christmas tree wooden car ornament with green tree and snowflake laser-cut details - Green Christmas Tree and Car (P-Z30)
Rustic green wooden vintage car Christmas ornament with snowflake detail and jute string - Green Sedan (P-Z31)
+3
Christmas Wooden Dog Car Tree Hanging Ornaments Cartoon Animal Wood Pendant For Home Party Wall Decor Xmas Gift
-4%
$0.41
No MOQ
Glitter Christmas Tree Topper Star Pentagram Ornament For Holiday Party Home Decoration Plastic Gold Red Star Tree Topper
Glitter Christmas Tree Topper Star Pentagram Ornament For Holiday Party Home Decoration Plastic Gold Red Star Tree Topper
like
Find Similar
Sparkling gold Christmas tree topper star with glitter finish and mounting base - Gold Five-pointed Star
Sparkly red glitter five-pointed star topper for Christmas tree with secure base stand - Red Pentagram
Glitter Christmas Tree Topper Star Pentagram Ornament For Holiday Party Home Decoration Plastic Gold Red Star Tree Topper
$0.42
Mix MOQ : 2
Halloween Pumpkin Head Mirror Wall Sticker 3D Acrylic Jack-O-Lantern Door Frame Switch Decorative Border Holiday Home Decor
Halloween Pumpkin Head Mirror Wall Sticker 3D Acrylic Jack-O-Lantern Door Frame Switch Decorative Border Holiday Home Decor
like
Find Similar
3D mirror acrylic pumpkin head door frame corner sticker for Halloween wall decor - Silver
Black acrylic pumpkin mirror wall sticker for Halloween door frame corner decoration - Black
Golden mirror acrylic pumpkin wall sticker for Halloween switch decoration and frame - Gold
Halloween Pumpkin Head Mirror Wall Sticker 3D Acrylic Jack-O-Lantern Door Frame Switch Decorative Border Holiday Home Decor
$1.10
No MOQ
Free Shipping
Mini Santa Claus Hanging Dolls Christmas Tree Ornaments American Style Handmade Festival Decoration For Holiday Home Party
Mini Santa Claus Hanging Dolls Christmas Tree Ornaments American Style Handmade Festival Decoration For Holiday Home Party
like
Find Similar
Close-up of glittery Santa ornaments in six colors with gold hanging strings for Christmas - 6-color Mixed 5cm (yo9)
Two miniature Santa Claus hanging ornaments packaged in a transparent bag with gold cords - Red 10cm (yo9)
Set of 6 mini flocked Santa Claus ornaments with gold strings for Christmas tree decoration - Red 5cm (yo9)
Mini Santa Claus Hanging Dolls Christmas Tree Ornaments American Style Handmade Festival Decoration For Holiday Home Party
$0.46-0.52
No MOQ
 · 
68 sold recently
Halloween Highland Cow Statue With Witch Hat Pumpkin Skull Resin Craft Desktop Ornament Festive Home Decor Gift
Halloween Highland Cow Statue With Witch Hat Pumpkin Skull Resin Craft Desktop Ornament Festive Home Decor Gift
like
Find Similar
Halloween highland cow figurine with wizard hat and pumpkin for home table decoration - Pumpkin Pattern
Halloween highland cow figurine with wizard hat and skull for home desktop decoration - Skull Pattern
Halloween Highland Cow Statue With Witch Hat Pumpkin Skull Resin Craft Desktop Ornament Festive Home Decor Gift
$6.92
Mix MOQ : 3
Halloween Burlap Elf Pumpkin Witch Ghost Black Cat Hanging Doll Ornaments For Festive Home Party Scene Decoration
Halloween Burlap Elf Pumpkin Witch Ghost Black Cat Hanging Doll Ornaments For Festive Home Party Scene Decoration
like
Find Similar
Halloween wizard skeleton doll hanging decoration with burlap dress and black hat - White Ghost Doll Hanging
Halloween black cat wizard plush pendant with green burlap dress and small bells - Black Cat Doll Hanging
Hanging Halloween burlap pumpkin wizard doll decoration with bell legs on a rustic twine - Pumpkin Doll Hanging
Halloween Burlap Elf Pumpkin Witch Ghost Black Cat Hanging Doll Ornaments For Festive Home Party Scene Decoration
-5%
$1.86
No MOQ
Cute Dog Figurine Resin Miniature Micro Landscape Ornaments Cartoon Puppy Statues With Colorful Scarves Desk Car Home Decor
Cute Dog Figurine Resin Miniature Micro Landscape Ornaments Cartoon Puppy Statues With Colorful Scarves Desk Car Home Decor
like
Find Similar
Miniature white puppy resin figurine with blue bow tie and 2.4cm size specification - Maltese
Miniature white puppy figurine with pink bib for DIY micro landscape 2.4cm height - Westie
Miniature resin brown poodle figurine with red scarf, height 2.3cm and weight 4.5g - Brown Teddy
Miniature white puppy figurine with pink bib, 2.3cm tall cute resin micro landscape decor - White Teddy
+8
Cute Dog Figurine Resin Miniature Micro Landscape Ornaments Cartoon Puppy Statues With Colorful Scarves Desk Car Home Decor
$0.10-0.15
Mix MOQ : 3
 · 
278 sold recently
Christmas Angel Hanging Decoration Plush Fabric Angel Dolls For Christmas Tree Ornaments Home Holiday Party Decor Gifts
Christmas Angel Hanging Decoration Plush Fabric Angel Dolls For Christmas Tree Ornaments Home Holiday Party Decor Gifts
like
Find Similar
Handmade white plush Christmas angel ornament with golden sequin tree and wooden beads - White
Handmade pink angel Christmas tree ornament with knitted dress and white feather wings - Pink
Handmade Christmas angel ornament in grey plush dress holding a white star hanging decor - Gray
Christmas Angel Hanging Decoration Plush Fabric Angel Dolls For Christmas Tree Ornaments Home Holiday Party Decor Gifts
-4%
$1.56
No MOQ
Halloween Tinsel Garland With Pumpkin Bat Skeleton Charms Metallic Foil Hanging Ribbon For Spooky Party Fireplace Wall Decor
Halloween Tinsel Garland With Pumpkin Bat Skeleton Charms Metallic Foil Hanging Ribbon For Spooky Party Fireplace Wall Decor
like
Find Similar
2m Halloween tinsel garland with orange and black sequins and pumpkin ornaments - 2M Orange Black Pumpkin Tinsel
2M Halloween black tinsel garland with silver glitter and pumpkin spider silhouettes - 2M Silver Black Skeleton Tinsel
2m Halloween purple and black tinsel garland with bat cutouts for party decor - 2M Purple Black Bat Tinsel
Halloween tinsel garland in black and purple with bat sequins, 2M length for party decor - 2M Rose Red Black Bat Tinsel
Halloween Tinsel Garland With Pumpkin Bat Skeleton Charms Metallic Foil Hanging Ribbon For Spooky Party Fireplace Wall Decor
-3%
$0.50
Mix MOQ : 2
Small Cat Paw Print Christmas Stockings Buffalo Plaid Hanging Socks With Faux Fur Trim For Xmas Tree Ornament Party Favor Bag
Small Cat Paw Print Christmas Stockings Buffalo Plaid Hanging Socks With Faux Fur Trim For Xmas Tree Ornament Party Favor Bag
like
Find Similar
Red and black plaid Christmas stocking with white paw print hanging on a snowy pine tree - Small / Red and Black Grid
Close-up of black buffalo plaid pet paw Christmas stocking hanging on a snowy tree branch - Small / Black White Grid
Detail of green plaid pet paw Christmas stocking hanging on a festive decorated tree - Small / Green & Black Plaid
Small Cat Paw Print Christmas Stockings Buffalo Plaid Hanging Socks With Faux Fur Trim For Xmas Tree Ornament Party Favor Bag
$0.95
Mix MOQ : 2
Free Shipping
Glitter Butterfly Christmas Tree Decoration With Clip Sequin Fabric Butterfly For Holiday Party Wedding Home Decor Xmas Ornament
Glitter Butterfly Christmas Tree Decoration With Clip Sequin Fabric Butterfly For Holiday Party Wedding Home Decor Xmas Ornament
like
Find Similar
Sparkly red 27cm Christmas butterfly ornament with gold glitter and clip attachment - Red
Champagne gold Christmas butterfly clip with sequins and pearls for tree decor - Artificial Butterfly With Clip / Gold
Pink velvet Christmas butterfly decoration with gold sequins and pearls on metal clip - Artificial Butterfly With Clip / Pink
Sparkling light blue Christmas butterfly ornament with sequins and clip attachment - Artificial Butterfly With Clip / Blue
+1
Glitter Butterfly Christmas Tree Decoration With Clip Sequin Fabric Butterfly For Holiday Party Wedding Home Decor Xmas Ornament
-5%
$1.89
No MOQ
Plush Angel Girl Christmas Tree Hanging Decoration With Sequins Wings And Knit Hat For Home Holiday Party Decor
Plush Angel Girl Christmas Tree Hanging Decoration With Sequins Wings And Knit Hat For Home Holiday Party Decor
like
Find Similar
White plush Christmas angel ornament with silver glitter wings and string legs - White Jacquard Hat
Pink and white Christmas angel doll ornament with sequined wings and golden shoes - Pink Jacquard Hat
Plush Christmas angel ornament with pink knit hat, gold wings and fluffy skirt - Coffee Jacquard Hat
Christmas plush angel tree pendant featuring silver wings and a grey knitted hat - Grey Jacquard Hat
Plush Angel Girl Christmas Tree Hanging Decoration With Sequins Wings And Knit Hat For Home Holiday Party Decor
$1.79
No MOQ
Mesh Butterfly Christmas Tree Ornaments With Glitter Feather Artificial Pearl Accents Festival Party Hanging Decoration Butterfly Clips
Mesh Butterfly Christmas Tree Ornaments With Glitter Feather Artificial Pearl Accents Festival Party Hanging Decoration Butterfly Clips
like
Find Similar
Five pack of white mesh butterfly Christmas tree ornaments with silver glitter edges - White Feather Decor Style
Set of 6 white mesh Christmas butterfly ornaments with gold glitter finish 8x9cm - White Gold Glitter Texture Style
Silver mesh butterfly ornaments with sequins and pearls in a 3-piece set for Christmas - Silver Sequins Faux Pearl Style
Three cream and gold mesh butterfly clips with pink faux pearls in white gift box - Cream Gold Glitter Faux Pearl Style
+2
Mesh Butterfly Christmas Tree Ornaments With Glitter Feather Artificial Pearl Accents Festival Party Hanging Decoration Butterfly Clips
$3.11-4.27
Mix MOQ : 2
Free Shipping
Festive Christmas Tree Hanging Ornaments Plush Santa Snowman Reindeer Bear Dolls For Home Holiday Party Decoration Gift
Festive Christmas Tree Hanging Ornaments Plush Santa Snowman Reindeer Bear Dolls For Home Holiday Party Decoration Gift
like
Find Similar
Detailed view of plush snowman ornament with red plaid fabric hanging on a snowy branch - Dancing Snowman Pendant
Plush Santa Claus ornament with red burlap texture and plaid hat for Christmas tree decor - Dancing Santa Claus Pendant
Hanging reindeer plush ornament with burlap texture and red plaid scarf for Christmas tree - Dancing Reindeer Pendant
Christmas plush bear ornament with red and green plaid hat and festive burlap body - Dancing Bear Pendant
NewFestive Christmas Tree Hanging Ornaments Plush Santa Snowman Reindeer Bear Dolls For Home Holiday Party Decoration Gift
$0.60
Mix MOQ : 2
 · 
47 sold recently
Christmas Wood Box Doll Hanging Ornaments Knitted Mini Baby Figurine Pendants For Xmas Tree Decor Holiday Party Favors Home Decorations
Christmas Wood Box Doll Hanging Ornaments Knitted Mini Baby Figurine Pendants For Xmas Tree Decor Holiday Party Favors Home Decorations
like
Find Similar
Christmas wooden box doll ornament with red knitted jacket and hanging string detail - Burgundy
Handmade wooden Christmas doll pendant with orange knit details and white hat on twine - Orange
Handcrafted wooden doll ornament in pink corduroy fabric within a small wood frame - Dusty Pink
Handmade wooden doll ornament in pink corduroy swaddle with a white knitted hat - Peach Pink
+1
Christmas Wood Box Doll Hanging Ornaments Knitted Mini Baby Figurine Pendants For Xmas Tree Decor Holiday Party Favors Home Decorations
$0.72
Mix MOQ : 2
Vintage Christmas Wooden Rocking Horse Desktop Decoration Ornament Painted Wood Horse With Snowflake For Home Holiday Party Gift
Vintage Christmas Wooden Rocking Horse Desktop Decoration Ornament Painted Wood Horse With Snowflake For Home Holiday Party Gift
like
Find Similar
Vintage wooden Christmas rocking horse ornament with red runners and snowflake saddle patterns - Rocking Horse Style
Vintage Christmas Wooden Rocking Horse Desktop Decoration Ornament Painted Wood Horse With Snowflake For Home Holiday Party Gift
$8.75
No MOQ
Halloween Tinsel Wreath With Pumpkin Bat Skull Sequins Artificial Door Wall Hanging Garland For Party Home Decor
Halloween Tinsel Wreath With Pumpkin Bat Skull Sequins Artificial Door Wall Hanging Garland For Party Home Decor
like
Find Similar
26cm Halloween tinsel wreath featuring black fringe and decorative orange pumpkins - Orange Pumpkin
Halloween wreath with purple bats and black tinsel, 26cm diameter party decoration - Purple Bat Style
Black Halloween wreath with silver skulls, tinsel texture, 26cm diameter and 141g weight - Silver Skull Style
NewHalloween Tinsel Wreath With Pumpkin Bat Skull Sequins Artificial Door Wall Hanging Garland For Party Home Decor
-5%
$2.60
Mix MOQ : 2
Plastic Christmas Tree Hanging Ornaments Strawberry Pine Cone Violin Shape Pendants For Holiday Party Home Decoration
Plastic Christmas Tree Hanging Ornaments Strawberry Pine Cone Violin Shape Pendants For Holiday Party Home Decoration
like
Find Similar
Detailed set of six golden pinecone-shaped Christmas ornaments with textured scales - Pine Cone Style / Gold
Set of 6 strawberry Christmas ornaments with red glitter finish and white wave details - Strawberry Style / Red White Green
Close-up of six golden pine cone ornaments in a neat 2x3 grid with hanging loops - Pine Cone Style / Gold
Set of 6 golden glitter hummingbird hanging ornaments for Christmas tree decor - Hummingbird Style / Gold
+1
Plastic Christmas Tree Hanging Ornaments Strawberry Pine Cone Violin Shape Pendants For Holiday Party Home Decoration
$11.53
No MOQ
Free Shipping
Halloween Decoration Purple Black Glitter Tree Simulation Skeleton Skull Ornament Haunted House Table Centerpiece For Party Home Decor
Halloween Decoration Purple Black Glitter Tree Simulation Skeleton Skull Ornament Haunted House Table Centerpiece For Party Home Decor
like
Find Similar
Halloween black tinsel tree with purple and orange baubles and a golden skull, 18.11 inches - Black Glitter Skeleton Decor Tree (002) / 46x25cm
45cm Halloween black tabletop tree with purple ornaments and burlap base decoration - Black Purple Branch Decor Tree (003) / 45x30cm
45cm Halloween purple tinsel tree with orange and purple ornaments on black burlap base - Purple Glitter Skeleton Decor Tree (004) / 45x30cm
Halloween Decoration Purple Black Glitter Tree Simulation Skeleton Skull Ornament Haunted House Table Centerpiece For Party Home Decor
$7.15-7.72
No MOQ
Personalized Resin Christmas Tree Family Hanging Ornament Cute Cartoon Family Character Festive Home Xmas Decoration Gift
Personalized Resin Christmas Tree Family Hanging Ornament Cute Cartoon Family Character Festive Home Xmas Decoration Gift
like
Find Similar
Close-up of personalized resin Christmas tree ornament with cute children figures - Family Of Two
Christmas tree ornament featuring three people with red hats and white space for name custom - Family of Three
Custom resin Christmas tree ornament with a cute family of four and red glitter hats - Family Of Four
Family of 5 Christmas tree resin pendant with cute cartoon heads and red hats - Family Of Five
+1
Personalized Resin Christmas Tree Family Hanging Ornament Cute Cartoon Family Character Festive Home Xmas Decoration Gift
$1.73-2.16
Mix MOQ : 2
Christmas Sequin Stockings Gnome Plush Doll Gift Bags Fireplace Xmas Tree Hanging Decorations For Holiday Home Party Decor
Christmas Sequin Stockings Gnome Plush Doll Gift Bags Fireplace Xmas Tree Hanging Decorations For Holiday Home Party Decor
like
Find Similar
Three-piece red sequined Christmas gnome stockings hanging on a festive mantelpiece - Large / Red
Three green sequined gnome Christmas stockings with white fur trim hanging on fireplace - Large / Green
Three sequined Christmas stockings with gnome plush beard hanging on a white fireplace - Large / Gold
Three sequined Christmas stockings with gnomes hanging on a festive decorated fireplace - Large / Silver
+8
Christmas Sequin Stockings Gnome Plush Doll Gift Bags Fireplace Xmas Tree Hanging Decorations For Holiday Home Party Decor
$1.41-2.54
Mix MOQ : 2
Family Campfire Christmas Tree Resin Ornament Cartoon Roasting Marshmallow Hanging Holiday Decoration Home Party Display
Family Campfire Christmas Tree Resin Ornament Cartoon Roasting Marshmallow Hanging Holiday Decoration Home Party Display
like
Find Similar
Creative family camping Christmas tree pendant showing resin figures roasting marshmallows - 2-Person Family Design (A514)
Christmas resin ornament with a family camping scene and roasting marshmallows near tent - 3-Person Family Design (A514)
Personalized family camping resin Christmas tree ornament with bonfire and tent - 4-Person Family Design (A514)
Customized 5-person family Christmas resin ornament with campfire and tent design - 5-Person Family Design (A514)
Family Campfire Christmas Tree Resin Ornament Cartoon Roasting Marshmallow Hanging Holiday Decoration Home Party Display
$2.59
No MOQ
Artificial Pumpkin Ornaments Realistic Foam Faux Models Halloween Thanksgiving Harvest Christmas Table Decor Home Kitchen
Artificial Pumpkin Ornaments Realistic Foam Faux Models Halloween Thanksgiving Harvest Christmas Table Decor Home Kitchen
like
Find Similar
Realistic white decorative pumpkin model, size 6.2x8.5 inches, for Halloween and autumn decor - 6.2x8.5inch / No.1 Large White Pumpkin
Artificial white pumpkin decor 5.2x6.6 inch for Halloween and harvest festival display - 5.2x6.6inch / No.2 Large White Pumpkin
Artificial orange pumpkin model with yellow spots for Halloween and harvest festival decor - No.1 Yellow Pumpkin
Glossy black pumpkin decoration with silver stem for Halloween and autumn harvest decor - No.1 Large Black Pumpkin with Large Stem
+5
Artificial Pumpkin Ornaments Realistic Foam Faux Models Halloween Thanksgiving Harvest Christmas Table Decor Home Kitchen
$3.17-4.90
Mix MOQ : 2
 · 
267 sold recently
Electroplated Mirror Gloss Christmas Tree Ornaments Stars Boots Gift Boxes Drop Charms Plastic Festive Home Party Decorations
Electroplated Mirror Gloss Christmas Tree Ornaments Stars Boots Gift Boxes Drop Charms Plastic Festive Home Party Decorations
like
Find Similar
Set of 6 colorful electroplated teardrop Christmas ornaments in gold silver red blue - Drop Style
Set of 6cm shiny electroplated star Christmas ornaments in various vibrant colors - Star Style
Set of colorful 3cm electroplated Christmas gift box hanging ornaments for tree decor - Gift Box Style
NewElectroplated Mirror Gloss Christmas Tree Ornaments Stars Boots Gift Boxes Drop Charms Plastic Festive Home Party Decorations
$1.33
No MOQ
Transparent Acrylic Christmas Tree Ornaments Gold Sequins Reindeer Star Snowflake Butterfly Ballet Dancer Hanging Pendants
Transparent Acrylic Christmas Tree Ornaments Gold Sequins Reindeer Star Snowflake Butterfly Ballet Dancer Hanging Pendants
like
Find Similar
Acrylic Christmas reindeer ornament with gold sequins on snow-covered pine branch - Sitting Deer Transparent Sequin Style
Champagne gold sequin star ornament with ribbon for Christmas tree hanging decoration - Multi-Point Star Transparent Sequin Style
Sparkling transparent acrylic Christmas snowflake pendant with gold sequins on ribbon - Wreath Transparent Sequin Style
Transparent butterfly Christmas ornament with gold sequins hanging on a pine tree branch - Butterfly Transparent Sequin Style
+4
Transparent Acrylic Christmas Tree Ornaments Gold Sequins Reindeer Star Snowflake Butterfly Ballet Dancer Hanging Pendants
$1.04-1.44
No MOQ
Free Shipping
Handmade Christmas Angel Santa Snowman Elk Plush Doll Pendant Fabric Foam Festive Holiday Home Party Decor Kids Gift
Handmade Christmas Angel Santa Snowman Elk Plush Doll Pendant Fabric Foam Festive Holiday Home Party Decor Kids Gift
like
Find Similar
Christmas gnome ornament with red knit hat and heart embroidery for holiday tree decor - Red Clothes Santa Claus / 20*9*6
Charming red and grey Christmas snowman ornament with tall hat and knit scarf decor - Red Clothes Snowman / 20*9*6
Christmas reindeer plush doll with red knitted sweater and snowflake embroidery - Red Clothes Reindeer / 20*9*6
White plush Christmas angel doll with red scarf and wings for tree decoration - White Clothes Red Scarf Angel / 20*9*6
+2
Handmade Christmas Angel Santa Snowman Elk Plush Doll Pendant Fabric Foam Festive Holiday Home Party Decor Kids Gift
$1.27
Mix MOQ : 2
Christmas Decoration Fabric Feather Butterfly Hanging Pendant Colorful Glitter Artificial Pearl Ornaments For Tree Decor
Christmas Decoration Fabric Feather Butterfly Hanging Pendant Colorful Glitter Artificial Pearl Ornaments For Tree Decor
like
Find Similar
Set of 10 colorful fabric butterfly hair clips in a premium gift display box - Black Gold
Set of 10 decorative feather butterflies with mesh and pearls in a black gift box - Champagne
Set of 10 emerald green feather butterfly ornaments with glitter finish in a black gift box - Malachite green
Pink sequin butterfly ornaments set in a box with dimension and weight labels - Pink
+2
Christmas Decoration Fabric Feather Butterfly Hanging Pendant Colorful Glitter Artificial Pearl Ornaments For Tree Decor
$5.71
Mix MOQ : 2
Creative Mermaid PVC Ornaments Miniature Landscape Succulent Decoration Fish Tank Desk Decor Anime Figurine For Home
Creative Mermaid PVC Ornaments Miniature Landscape Succulent Decoration Fish Tank Desk Decor Anime Figurine For Home
like
Find Similar
Three-piece set of cartoon mermaid PVC figurines in blue, green, and pink finishes - Style A (Mermaid Group)
Three mermaid PVC figurines with colorful tails for moss micro-landscape or fish tank decor - Style B (Mermaid Group)
Creative Mermaid PVC Ornaments Miniature Landscape Succulent Decoration Fish Tank Desk Decor Anime Figurine For Home
$0.52
No MOQ
Acrylic Christmas Gingerbread Man Letter Hanging Ornament Clear Snowflake Teardrop Pendant Alphabet A-Z Tree Decoration
Acrylic Christmas Gingerbread Man Letter Hanging Ornament Clear Snowflake Teardrop Pendant Alphabet A-Z Tree Decoration
like
Find Similar
Acrylic Christmas gingerbread man ornament featuring letter A with snowflake and teardrop - Gingerbread Man Icy Pendant Style A
Custom acrylic Christmas ornament with pink gingerbread man and letter B on a tree - Gingerbread Man Icy Pendant Style B
Acrylic Christmas pendant featuring a gingerbread man with red letter C and snowflakes - Gingerbread Man Icy Pendant Style C
Acrylic snowflake and gingerbread man ornament with letter D for Christmas tree - Gingerbread Man Icy Pendant Style D
+22
Acrylic Christmas Gingerbread Man Letter Hanging Ornament Clear Snowflake Teardrop Pendant Alphabet A-Z Tree Decoration
$0.69
No MOQ
Yoga Frog Figurines Resin And Glass Decorative Statues For Desktop Cabinet Home Office Nordic Style Creative Ornaments
Yoga Frog Figurines Resin And Glass Decorative Statues For Desktop Cabinet Home Office Nordic Style Creative Ornaments
like
Find Similar
Green resin hugging frog figurines, 13cm height handcrafted yoga animal decor ornament - Heart-Shaped Couple Frogs
Resin kissing frogs figurine in green with gold details, 12x6x10cm yoga frog decor - Kissing Couple Frogs
Pair of green resin yoga frogs making a heart shape with golden accents and clover - Couple Frogs Heart Gesture 221
Green resin yoga frog proposal figurine with gold details for home shelf decor - Proposal Couple Frogs
+16
Yoga Frog Figurines Resin And Glass Decorative Statues For Desktop Cabinet Home Office Nordic Style Creative Ornaments
$3.40-8.01
No MOQ
 · 
48 sold recently
Free Shipping
Large Christmas Tree Elf Legs Hanging Ornament Plush Santa Claus Legs Decor With Hook For Home Party Tree Topper Decoration
Large Christmas Tree Elf Legs Hanging Ornament Plush Santa Claus Legs Decor With Hook For Home Party Tree Topper Decoration
like
Find Similar
Elf leg Christmas tree hanging ornament with red suit and black boots festive decor - Santa Claus
Christmas elf leg hanging ornament with red and green stripes on a snowy tree - Red Elf Style
Christmas elf leg ornament with red and white stripes hanging on a snowy Christmas tree - Green Elf Style
Large Christmas Tree Elf Legs Hanging Ornament Plush Santa Claus Legs Decor With Hook For Home Party Tree Topper Decoration
$5.94
Mix MOQ : 2
Resin Snowman Family Christmas Hanging Ornament Snowman Character Festive Home Tree Decoration Winter Holiday Party Ornament
Resin Snowman Family Christmas Hanging Ornament Snowman Character Festive Home Tree Decoration Winter Holiday Party Ornament
like
Find Similar
Handcrafted Christmas snowman family resin ornament with hats and scarves on snow base - Three Snowmen Style
Customized snowman family Christmas ornament with 5 names for pregnancy announcement décor - Four Snowmen Style
Custom snowman family of five Christmas tree ornament with personalized resin finish - Five Snowmen Style
Resin Snowman Family Christmas Hanging Ornament Snowman Character Festive Home Tree Decoration Winter Holiday Party Ornament
$0.72
Mix MOQ : 2
Gothic Dark Fantasy Skull Tapestry Polyester Wall Hanging Horror Aesthetic Art Blanket For Bedroom Living Room Halloween Party Decor
Gothic Dark Fantasy Skull Tapestry Polyester Wall Hanging Horror Aesthetic Art Blanket For Bedroom Living Room Halloween Party Decor
like
Find Similar
Gothic tapestry with red-haired angel and swan by a snowy lake for wall decor - Red Hair Angel (2) / 150x100(Peach Skin)
Gothic skull tapestry with full moon and dead trees displayed over a modern sofa - Realistic Skull (4) / 150x100(Peach Skin)
Dark fantasy wolf tapestry detail showing twisted trees and mushrooms above a grey sofa - Dark Forest Wolf (6) / 150x100(Peach Skin)
Dark gothic wall tapestry with ruins and woman motif above a grey fabric sofa - Woman in Ruins (1) / 150x100(Peach Skin)
+104
Gothic Dark Fantasy Skull Tapestry Polyester Wall Hanging Horror Aesthetic Art Blanket For Bedroom Living Room Halloween Party Decor
$2.59-10.37
No MOQ
Free Shipping
Positive Emotional Support Knitted Crochet Doll Handmade Ornament Tabletop Decor Healing Gift
Positive Emotional Support Knitted Crochet Doll Handmade Ornament Tabletop Decor Healing Gift
like
Find Similar
Detail of hand-knitted green frog holding an inspirational card on a white background - Frog Autumn Green
Macro detail of pink crochet frog doll holding a white card with English text - Frog Rose Red
Cute green crochet frog doll holding an inspirational card for emotional support - Fruit Green Frog H Card
Detail showing an 8cm handmade crochet cabbage toy with an inspirational card - Cabbage P Card
+97
Positive Emotional Support Knitted Crochet Doll Handmade Ornament Tabletop Decor Healing Gift
$1.15-6.05
Mix MOQ : 5
 · 
350 sold recently
Top 3% Best Sellers
in Home Decor
Free Shipping
Telescopic Christmas Doll Ornament Santa Claus Snowman Reindeer Plush Figurine For Holiday Party Home Desktop Decoration
Telescopic Christmas Doll Ornament Santa Claus Snowman Reindeer Plush Figurine For Holiday Party Home Desktop Decoration
like
Find Similar
Charming telescopic Christmas Santa plush doll with red white stripes for festive decor - Santa Claus Style (D-BJ98)
Standing Christmas reindeer plush doll with retractable legs and red knitted sweater - Reindeer Style (D-BJ100)
Telescopic Christmas Doll Ornament Santa Claus Snowman Reindeer Plush Figurine For Holiday Party Home Desktop Decoration
$6.02
Mix MOQ : 2
Christmas Gingerbread House Resin Hanging Decoration DIY Family Personalized Painted Ornament Xmas Tree Decor For Holiday Party
Christmas Gingerbread House Resin Hanging Decoration DIY Family Personalized Painted Ornament Xmas Tree Decor For Holiday Party
like
Find Similar
Christmas gingerbread house resin ornament with heart roof and candy cane heart door - 2 Characters House (A629)
Creative 3-person gingerbread house resin Christmas ornament with red hats and white snow - 3 Characters House (A629)
Gingerbread house Christmas ornament with resin figurines and festive decorations - 4 Characters House (A629)
Detailed view of 5-member family gingerbread house ornament with glitter and candy cane decor - 5 Characters House (A629)
+3
Christmas Gingerbread House Resin Hanging Decoration DIY Family Personalized Painted Ornament Xmas Tree Decor For Holiday Party
$1.73
Mix MOQ : 2
Purple Velvet Christmas Ball Ornament With Ruffle Top And Hanging String Soft Flocking Decorative Ball For Christmas Tree Holiday Home Decor
Purple Velvet Christmas Ball Ornament With Ruffle Top And Hanging String Soft Flocking Decorative Ball For Christmas Tree Holiday Home Decor
like
Find Similar
Purple velvet flocking Christmas ball ornament with hanging loop 8cm diameter - Extra Small / Lavender
Purple velvet 10cm Christmas ball ornament with drawstring top for tree decoration - Small / Lavender
Purple velvet flocking Christmas ball ornament with hanging loop 12cm diameter - Medium / Lavender
15cm purple flocked velvet Christmas ball ornament with hanging string for decoration - Large / Lavender
+6
Purple Velvet Christmas Ball Ornament With Ruffle Top And Hanging String Soft Flocking Decorative Ball For Christmas Tree Holiday Home Decor
$1.27-5.48
No MOQ
Free Shipping
Bat Owl Bird Suncatcher Acrylic Stained Glass Style Window Hanging Gothic Halloween Decor Indoor Home Wall Ornament
Bat Owl Bird Suncatcher Acrylic Stained Glass Style Window Hanging Gothic Halloween Decor Indoor Home Wall Ornament
like
Find Similar
Detailed size specifications and waterproof features for acrylic bat window decor - Bat 01 / Thickness 0.3cm
8x8 inch red cardinal suncatcher bird ornament with stained glass acrylic texture - Red Bird / Thickness 0.2cm
Acrylic bat suncatcher with galaxy pattern and branch detail, 8x7 inch Halloween decor - Hanging Bat / Thickness 0.2cm
Colorful hummingbird suncatcher ornament in acrylic stained glass style with gold cord - Diamond Bird / Thickness 0.3cm
+10
Bat Owl Bird Suncatcher Acrylic Stained Glass Style Window Hanging Gothic Halloween Decor Indoor Home Wall Ornament
-4%
$1.16-2.33
No MOQ
 · 
124 sold recently
Handmade Orgonite Energy Pyramid Healing Crystal Resin Decor With Copper Coil Gold Foil Flower Of Life Table Ornament
Handmade Orgonite Energy Pyramid Healing Crystal Resin Decor With Copper Coil Gold Foil Flower Of Life Table Ornament
like
Find Similar
Amethyst and gold foil Orgone energy pyramid with flower of life symbol for desk decor - Candy Style (G1)
5cm Orgonite Pyramid with obsidian stones, golden spiral, and metallic foil base - Black And White Style (G2)
Handcrafted Amethyst Orgone Pyramid with golden spiral and geometric flower pattern - Amethyst And White Crystal Style(G3)
Lapis lazuli orgone pyramid with gold leaf flower of life symbol and copper spiral - Lapis Lazuli And White Crystal Style(G4)
+2
Handmade Orgonite Energy Pyramid Healing Crystal Resin Decor With Copper Coil Gold Foil Flower Of Life Table Ornament
$3.03
No MOQ
 · 
13 sold recently
Resin Penguin Family Christmas Ornament With Glitter Winter Hats And Scarves Hanging Decoration For Xmas Tree Festive Home
Resin Penguin Family Christmas Ornament With Glitter Winter Hats And Scarves Hanging Decoration For Xmas Tree Festive Home
like
Find Similar
Custom Penguin Couple Christmas Ornament with Mr. & Mrs. text and personalized names - 2 Penguins Family Music Hanging Ornament (A494)
Customized penguin family resin ornament wearing festive hats for Christmas decoration - 3 Penguins Family Music Hanging Ornament (A494)
Custom Penguin Family Christmas Ornament with Glitter Details and Gold Hanging String - 4 Penguins Family Music Hanging Ornament (A494)
Personalized family of 5 penguins resin Christmas ornament with glitter hats and gold string - 5 Penguins Family Music Hanging Ornament (A494)
+1
NewResin Penguin Family Christmas Ornament With Glitter Winter Hats And Scarves Hanging Decoration For Xmas Tree Festive Home
$2.59
No MOQ
Go to

More in home & kitchen

Explore more in dragon decor

homewallroomkidshandmadepartyshapestarsholdertassels
alloystyledesktopmetaldiydailyeyemakingsilverpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access