Everful

Wholesale dragon decor

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Dragon Decor

Find the perfect pieces: home decor accents & accessories, artificial decorations, artificial flowers and more

CarPets, Floor Mats & Protectants

All products in dragon decor

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Halloween Witch Please Wooden Sign Witch Hat Bat Pattern Wall Plaque Poplar Wood Decorative Board With Bowknot For Party Home Decor
Halloween Witch Please Wooden Sign Witch Hat Bat Pattern Wall Plaque Poplar Wood Decorative Board With Bowknot For Party Home Decor
like
Find Similar
Detail of Halloween wooden sign with Witch Please text, bat icons, and plaid bow decor - 13.5x25cm / Without Hook Style
Halloween Witch Please Wooden Sign Witch Hat Bat Pattern Wall Plaque Poplar Wood Decorative Board With Bowknot For Party Home Decor
$2.85
Mix MOQ : 2
Halloween Gnome Decoration Plush Faceless Doll Black Cat Bat Pumpkin Spider Ornaments For Festival Party Home Tabletop Decor Gift
Halloween Gnome Decoration Plush Faceless Doll Black Cat Bat Pumpkin Spider Ornaments For Festival Party Home Tabletop Decor Gift
like
Find Similar
Halloween gnome plush with purple hat, bat details and pumpkin on a rustic wood base - Purple Hat Pumpkin Style
Halloween black cat gnome doll with pink ears and plush beard on a rustic wood base - Black Cat Style
Halloween gnome plush with orange beard and yellow spider hat on a wooden base - Orange Hat Spider Style
Halloween faceless gnome doll with black bat wings and red pointed hat for desktop decoration - Bat Style
Halloween Gnome Decoration Plush Faceless Doll Black Cat Bat Pumpkin Spider Ornaments For Festival Party Home Tabletop Decor Gift
$1.15
No MOQ
Cute Cartoon Panda Figurine Resin Desktop Ornament Chinese Style Gourmet Blind Surprise Gift Home Office Decor
Cute Cartoon Panda Figurine Resin Desktop Ornament Chinese Style Gourmet Blind Surprise Gift Home Office Decor
like
Find Similar
Cat themed multifunctional resin figurine set used as phone holder and incense burner - 1244-21 Healing Companion Support Box 4 / Full Box Set
Cute resin cat figurine set with a tiny kitten on a swing and hidden mystery edition - 1210-110 Cat Swing Box 4 / Full Box Set
Set of crystal stone potted figurines with Rich and Fortune lucky inscriptions - -116 Vibrant Energy Box 6 / Full Box Set
Cute Siamese Cat Resin Figurine with Magnetic Feature for Desktop or Fridge Decor - 1244-24 The Flourishing Life Box 6 / Full Box Set
+104
Cute Cartoon Panda Figurine Resin Desktop Ornament Chinese Style Gourmet Blind Surprise Gift Home Office Decor
-5%
$1.19-31.21
No MOQ
 · 
21 sold recently
Free Shipping
Rustic Wood Merry Christmas Hanging Sign With Reindeer Bells Hollow Out Design Red Plaque Decoration For Door Home Party
Rustic Wood Merry Christmas Hanging Sign With Reindeer Bells Hollow Out Design Red Plaque Decoration For Door Home Party
like
Find Similar
Red wooden Merry Christmas door sign with hollow bells and rustic buffalo plaid bows - Bell Style Hanging Sign
Red wooden Christmas door sign with Merry Christmas text and festive checkered bow decor - Ball Style Hanging Sign
Rustic Wood Merry Christmas Hanging Sign With Reindeer Bells Hollow Out Design Red Plaque Decoration For Door Home Party
-4%
$4.38
Mix MOQ : 2
Christmas Angel Santa Snowman Reindeer Plush Doll Hanging Ornaments Knitted Fabric Foam Xmas Tree Decorations Children Gift
Christmas Angel Santa Snowman Reindeer Plush Doll Hanging Ornaments Knitted Fabric Foam Xmas Tree Decorations Children Gift
like
Find Similar
19cm Christmas angel plush doll with red knit hat and wings for tree decoration - Angel
Christmas gnome doll in red knit with white snowflake decor and long beard hanging ornament - Santa Claus
Christmas snowman plush pendant with red knitted outfit and gray snowflake hat - Snowman
Christmas reindeer doll ornament featuring red knit sweater with white snowflake details - Elk
+1
Christmas Angel Santa Snowman Reindeer Plush Doll Hanging Ornaments Knitted Fabric Foam Xmas Tree Decorations Children Gift
$0.98-3.92
Mix MOQ : 2
 · 
12 sold recently
Micro Landscape Beach Ornaments Resin Sandcastle Octopus Palm Tree Miniature Mediterranean Style DIY Decor
Micro Landscape Beach Ornaments Resin Sandcastle Octopus Palm Tree Miniature Mediterranean Style DIY Decor
like
Find Similar
Miniature Mediterranean resin sandcastle ornament with realistic grainy texture for beach decor - No. 1 Castle
Miniature bright red bucket ornament for micro beach landscape and fish tank decor - Beach Bucket
Miniature resin lighthouse ornament in red and white for Mediterranean beach decor - Red Lighthouse
Miniature resin seagull figurine on a wooden post for nautical beach micro landscapes - No. 1 Pigeon
+5
Micro Landscape Beach Ornaments Resin Sandcastle Octopus Palm Tree Miniature Mediterranean Style DIY Decor
-7%
$0.07-0.44
No MOQ
 · 
486 sold recently
3D Printed Articulated Animal Toy Frog Ant Hermit Crab Spider Lobster PLA Satin Iridescent Novelty Desk Decor
3D Printed Articulated Animal Toy Frog Ant Hermit Crab Spider Lobster PLA Satin Iridescent Novelty Desk Decor
like
Find Similar
3D printed lobster ornament with metallic color-changing finish in green and purple tones - Lobster / Red Yellow Blue Gradient
Detailed view of the 3D printed articulated hermit crab toy in a metallic gold finish - Hermit Crab / Silk Gold
Detail shot of a red 3D printed hermit crab toy with visible layered surface texture - Hermit Crab / Silk Red
Detailed macro view of a green 3D printed hermit crab toy with visible layer textures - Hermit Crab / Silk Green
+27
3D Printed Articulated Animal Toy Frog Ant Hermit Crab Spider Lobster PLA Satin Iridescent Novelty Desk Decor
$0.58-1.04
No MOQ
 · 
138 sold recently
Mini Witch Broom Hanging Ornament Branch Straw Wicca Altar Decor With Metal Charm And Crystal Stone Pendant
Mini Witch Broom Hanging Ornament Branch Straw Wicca Altar Decor With Metal Charm And Crystal Stone Pendant
like
Find Similar
Macro view of a mini wicca broom pendant with a silver pentagram and yellow crystal stone - Pentagram with Yellow Crystal
Close-up of mini wicca straw broom with silver pentagram and black crystal pendant - Pentagram with Black Crystal
Mini wicca straw broom car charm with pink crystal and pentagram metal pendant - Pentagram with Pink Crystal
Mini wicca witch broom charm with orange crystal and silver pentagram star pendant - Pentagram with Orange Crystal
+25
Mini Witch Broom Hanging Ornament Branch Straw Wicca Altar Decor With Metal Charm And Crystal Stone Pendant
-4%
$2.74
No MOQ
 · 
216 sold recently
Free Shipping
Vintage Wooden Carousel Music Box With 3 Horses Wind Up Musical Box For Kids Girls Birthday Christmas Home Desk Decor
Vintage Wooden Carousel Music Box With 3 Horses Wind Up Musical Box For Kids Girls Birthday Christmas Home Desk Decor
like
Find Similar
Retro wooden carousel music box with red polka dot roof and painted horses ornament - Polka Dot Red
Sky blue wooden carousel music box with hand-painted horses and star details - Dotted Blue
Pink and white wooden carousel music box with gold accents for kids birthday gift - Floral Pink
Classic white and red striped wooden carousel music box with miniature horses and gold trim - Floral Red
+9
Vintage Wooden Carousel Music Box With 3 Horses Wind Up Musical Box For Kids Girls Birthday Christmas Home Desk Decor
$4.76
Mix MOQ : 2
 · 
10 sold recently
Miniature Ocean Animal Figurines Resin Cute Cartoon Shark Whale Micro Landscape Decor DIY Craft Desktop Ornaments
Miniature Ocean Animal Figurines Resin Cute Cartoon Shark Whale Micro Landscape Decor DIY Craft Desktop Ornaments
like
Find Similar
Miniature seal figurine in translucent resin for micro landscape, 2cm height - No. 1 Sitting Whale
Mini blue resin seashell with pearl ornament for miniature ocean micro landscape - No. 8 Shell
Miniature pink resin octopus figurine with translucent jelly texture on blue sand - No. 3 Jellyfish
Miniature orange tropical fish resin figurine 2.1cm for micro landscape and aquarium decor - No. 15 Goldfish
+42
Miniature Ocean Animal Figurines Resin Cute Cartoon Shark Whale Micro Landscape Decor DIY Craft Desktop Ornaments
-4%
$0.29-0.84
No MOQ
 · 
316 sold recently
Free Shipping
Bohemian Handmade Feather Dream Catcher With Tree Of Life Moon Design Wall Hanging Home Decor Ornament For Bedroom Living Room
Bohemian Handmade Feather Dream Catcher With Tree Of Life Moon Design Wall Hanging Home Decor Ornament For Bedroom Living Room
like
Find Similar
Bohemian moon dream catcher with tree of life charm and vibrant turquoise feathers - Peacock Blue
Bohemian Handmade Feather Dream Catcher With Tree Of Life Moon Design Wall Hanging Home Decor Ornament For Bedroom Living Room
$3.03
No MOQ
 · 
21 views
Antique Copper Plated Alloy Insect Miniature Ornaments Butterfly Bee Dragonfly Statues For Home Office Desk Decor Vintage
Antique Copper Plated Alloy Insect Miniature Ornaments Butterfly Bee Dragonfly Statues For Home Office Desk Decor Vintage
like
Find Similar
Handcrafted antique copper bee figurine with vintage finish for home and office decor - Bee
Vintage bronze butterfly ornament featuring intricate relief carving for home decor - Butterfly
Detailed close-up of a realistic vintage brass ant figurine held in hand for scale - Army Ant
Macro shot of a solid brass Zen frog figurine being held in hand to show the mini size - Arrow Frog
+31
Antique Copper Plated Alloy Insect Miniature Ornaments Butterfly Bee Dragonfly Statues For Home Office Desk Decor Vintage
$0.20-1.21
No MOQ
 · 
54 sold recently
Handmade Indian Dream Catcher Wall Hanging Home Decor Feather Wooden Beads LED Light Ornament Bedroom Gift
Handmade Indian Dream Catcher Wall Hanging Home Decor Feather Wooden Beads LED Light Ornament Bedroom Gift
like
Find Similar
Handmade purple dream catcher wind chime with delicate feathers and wooden beads - No Light Version / Purple
Handmade mint green dream catcher with intricate weaving, wooden beads and soft feathers - No Light Version / Green
Blue dream catcher with feathers and heart charm, handmade home decoration wall hanging - No Light Version / Blue
Handmade white dream catcher with feathers, colorful beads and a silver heart pendant - No Light Version / White
+6
Handmade Indian Dream Catcher Wall Hanging Home Decor Feather Wooden Beads LED Light Ornament Bedroom Gift
-4%
$1.78-2.14
No MOQ
 · 
85 sold recently
Natural Crystal Crushed Stone Owl Figurine Resin Animal Ornament With Gold Foil For Home Office Desktop Decor Gift
Natural Crystal Crushed Stone Owl Figurine Resin Animal Ornament With Gold Foil For Home Office Desktop Decor Gift
like
Find Similar
Pink natural crystal owl figurine with gold foil accents and large blue eyes - Rose Quartz
Brown resin owl figurine with gold glitter, blue eyes, and natural crystal stone detail - Red Jasper
Dark grey resin owl statue with blue crystal eyes and gold spots for home decor - Obsidian
Resin owl figurine with reddish-brown natural crystals and gold foil decorative accents - Red Agate
+31
Natural Crystal Crushed Stone Owl Figurine Resin Animal Ornament With Gold Foil For Home Office Desktop Decor Gift
$2.59
No MOQ
 · 
20 sold recently
Indian Dream Catcher Double Ring Handmade Hanging Ornament With ABS Beads And Fumigated Feathers For Home Wall Decor
Indian Dream Catcher Double Ring Handmade Hanging Ornament With ABS Beads And Fumigated Feathers For Home Wall Decor
like
Find Similar
Dual ring dreamcatcher with red woven circles, natural brown feathers and beads decoration - Red
Handmade brown and white feather dream catcher with double hoops and natural beads decoration - Beige
Handmade brown double ring dream catcher with natural feathers and wooden beads - Dark Coffee
Double hoop dream catcher with orange and brown feathers and beads for wall hanging - Earthy Yellow
+2
Indian Dream Catcher Double Ring Handmade Hanging Ornament With ABS Beads And Fumigated Feathers For Home Wall Decor
-5%
$1.42
No MOQ
 · 
161 sold recently
Miniature Resin Duck Figurines Glow In The Dark Sunglasses Gold Chain Colorful Luminous Micro Landscape Desktop Ornaments
Miniature Resin Duck Figurines Glow In The Dark Sunglasses Gold Chain Colorful Luminous Micro Landscape Desktop Ornaments
like
Find Similar
Glow-in-the-dark blue duck miniature with sunglasses and gold chain, size 1.6cm - Greenish Blue
Luminous sunglasses duck miniature in matte resin with gold chain, size 1.6cm 1.9g - White
Luminous miniature resin duck with sunglasses and gold chain on sand, 1.6cm size - Pink
Mini resin yellow duckling with sunglasses and gold necklace, 1.6cm micro landscape decor - Yellow
+6
Miniature Resin Duck Figurines Glow In The Dark Sunglasses Gold Chain Colorful Luminous Micro Landscape Desktop Ornaments
$0.05
Mix MOQ : 7
 · 
460 sold recently
Retro Geode Style Resin Candle Bowl Aromatherapy Candle Holder For Home Tabletop Decor Geode Crystal Texture Resin Craft Gift
Retro Geode Style Resin Candle Bowl Aromatherapy Candle Holder For Home Tabletop Decor Geode Crystal Texture Resin Craft Gift
like
Find Similar
Close-up of a lit pink crystal geode candle bowl placed on a carved wooden surface - Large Size 6x12 / Light Pink
Decorative creative resin geode bowl candle for home office aromatherapy and garden decor - Large Size 6x12 / Orange
Detailed view of a lit geode-style crystal candle bowl for atmospheric home decor - Large Size 6x12 / Cyan Blue
Creative geode-shaped amethyst candle bowl for unique home decor and aromatherapy - Large Size 6x12 / Dark Purple
+6
Retro Geode Style Resin Candle Bowl Aromatherapy Candle Holder For Home Tabletop Decor Geode Crystal Texture Resin Craft Gift
-5%
$2.74-3.97
No MOQ
 · 
160 sold recently
Top 5% Best Sellers
in Home Decor
Gothic Skeleton Wall Hanging Tapestry Retro Barbershop Floral Skull Art Scroll With Wood Rod Tassels For Halloween Home Decor
Gothic Skeleton Wall Hanging Tapestry Retro Barbershop Floral Skull Art Scroll With Wood Rod Tassels For Halloween Home Decor
like
Find Similar
Skull floral wall tapestry with black wood frame and tassels for bedroom decor - 35x50cm / Floral Skull (Style 1)
Detailed view of skull tapestry with floral patterns, hummingbirds, and black tassels - 35x50cm / Vintage Art Skull (Style 2)
Detailed wall tapestry featuring a retro barbershop skull with red roses and black tassels - 35x50cm / Barbershop Theme (Style 3)
Detail of skull wall tapestry with floral pattern, wooden pole, and black tassels decor - 35x50cm / Autumn Floral Skull (Style 4)
+6
Gothic Skeleton Wall Hanging Tapestry Retro Barbershop Floral Skull Art Scroll With Wood Rod Tassels For Halloween Home Decor
$2.85
Mix MOQ : 2
Cute Cartoon Dinosaur Resin Figurines Mini Ornament For Car Dashboard Desktop Home Decor Cake Toppers Gift
Cute Cartoon Dinosaur Resin Figurines Mini Ornament For Car Dashboard Desktop Home Decor Cake Toppers Gift
like
Find Similar
Cute purple dinosaur car ornament in a clear PVC gift box, soft pastel toy for dash decor - PVC Box Packaging / Purple - Prone Position (Generation 2 Mini)
Pink cartoon dinosaur cake topper ornament in a transparent PVC display box - PVC Box Packaging / Pink - Lying Position (Generation 2 Mini)
Cute light blue dinosaur cartoon figurine in PVC gift box with pink floral background - PVC Box Packaging / Blue - Lying Position (Generation 2 Mini)
Cute mint green dinosaur car ornament with matte finish in a PVC box packaging - 1B Cyan Green - Sitting Position (Generation 1 Mini)
+2
Cute Cartoon Dinosaur Resin Figurines Mini Ornament For Car Dashboard Desktop Home Decor Cake Toppers Gift
$1.15
No MOQ
 · 
25 views
Glitter Round Circle Paper Garland Hanging Banner For Christmas Party Wedding Birthday Home Decor Winter Blue Silver Red Green
Glitter Round Circle Paper Garland Hanging Banner For Christmas Party Wedding Birthday Home Decor Winter Blue Silver Red Green
like
Find Similar
Blue and silver sparkling circle garland for Christmas party and ceiling decoration - 3 Meters / Winter Style (Blue and Silver)
Christmas glitter paper circle garland hanging decoration in red, green, and silver - 3 Meters / Christmas Style (Red Green White)
Glitter Round Circle Paper Garland Hanging Banner For Christmas Party Wedding Birthday Home Decor Winter Blue Silver Red Green
$0.81-0.92
No MOQ
 · 
20 sold recently
Tropical Wooden Surfboard Wall Art Beach Coastal Decorative Plaque Ocean Theme Hanging Ornament For Home Bedroom Living Room Decor
Tropical Wooden Surfboard Wall Art Beach Coastal Decorative Plaque Ocean Theme Hanging Ornament For Home Bedroom Living Room Decor
like
Find Similar
Detail of wooden surfboard wall decor set with turtle, hibiscus, and pineapple cutouts - Tropical Element Style-Turtle Hibiscus Pineapple (ms8397)
Three wooden surfboard wall decors with laser-cut sea turtle, flower, and leaf designs - Tropical Plant Style-Turtle Hibiscus Monstera (ms10801)
Macro detail of three surfboard-shaped wooden wall art pieces with laser-cut sea turtle motifs - Ocean Life Style-Turtle Sea Star Coral (ms10802)
Tropical Wooden Surfboard Wall Art Beach Coastal Decorative Plaque Ocean Theme Hanging Ornament For Home Bedroom Living Room Decor
$7.75
No MOQ
 · 
28 views
Handmade Mini Crystal Witch Besom Broom Hanging Ornament Wicca Altar Decor Halloween Prop With Alloy Pendant Natural Stones
Handmade Mini Crystal Witch Besom Broom Hanging Ornament Wicca Altar Decor Halloween Prop With Alloy Pendant Natural Stones
like
Find Similar
Detail of mini Wicca broom with healing crystals and silver pentagram goddess pendant - Triple Goddess Pentagram Style (01)
Miniature Wicca besom with crystals and tree of life charm on black background - Tree of Life Triple Goddess Style (02)
Detail of wicca mini broom featuring copper wire, amethyst crystals and metal butterfly - Hollow Butterfly Style (03)
Mini Wicca witch broom with rose quartz and a bronze goddess charm on a dark background - Goddess Isis Style (04)
+7
Handmade Mini Crystal Witch Besom Broom Hanging Ornament Wicca Altar Decor Halloween Prop With Alloy Pendant Natural Stones
$5.62
No MOQ
 · 
16 sold recently
Free Shipping
Nordic Viking Knight Gnome Christmas Decoration Plush Figurine With Horned Helmet Ax Shield Warrior Dwarf Ornament Home Party Decor
Nordic Viking Knight Gnome Christmas Decoration Plush Figurine With Horned Helmet Ax Shield Warrior Dwarf Ornament Home Party Decor
like
Find Similar
Viking gnome doll with horned helmet and axe for home decoration and festive ornaments - Black Knight Gnome
Viking knight gnome plush with horned helmet, shield and axe for holiday decoration - White Knight Gnome
Detail of Viking gnome plush with warrior helmet, shield and axe in festive setup - Brown Knight Gnome
Nordic Viking Knight Gnome Christmas Decoration Plush Figurine With Horned Helmet Ax Shield Warrior Dwarf Ornament Home Party Decor
$3.55
Mix MOQ : 2
Handmade Dream Catcher Feather Wooden Beads Romantic Wall Hanging Home Decor Bohemian Style For Girls Bedroom
Handmade Dream Catcher Feather Wooden Beads Romantic Wall Hanging Home Decor Bohemian Style For Girls Bedroom
like
Find Similar
Pink dreamcatcher with soft feathers and glowing LED fairy lights for wall decor - With LED Light / Pink
Blue dream catcher with feathers and heart pendant hanging on a light blue wall decoration - Standard Type / Blue
Handmade white dream catcher with soft feathers and beads against a light blue background - Standard Type / White
Mint green dream catcher with turquoise feathers and wooden beads on a light blue wall - Standard Type / Green
+6
Handmade Dream Catcher Feather Wooden Beads Romantic Wall Hanging Home Decor Bohemian Style For Girls Bedroom
$1.73-2.16
No MOQ
 · 
64 sold recently
Vintage Wooden Carousel Music Box Rotating Horse Wind-Up Musical Box Desktop Decor For Kids Birthday Craft Gift
Vintage Wooden Carousel Music Box Rotating Horse Wind-Up Musical Box Desktop Decor For Kids Birthday Craft Gift
like
Find Similar
Vintage carousel music box with red and gold canopy and rotating painted horses - Red
Decorative pink and blue carousel music box with mechanical wind-up for kids gifts - Blue & Pink
Vintage Wooden Carousel Music Box Rotating Horse Wind-Up Musical Box Desktop Decor For Kids Birthday Craft Gift
$3.89
No MOQ
 · 
10 sold recently
Resin Miniature Landscape Ornaments Retro Stone Bridge Well Lighthouse Fairy Garden DIY Terrarium Decor Desk Accessories
Resin Miniature Landscape Ornaments Retro Stone Bridge Well Lighthouse Fairy Garden DIY Terrarium Decor Desk Accessories
like
Find Similar
Miniature resin pond model for fairy gardens featuring blue water and tiny mushrooms - Stump Water Pool
Miniature purple bridge figurine in resin with wood texture, size 6.8cm x 1.5cm - Purple Plank Small Bridge
Miniature resin arched bridge with brown wood texture 1.5cm high 6.8cm long for micro landscape - Brown Plank Small Bridge
Miniature vintage resin grey lighthouse tower figurine for micro landscape decor 4.9cm - West Lake Lighthouse
+3
Resin Miniature Landscape Ornaments Retro Stone Bridge Well Lighthouse Fairy Garden DIY Terrarium Decor Desk Accessories
$0.14-0.30
Mix MOQ : 3
 · 
1K+ sold recently
French Bulldog Figurine Natural Crystal Gravel Resin Dog Statue Gold Foil Small Desk Ornament Home Decor Animal Healing
French Bulldog Figurine Natural Crystal Gravel Resin Dog Statue Gold Foil Small Desk Ornament Home Decor Animal Healing
like
Find Similar
French bulldog figurine crafted with brown crystal chips, gold foil, and clear resin - Red Jasper
Handheld dark brown resin French Bulldog statue with gold spots and crystal stones - Tiger's Eye
French Bulldog figurine with amethyst crystals and gold foil in clear resin finish - Amethyst
French Bulldog figurine with green natural crystal stones and gold foil resin detail - Unakite
+19
French Bulldog Figurine Natural Crystal Gravel Resin Dog Statue Gold Foil Small Desk Ornament Home Decor Animal Healing
$1.59
Mix MOQ : 2
 · 
191 sold recently
Unicorn Dreamcatcher With LED Lights Handmade Colorful Feather Wall Hanging For Bedroom Girls Room Decor Romantic
Unicorn Dreamcatcher With LED Lights Handmade Colorful Feather Wall Hanging For Bedroom Girls Room Decor Romantic
like
Find Similar
Unicorn dream catcher with pink blue roses and colorful hanging feathers in pastel tones - MS9061 Without Light
Unicorn dream catcher with rainbow tassels and purple flowers for room decoration - MS9139 Colorful Without Light
Pink and white unicorn dream catcher with flowers and fabric ribbons for home decoration - MS9036A Pink Without Light
Handmade pink unicorn dream catcher with floral decor and soft pink tassels - MS9035A Pink Without Light
+16
Unicorn Dreamcatcher With LED Lights Handmade Colorful Feather Wall Hanging For Bedroom Girls Room Decor Romantic
-5%
$2.33-5.07
No MOQ
 · 
20 sold recently
Mediterranean Heart Shaped Wood Hanging Ornament Tropical Flamingo Gecko Palm Tree IBIZA Beach Party Home Wall Decor
Mediterranean Heart Shaped Wood Hanging Ornament Tropical Flamingo Gecko Palm Tree IBIZA Beach Party Home Wall Decor
like
Find Similar
IBIZA wooden heart ornament with flamingo and palm tree patterns for beach home decor - Flamingo
Detail of heart wooden ornament with green lizard, Ibiza text and tropical palm leaves - Gecko
Macro detail of a heart-shaped wooden Ibiza ornament with palm tree and camper van - Car
Mediterranean Heart Shaped Wood Hanging Ornament Tropical Flamingo Gecko Palm Tree IBIZA Beach Party Home Wall Decor
$1.44
Mix MOQ : 2
Free Shipping
Luminous Mini Duck Figurines Resin Duckling Ornaments Micro Landscape Glow In The Dark Desktop Decor Cute Animal Statues
Luminous Mini Duck Figurines Resin Duckling Ornaments Micro Landscape Glow In The Dark Desktop Decor Cute Animal Statues
like
Find Similar
Miniature yellow luminous resin duck with pink bow for micro landscapes, 2cm height - Cool Duck - With Headband
Miniature yellow resin duck figurine with black sunglasses and 1.6cm compact size - Cool Duck - Black Sunglasses
Miniature yellow glowing duck resin figurine with green hat on blue decorative sand - Cool Duck - Sun Hat
Miniature luminous yellow resin duck with pink heart-shaped sunglasses for micro landscapes - Cool Duck - Heart Glasses
+3
Luminous Mini Duck Figurines Resin Duckling Ornaments Micro Landscape Glow In The Dark Desktop Decor Cute Animal Statues
$0.08
Mix MOQ : 4
 · 
921 sold recently
Halloween Gothic Coffin Wooden Desktop Ornament Spooky Spider Web Moth Moon Star Mystery Dark Aesthetic Home Decoration
Halloween Gothic Coffin Wooden Desktop Ornament Spooky Spider Web Moth Moon Star Mystery Dark Aesthetic Home Decoration
like
Find Similar
Detail view of gothic wooden coffin decor with moon, stars, and hand engraving - Moon and Stars Pattern (BS4328)
Detailed view of coffin-shaped wooden Gothic shelf with moth and hand carvings - Death's-Head Hawkmoth Pattern (BS4329)
Detail showing the wooden coffin-shaped shelf with a spider and web gothic design - Spider Web Pattern (BS4330)
Halloween Gothic Coffin Wooden Desktop Ornament Spooky Spider Web Moth Moon Star Mystery Dark Aesthetic Home Decoration
$5.73
No MOQ
 · 
30 views
Miniature Flamingo Figurine Resin Micro Landscape Ornament DIY Succulent Bonsai Craft Decor Accessory
Miniature Flamingo Figurine Resin Micro Landscape Ornament DIY Succulent Bonsai Craft Decor Accessory
like
Find Similar
Pink miniature flamingo figurine for DIY micro landscape bonsai succulent decoration - Flamingo / Magenta
Miniature yellow resin flamingo figurine for micro landscape and bonsai decoration - Little Duck / Green
Miniature light purple flamingo figurines for DIY micro landscape and bonsai garden decor - Flamingo / Purple
Set of two miniature blue resin ducks on blue sand for DIY micro landscape decor - Little Duck / Blue
+2
Miniature Flamingo Figurine Resin Micro Landscape Ornament DIY Succulent Bonsai Craft Decor Accessory
$0.06
No MOQ
 · 
5K+ sold recently
Funny Naughty Chicken Ceramic Resin Ornaments With Dangling Legs Garden Decoration Home Desk Decor Cartoon Figurine
Funny Naughty Chicken Ceramic Resin Ornaments With Dangling Legs Garden Decoration Home Desk Decor Cartoon Figurine
like
Find Similar
Close-up of resin chicken statue with long rope legs and quirky thick lips for garden decor - Red
Detailed view of handmade funny chicken garden statue with rustic rope legs and wooden beads - Green
Funny resin chicken garden statue with long rope legs for outdoor fence yard decor - Blue
Three funny resin garden chicken statues with dangling legs for outdoor fence decor - Red, Green And Blue
Funny Naughty Chicken Ceramic Resin Ornaments With Dangling Legs Garden Decoration Home Desk Decor Cartoon Figurine
-5%
$3.12-9.31
No MOQ
 · 
79 sold recently
Cute Animal Mystery Figure PVC Plush Transparent Glitter Cartoon Character Desk Ornament Gift
Cute Animal Mystery Figure PVC Plush Transparent Glitter Cartoon Character Desk Ornament Gift
like
Find Similar
Capybara beach holiday series blind box figurines featuring six creative summer vacation poses - Beach Holiday Set 6/Full Box
Cute bee collection blind box set with six mini figurines for desk decoration - Little Bee Set 6/Full Box
Candy Paradise plush blind box figures with colorful pastel designs and fuzzy details - Candy Paradise Set 12/Full Box
Cute panda blind box figurine series featuring 7 unique resin poses for desk decor - Panda Group Happy Daily Set 6/Full Box
+88
Cute Animal Mystery Figure PVC Plush Transparent Glitter Cartoon Character Desk Ornament Gift
-5%
$7.12-40.57
No MOQ
 · 
111 views
Bohemian Dream Catcher Wall Hanging Decor Handmade Ethnic Feather Wooden Beads Large Rings Ornament For Home Bedroom
Bohemian Dream Catcher Wall Hanging Decor Handmade Ethnic Feather Wooden Beads Large Rings Ornament For Home Bedroom
like
Find Similar
Brown handmade bohemian dreamcatcher with colorful feathers on a white wall decor - Brown
Handmade bohemian purple dream catcher with feathers and beads for wall decoration - Purple
Handmade dreamcatcher with turquoise beads and grey spotted feathers hanging on a white wall - Blue
Handmade dream catcher with green feathers and brown beads hanging on white wall - Green
+2
Bohemian Dream Catcher Wall Hanging Decor Handmade Ethnic Feather Wooden Beads Large Rings Ornament For Home Bedroom
$10.61
Mix MOQ : 2
 · 
20 views
Free Shipping
French Bulldog Figurine Natural Crystal Gemstone Carved Dog Statue Desk Ornament Home Decor Gift
French Bulldog Figurine Natural Crystal Gemstone Carved Dog Statue Desk Ornament Home Decor Gift
like
Find Similar
Macro detail of blue translucent crystal French Bulldog figurine on dark wood surface - Blue Opalite
Macro shot of a 3cm white semi-transparent crystal French bulldog figurine on wood - Afghan Jade
Macro shot of 3cm green semi-precious stone french bulldog carving on wooden surface - Green Aventurine
Green semi-precious gemstone carving of a French Bulldog figurine with natural mineral texture - Ruby Zoisite
+17
French Bulldog Figurine Natural Crystal Gemstone Carved Dog Statue Desk Ornament Home Decor Gift
$3.46
Mix MOQ : 2
 · 
38 sold recently
Free Shipping
Christmas Snowman Family Hanging Ornament Resin North Pole Sign Festive Tree Decoration Holiday Gift Home Party Decor
Christmas Snowman Family Hanging Ornament Resin North Pole Sign Festive Tree Decoration Holiday Gift Home Party Decor
like
Find Similar
Customizable resin snowman North Pole sign hanging ornament for Christmas tree decor - Double Snowmen Sign Style (A463)
Customizable snowman family Christmas ornament with North Pole sign for holiday tree decor - Triple Snowmen Sign Style (A463)
Resin Snowman Family of Four Christmas Ornament with North Pole Signpost decoration - Quadruple Snowmen Sign Style (A463)
Customized 5-member snowman family Christmas ornament with North Pole signpost design - Quintuple Snowmen Sign Style (A463)
+1
Christmas Snowman Family Hanging Ornament Resin North Pole Sign Festive Tree Decoration Holiday Gift Home Party Decor
$2.59
Mix MOQ : 2
 · 
10 sold recently
3D Printed Poseable Sports Ball Action Figure Desk Ornaments Basketball Soccer Baseball Football Volleyball Golf Bowling Pin Decoration Gift
3D Printed Poseable Sports Ball Action Figure Desk Ornaments Basketball Soccer Baseball Football Volleyball Golf Bowling Pin Decoration Gift
like
Find Similar
3D printed poseable soccer ball figure with movable black and white limbs, 7cm tall - Soccer Style
Articulated basketball figure poseable toy ornament in orange, size 9cm x 7cm - Basketball Style
Creative 7cm 3D printed brown American football figurine in sitting pose - Rugby Football Style
Creative sitting baseball figurine with movable limbs and red stitching details - Baseball Style
+4
3D Printed Poseable Sports Ball Action Figure Desk Ornaments Basketball Soccer Baseball Football Volleyball Golf Bowling Pin Decoration Gift
$1.96
Mix MOQ : 3
 · 
51 sold recently
Free Shipping
Bohemian Handmade Feather Dreamcatcher With LED Warm Light Natural Stones Agate Slices Wall Hanging Decor For Home Bedroom
Bohemian Handmade Feather Dreamcatcher With LED Warm Light Natural Stones Agate Slices Wall Hanging Decor For Home Bedroom
like
Find Similar
Pink and purple bohemian dreamcatcher with colorful agate slices and feathers decoration - Pink
Pink and purple feather dream catcher with glowing LED lights for bedroom decor - With Lights / Pink
Bohemian dream catcher with green feathers and star pendant on a white wall - Standard / Green
Handmade green feather dream catcher with warm LED lights for bohemian home wall decor - With Lights / Green
+2
Bohemian Handmade Feather Dreamcatcher With LED Warm Light Natural Stones Agate Slices Wall Hanging Decor For Home Bedroom
$9.74-10.37
No MOQ
Moon Dream Catcher With Tree Of Life Pendant And Feathers Luminous Glow In The Dark Handmade Boho Wall Hanging Home Decor
Moon Dream Catcher With Tree Of Life Pendant And Feathers Luminous Glow In The Dark Handmade Boho Wall Hanging Home Decor
like
Find Similar
Dreamy moon-shaped dreamcatcher with pink and blue feathers for wall decoration - Finished Product / Pink
Blue and white crescent moon dream catcher with tree of life and star charms - Finished Product / Blue
Moon Dream Catcher With Tree Of Life Pendant And Feathers Luminous Glow In The Dark Handmade Boho Wall Hanging Home Decor
-4%
$5.97
Mix MOQ : 2
 · 
1 reviews
Blind Box Mini Figurine Mystery Toy Resin Lucky Animal Desktop Ornament Chinese New Year Style Cartoon Doll Collectible
Blind Box Mini Figurine Mystery Toy Resin Lucky Animal Desktop Ornament Chinese New Year Style Cartoon Doll Collectible
like
Find Similar
Rotatable Shanhai Spirit Fox blind box collectible figures for desktop decoration - -483 Dreamy Mountain And Sea Spirit Fox Set 6 / Full Box Set
Collectible Nine-Tailed Fox incense burner figurines in assorted pastel colors - A153 Mountain And Sea Nine-tailed Fox Small Incense Burner Set 6 / Full Box Set
Nine-Tailed Fox fairy figure set with 12 regular and 2 hidden resin mystery box styles - A150 Ten Miles Of Peach Blossoms Nine-tailed Fox Small Set 12 / Full Box Set
Nine-tailed fox resin figures in various pastel colors with mythological floral details - Hx-145 Fox Mountain Notes Set 6 / Full Box Set
+140
Blind Box Mini Figurine Mystery Toy Resin Lucky Animal Desktop Ornament Chinese New Year Style Cartoon Doll Collectible
-5%
$1.64-40.57
No MOQ
 · 
37 views
Free Shipping
Halloween Party Decorations Flying Witch Ghost Pumpkin Hanging Ornaments For Haunted House Festive Indoor Home Decor Supplies
Halloween Party Decorations Flying Witch Ghost Pumpkin Hanging Ornaments For Haunted House Festive Indoor Home Decor Supplies
like
Find Similar
Set of 10 yellow-green gradient artificial pumpkins for Halloween decor, 3.5cm each - Small Pumpkin (Yellow + Green) 10PCS
Set of 10 purple artificial mini pumpkins with gold dots for Halloween decor - Small Pumpkin (Purple) 10PCS
Set of 10 mini light green artificial pumpkins for Halloween decor, 3.5cm foam models - Small Pumpkin (Light Green) 10PCS
Set of 10 mini orange faux pumpkins with yellow stripes for Halloween decor, 3.5cm size - Small Pumpkin (Orange) 10PCS
+53
Halloween Party Decorations Flying Witch Ghost Pumpkin Hanging Ornaments For Haunted House Festive Indoor Home Decor Supplies
-5%
$0.54-7.36
No MOQ
 · 
30 sold recently
Free Shipping
Red White Christmas Tree Hanging Ornaments Spiral Finial Teardrop Baubles With Glitter Stars For Holiday Party Home Decor
Red White Christmas Tree Hanging Ornaments Spiral Finial Teardrop Baubles With Glitter Stars For Holiday Party Home Decor
like
Find Similar
Christmas tree ornaments set with 6 red and white spiral stripe balls and star patterns - Red White Long Spiral Ball
6-piece set of red and white spiral Christmas ornaments with glitter stars in Style A - Red White Long Pumpkin Spiral Ball
Red and white spiral Christmas ornaments set with star patterns and dimension markers - Red White Pointed Spiral Ball
Red White Christmas Tree Hanging Ornaments Spiral Finial Teardrop Baubles With Glitter Stars For Holiday Party Home Decor
$2.10
No MOQ
Unicorn Dreamcatcher With LED Lights Colorful Feathers Handmade Woven Hanging Decoration Bohemian Wall Art For Girls Gift
Unicorn Dreamcatcher With LED Lights Colorful Feathers Handmade Woven Hanging Decoration Bohemian Wall Art For Girls Gift
like
Find Similar
Unicorn dream catcher with LED lights, colorful feathers and ribbons for home wall decor - With LED Lights
Unicorn dream catcher with colorful feathers and lace hanging against a clear blue sky - Colorful Purple Unicorn
Unicorn Dreamcatcher With LED Lights Colorful Feathers Handmade Woven Hanging Decoration Bohemian Wall Art For Girls Gift
$3.31-4.18
No MOQ
Creative Rhinestone Inlaid Hummingbird Christmas Tree Hanging Ornament Metal Bird Pendant For Holiday Home Decor Gift
Creative Rhinestone Inlaid Hummingbird Christmas Tree Hanging Ornament Metal Bird Pendant For Holiday Home Decor Gift
like
Find Similar
Glittering crystal hummingbird ornament with sparkling rhinestones and silver metal finish - Flying Bird 1
Creative Rhinestone Inlaid Hummingbird Christmas Tree Hanging Ornament Metal Bird Pendant For Holiday Home Decor Gift
$2.56
No MOQ
 · 
45 sold recently
Handmade Mini Witch Broom Pendant Crystal Triple Moon Pentagram Natural Wood Halloween Altar Car Keychain Accessory
Handmade Mini Witch Broom Pendant Crystal Triple Moon Pentagram Natural Wood Halloween Altar Car Keychain Accessory
like
Find Similar
Mini handmade decorative witch broom with natural wood, twine, and purple crystal stone - Natural Wood Broom + Amethyst / 10cm
Close-up of handmade mini broom keychain with natural twigs and orange bead detail - Natural Wood Broom + Red Agate / 10cm
Detail of a handmade mini witch broom with a silver triple moon pentagram charm - Natural Wood Broom + Triple Moon / 10cm
Handmade miniature altar broom with crystal pendant for car decor and holiday ornament - Natural Wood Broom + White Crystal / 10cm
+13
Handmade Mini Witch Broom Pendant Crystal Triple Moon Pentagram Natural Wood Halloween Altar Car Keychain Accessory
$1.44
No MOQ
 · 
23 views
Realistic Chinese Dragon Animal Model Solid Plastic Mythical Beast Figure Five Claws Auspicious Ornament Collection
Realistic Chinese Dragon Animal Model Solid Plastic Mythical Beast Figure Five Claws Auspicious Ornament Collection
like
Find Similar
Chinese silver dragon mythical beast figurine with blue accents and red flame base - Silver
Chinese dragon animal model in gold and reddish brown with dimensions and weight specs - Gold
Detailed solid red Chinese dragon figurine with scale textures and yellow flame accents - Red
Realistic Blue Chinese Dragon mythical animal model with orange fins and 22cm solid PVC body - Blue
+1
NewRealistic Chinese Dragon Animal Model Solid Plastic Mythical Beast Figure Five Claws Auspicious Ornament Collection
-4%
$5.75
No MOQ
Natural Crystal Stone Crushed Stone Crown Bear Figurine Resin Ornament Heart Shape Bear Desktop Figurine Home Office Car Decoration Art Craft Gift
Natural Crystal Stone Crushed Stone Crown Bear Figurine Resin Ornament Heart Shape Bear Desktop Figurine Home Office Car Decoration Art Craft Gift
like
Find Similar
Blue natural crystal stone resin bear figurine with gold crown for home decor - Lapis Lazuli Style
Polished black crystal bear figurine with gold crown and heart detail home decor - Obsidian Style
Crown bear ornament with yellow natural crystals and gold foil in clear resin - White Crystal Style
Crown bear ornament filled with red jasper crystals and gold foil on white stand - Red Jasper Style
+17
Natural Crystal Stone Crushed Stone Crown Bear Figurine Resin Ornament Heart Shape Bear Desktop Figurine Home Office Car Decoration Art Craft Gift
-5%
$2.46
No MOQ
 · 
55 sold recently
Evil Eye Dreamcatcher Wall Hanging Handmade Feather Beads Boho Ornament Home Decor For Bedroom Living Room
Evil Eye Dreamcatcher Wall Hanging Handmade Feather Beads Boho Ornament Home Decor For Bedroom Living Room
like
Find Similar
Detail of handmade evil eye dreamcatcher with black feathers and woven blue core - Single Layer Black Evil Eye
Blue Evil Eye dreamcatcher with hanging feathers and woven center, size 19cm x 30cm - Single Layer Royal Blue Evil Eye
Handwoven Evil Eye Dream Catcher with black and blue feathers for boho wall decoration - Black Evil Eye
Blue evil eye dream catcher with feathers and beads, showing precise size dimensions - Royal Blue Evil Eye
+13
Evil Eye Dreamcatcher Wall Hanging Handmade Feather Beads Boho Ornament Home Decor For Bedroom Living Room
-5%
$3.43-4.80
No MOQ
 · 
24 sold recently
Free Shipping
Happy Diwali Wooden Sign Hanging Decoration Mandala Peacock Flower Printed Door Plaque Festival Home Decor Party Supplies
Happy Diwali Wooden Sign Hanging Decoration Mandala Peacock Flower Printed Door Plaque Festival Home Decor Party Supplies
like
Find Similar
Deep purple and blue Diwali mandala wooden hanging plaque with Happy Diwali greeting - Mandala Style Diwali
28cm Happy Diwali round wooden sign with peacock and diya patterns for home decoration - Peacock Style Diwali
Happy Diwali round wooden door sign with marigold flowers and diya lamp, 42cm total height - Marigold Style Diwali
Happy Diwali Wooden Sign Hanging Decoration Mandala Peacock Flower Printed Door Plaque Festival Home Decor Party Supplies
$1.87
Mix MOQ : 50
Cartoon Animal Mythical Creature Resin Figure Translucent Sparkling Desktop Decoration Cute Surprise Toy Gift
Cartoon Animal Mythical Creature Resin Figure Translucent Sparkling Desktop Decoration Cute Surprise Toy Gift
like
Find Similar
Nine-tailed fox cat action figure series with 6 regular styles and 1 hidden version - -483 Dreamy Mountain And Sea Spirit Fox Box 6 / Full Box Set
Collectible Nine-Tailed Fox incense burner figurines in assorted pastel colors - Shanhai Nine-Tailed Fox Incense Burner / Whole Set (6pcs)
Nine-Tailed Fox fairy figure set with 12 regular and 2 hidden resin mystery box styles - A150 Ten Miles Of Peach Blossoms Nine-tailed Fox Mini Box 12 / Full Box Set
Nine-tailed fox art toy blind box figures made of resin in various colors and styles - 0312 Fox Bell Story Box 8 / Full Box Set
+92
Cartoon Animal Mythical Creature Resin Figure Translucent Sparkling Desktop Decoration Cute Surprise Toy Gift
-5%
$1.64-40.57
No MOQ
 · 
41 views
Mediterranean Style Wooden Nautical Hanging Ornament Boxwood Laser Cut Starfish Octopus Seahorse Wall Decor For Home Party
Mediterranean Style Wooden Nautical Hanging Ornament Boxwood Laser Cut Starfish Octopus Seahorse Wall Decor For Home Party
like
Find Similar
Close-up of ocean-themed wooden wall decor with sea stars and fish in dual blue tones - Round Hollow Style / Starfish
Blue wooden octopus hanging ornament with starfish and shells in nautical beach theme - Round Hollow Style / Octopus
Detail of wooden sea horse wall hanging featuring laser-cut double layer design - Round Hollow Style / Seahorse
Marine shark wooden wall hanging decor with layered blue design and hemp rope - Round Hollow Style / Shark
+1
Mediterranean Style Wooden Nautical Hanging Ornament Boxwood Laser Cut Starfish Octopus Seahorse Wall Decor For Home Party
$1.33-1.70
Mix MOQ : 2
Happy Diwali Wooden Hanging Sign Mandala Peacock Marigold Garland Traditional Indian Festival Home Party Door Decoration Wood Plaque
Happy Diwali Wooden Hanging Sign Mandala Peacock Marigold Garland Traditional Indian Festival Home Party Door Decoration Wood Plaque
like
Find Similar
Deep purple and blue Diwali mandala wooden hanging plaque with Happy Diwali greeting - Mandala Flower Style
28cm Happy Diwali round wooden sign with peacock and diya patterns for home decoration - Peacock Oil Lamp Style
Happy Diwali round wooden door sign with marigold flowers and diya lamp, 42cm total height - Marigold Garland Style
Happy Diwali Wooden Hanging Sign Mandala Peacock Marigold Garland Traditional Indian Festival Home Party Door Decoration Wood Plaque
-3%
$1.81
Mix MOQ : 50
Bohemian Handmade Moon Dream Catcher Purple Black Feather Wall Hanging Decor For Bedroom Living Room Home Ornament Gift
Bohemian Handmade Moon Dream Catcher Purple Black Feather Wall Hanging Decor For Bedroom Living Room Home Ornament Gift
like
Find Similar
Bohemian moon dream catcher with purple and black feathers for bedroom wall decor - Mysterious Moon Finished Style
Bohemian moon dreamcatcher with purple and black feathers and LED string lights - Mysterious Moon Finished Style (With LED Light)
Bohemian Handmade Moon Dream Catcher Purple Black Feather Wall Hanging Decor For Bedroom Living Room Home Ornament Gift
$3.31-4.03
Mix MOQ : 2
 · 
13 views
Miniature Fairy Door Elf Gate Wooden Resin Garden Tree Decoration Outdoor Ornament Sculpture For Yard Patio Magical Style
Miniature Fairy Door Elf Gate Wooden Resin Garden Tree Decoration Outdoor Ornament Sculpture For Yard Patio Magical Style
like
Find Similar
Miniature blue fairy door with white flowers and red mushrooms for garden decor - 3D Fairy Door 1 (Resin)
Miniature gray stone arch fairy door with red wooden panel and golden window frame - 3D Fairy Door 3 (Resin)
Green wooden fairy garden door with Celtic knots and beige braided arch decoration - 3D Fairy Door 4 (Resin)
Pink wooden fairy door decoration with heart cutout and black hardware for garden tree - 3D Fairy Door 5 (Wood)
+11
Miniature Fairy Door Elf Gate Wooden Resin Garden Tree Decoration Outdoor Ornament Sculpture For Yard Patio Magical Style
$1.44
Mix MOQ : 2
 · 
506 sold recently
Top 5% Best Sellers
in Home Decor
Free Shipping
Nine Tailed Fox Fairy Mystery Box Resin Ornament Tabletop Decor Mythological Statues Guochao Style Collectible
Nine Tailed Fox Fairy Mystery Box Resin Ornament Tabletop Decor Mythological Statues Guochao Style Collectible
like
Find Similar
Cute Nine-tailed Fox resin figurine blind box set with pearlescent lotus base - -481 Good Fortune Nine-Tailed Fox (Set of 6) / Full Box Set
Nine-tailed fox art toy series including 6 regular styles and 1 hidden edition - A152 Kunlun Nine-tailed Fox Small Incense Burner Box 6 / Full Box Set
Kitsune blind box figure with glowing nine tails and white fox with crown variant - A147 Flower-like Nine-tailed Fox Box 6 / Full Box Set
Rotatable Shanhai Spirit Fox blind box collectible figures for desktop decoration - -483 Dreamy Mountain And Sea Spirit Fox Box 6 / Full Box Set
+104
Nine Tailed Fox Fairy Mystery Box Resin Ornament Tabletop Decor Mythological Statues Guochao Style Collectible
$1.73-42.71
No MOQ
 · 
63 views
Free Shipping
Miniature Bird Ornaments Resin Artificial Small Birds Bird Nest For Micro Landscape Fairy Garden Succulent Plants Decoration
Miniature Bird Ornaments Resin Artificial Small Birds Bird Nest For Micro Landscape Fairy Garden Succulent Plants Decoration
like
Find Similar
Miniature garden resin bird nest with three white eggs for succulent moss landscape - Three Eggs (excluding The Nest)
Miniature yellow bird resin figurine with blue wings for succulent garden decor - Yellow Bird
Miniature white and yellow resin bird figurine for succulent moss micro landscape - Purple Bird
Miniature resin bird figurine featuring white body and blue wings for garden decor - Pink Flamingo
+6
Miniature Bird Ornaments Resin Artificial Small Birds Bird Nest For Micro Landscape Fairy Garden Succulent Plants Decoration
$0.17
No MOQ
 · 
41 sold recently
Free Shipping
Cute Cat Blind Box Figurines Resin Desktop Ornaments Creative Animal Miniature Collectibles Home Office Decoration Gifts
Cute Cat Blind Box Figurines Resin Desktop Ornaments Creative Animal Miniature Collectibles Home Office Decoration Gifts
like
Find Similar
Hidden variant transparent pony figurine with Chinese lion dance motif and festive accents - -246 Fortune Malaysia Chinese New Year Set 6 / Full Box Set
Cute yellow Zodiac Horse blind box figurines with traditional Chinese lucky symbols on red base - HM199 Success Pig Series Set of 8 / Full Box Set
Artistic collection of 4 fortune god mini figurines on horses with traditional symbols - -92 Immediately Wealth God Set 4 / Full Box Set
Collectible fox blind box toy in red festive outfit with mahjong fortune base - -421 Happiness Plus Joyful Set 6 / Full Box Set
+84
Cute Cat Blind Box Figurines Resin Desktop Ornaments Creative Animal Miniature Collectibles Home Office Decoration Gifts
$7.49-28.79
No MOQ
 · 
50 views
Free Shipping
LED House Lantern Plastic Ribbed Warm Light Christmas Tree Hanging Ornament Festive Home Decoration Gift Crystal Look Lamp
LED House Lantern Plastic Ribbed Warm Light Christmas Tree Hanging Ornament Festive Home Decoration Gift Crystal Look Lamp
like
Find Similar
Macro detail of a mini LED Christmas lantern with warm light and prism textures - Crystal House Lantern (Crystal Lamp)
LED House Lantern Plastic Ribbed Warm Light Christmas Tree Hanging Ornament Festive Home Decoration Gift Crystal Look Lamp
$1.21
Mix MOQ : 2
 · 
11 views
Nordic Stained Glass Style Wood Bird Ornament Vintage Art Desk Decor Bird Figurines On Branch For Home Living Room Shelf
Nordic Stained Glass Style Wood Bird Ornament Vintage Art Desk Decor Bird Figurines On Branch For Home Living Room Shelf
like
Find Similar
Colorful stained glass bird ornament on black round stand for desktop home decoration - One Bird
Artistic bird figurine with colorful glass-style design on a black branch base - Two Birds
Colorful birds on branch desk ornament with sturdy black base for home decor - Five Birds
Nordic Stained Glass Style Wood Bird Ornament Vintage Art Desk Decor Bird Figurines On Branch For Home Living Room Shelf
-5%
$1.29-2.59
No MOQ
 · 
26 views
Go to

More in home & kitchen

Explore more in dragon decor

homewallroomkidshandmadepartyshapestarsholderhollow
alloystyledesktopmetaldiydailyeyemakingsilvertassels

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access