Everful

Wholesale dragon decor

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Dragon Decor

Find the perfect pieces: home decor accents & accessories, artificial decorations, artificial flowers and more

CarPets, Floor Mats & Protectants

All products in dragon decor

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Halloween Pumpkin Castle Bat Window Stickers PVC Cartoon Moon Wall Decals For Festive Home Party Decoration Living Room
Halloween Pumpkin Castle Bat Window Stickers PVC Cartoon Moon Wall Decals For Festive Home Party Decoration Living Room
like
Find Similar
Size diagram showing Halloween wall decals with pumpkin castle and bat dimensions - 29x90cm
Halloween Pumpkin Castle Bat Window Stickers PVC Cartoon Moon Wall Decals For Festive Home Party Decoration Living Room
$2.02
No MOQ
Handmade Halloween Witch Broom Decor Black Lace Alloy Charm Vintage Gothic Miniature Broom Ornament Home Festival Decor
Handmade Halloween Witch Broom Decor Black Lace Alloy Charm Vintage Gothic Miniature Broom Ornament Home Festival Decor
like
Find Similar
Handmade witch broom with black lace bow and natural twigs on a stone for gothic decor - Broom With Black Lace
Handmade decorative small broom with lace, moon pendant and white gemstone inlay - Broom With Moon Crystal
Handmade Halloween Witch Broom Decor Black Lace Alloy Charm Vintage Gothic Miniature Broom Ornament Home Festival Decor
$2.85
No MOQ
 · 
10 views
Halloween Bat Dreamcatcher Wind Chime Hanging Decoration Gothic Acrylic Agate Stone Ornament With Bell For Home Party Decor
Halloween Bat Dreamcatcher Wind Chime Hanging Decoration Gothic Acrylic Agate Stone Ornament With Bell For Home Party Decor
like
Find Similar
1 option
Halloween Bat Dreamcatcher Wind Chime Hanging Decoration Gothic Acrylic Agate Stone Ornament With Bell For Home Party Decor
$14.12
No MOQ
Free Shipping
Knitted Gingerbread Man Christmas Tree Hanging Ornaments Gingerbread Doll With Hat For Christmas Party Home Decor
Knitted Gingerbread Man Christmas Tree Hanging Ornaments Gingerbread Doll With Hat For Christmas Party Home Decor
like
Find Similar
Knitted gingerbread man Christmas ornament with chef hat and bow tie hanging on branch - Male Gingerbread Man Ornament (Chef Hat)
Handcrafted gingerbread man knit ornament with red green hat on white branch - Female Gingerbread Man Ornament (Christmas Hat)
Knitted Gingerbread Man Christmas Tree Hanging Ornaments Gingerbread Doll With Hat For Christmas Party Home Decor
$2.36
No MOQ
Christmas Wreath Santa Snowman Reindeer Doll Rattan Vine Ring Merry Christmas Banner Home Wall Hanging Xmas Party Decor
Christmas Wreath Santa Snowman Reindeer Doll Rattan Vine Ring Merry Christmas Banner Home Wall Hanging Xmas Party Decor
like
Find Similar
Detail of Christmas wreath featuring Santa doll, red berries and festive pine on wood - Small-Santa Claus
Close-up of a rustic Christmas wreath featuring a cute snowman doll with red berries and pine - Small-Snowman
Detail of Christmas wreath with plush reindeer, red berries and festive plaid bow - Small-Reindeer
Christmas wreath with Santa doll and Merry Christmas banner on a vine ring base - Large-Santa Claus
+2
NewChristmas Wreath Santa Snowman Reindeer Doll Rattan Vine Ring Merry Christmas Banner Home Wall Hanging Xmas Party Decor
-5%
$3.50-6.16
No MOQ
Halloween Foil Fringe Curtain Black Orange Tinsel Curtain For Party Decoration Photo Backdrop Spooky Venue Decor
Halloween Foil Fringe Curtain Black Orange Tinsel Curtain For Party Decoration Photo Backdrop Spooky Venue Decor
like
Find Similar
Detail of glossy black Halloween foil fringe curtain wrapped on a white cardboard spool - Black Fringe Curtain
Shiny orange Halloween foil fringe curtain backdrop for festive party decorations - Orange Fringe Curtain
Halloween Foil Fringe Curtain Black Orange Tinsel Curtain For Party Decoration Photo Backdrop Spooky Venue Decor
$0.52
Mix MOQ : 2
Halloween Spooky Bat Foil Fringe Curtain Spooky Orange Purple Black Bat Pattern Tinsel Backdrop For Party Decoration
Halloween Spooky Bat Foil Fringe Curtain Spooky Orange Purple Black Bat Pattern Tinsel Backdrop For Party Decoration
like
Find Similar
Halloween foil curtain featuring purple, black, and orange bat cutouts, size 1x2m - Orange Purple Black Bat (1*2m)
Halloween bat tinsel curtain background in purple and black, 1x2m party wall decoration - Purple Black Rose Red Bat (1*2m)
NewHalloween Spooky Bat Foil Fringe Curtain Spooky Orange Purple Black Bat Pattern Tinsel Backdrop For Party Decoration
-5%
$1.64
Mix MOQ : 2
Christmas Reindeer Hanging Ornament Plush Wooden Reindeer With Red Scarf For Xmas Tree Decor Home Party Festive Pendant
Christmas Reindeer Hanging Ornament Plush Wooden Reindeer With Red Scarf For Xmas Tree Decor Home Party Festive Pendant
like
Find Similar
Detailed size chart for Christmas plush reindeer ornament with red scarf and wooden accents - White Elk with Red Scarf
Detail of plush reindeer Christmas ornament with red knit scarf and wooden beads - Pink Elk with Red Scarf
Christmas Reindeer Hanging Ornament Plush Wooden Reindeer With Red Scarf For Xmas Tree Decor Home Party Festive Pendant
-3%
$0.81
Mix MOQ : 2
Halloween Cupcake Wall Stickers Watercolor Pumpkin Bat Witch Hat Decals For Kitchen Dining Room Home Party Decoration
Halloween Cupcake Wall Stickers Watercolor Pumpkin Bat Witch Hat Decals For Kitchen Dining Room Home Party Decoration
like
Find Similar
Detail showing 30cm x 60cm Halloween cupcake wall sticker layout with MG-B017 dimensions - Model MG-B017
Halloween Cupcake Wall Stickers Watercolor Pumpkin Bat Witch Hat Decals For Kitchen Dining Room Home Party Decoration
$1.21
No MOQ
Halloween Tinsel Curtain Orange Purple Black Party Backdrop Metallic Foil Fringe Door Curtain For Halloween Decoration
Halloween Tinsel Curtain Orange Purple Black Party Backdrop Metallic Foil Fringe Door Curtain For Halloween Decoration
like
Find Similar
Detailed view of 1x2m orange purple black fringe curtain with size and weight specs - 1*2M Orange Purple Black Fringe Curtain
2.5m x 1m Halloween tinsel fringe curtain in orange, purple, and black party decoration - 1*2.5M Orange Purple Black Fringe Curtain
Halloween Tinsel Curtain Orange Purple Black Party Backdrop Metallic Foil Fringe Door Curtain For Halloween Decoration
$0.75-0.92
Mix MOQ : 2
3D Halloween Zombie Wall Decals Horror Undead Breaking Through Wall With Axe Removable PVC Mural For Home Party Decoration
3D Halloween Zombie Wall Decals Horror Undead Breaking Through Wall With Axe Removable PVC Mural For Home Party Decoration
like
Find Similar
3D zombie wall decal breaking through wall measuring 40x60cm for Halloween decor - Zombie Breaking Wall Side Pose (HY-E081) / 40x60cm
Detailed 60x40cm sheet size layout of the 3D zombie wall sticker with axe - Zombie Breaking Wall Front Holding Axe (HY-E082) / 40x60cm
3D Halloween wall decal of a zombie with axe breaking through wall, 60cm by 40cm layout - Zombie Breaking Wall Roaring Pose (HY-E083) / 40x60cm
3D Halloween Zombie Wall Decals Horror Undead Breaking Through Wall With Axe Removable PVC Mural For Home Party Decoration
$1.38
No MOQ
Halloween Witch Bat Wall Stickers PVC Removable Silhouette Wall Decals For Living Room Bedroom Festival Home Decor Art Mural
Halloween Witch Bat Wall Stickers PVC Removable Silhouette Wall Decals For Living Room Bedroom Festival Home Decor Art Mural
like
Find Similar
Halloween witch and bats wall sticker with layout and paste size dimensions - ZD766/30*60 (Without Bag)
NewHalloween Witch Bat Wall Stickers PVC Removable Silhouette Wall Decals For Living Room Bedroom Festival Home Decor Art Mural
$1.21
Mix MOQ : 4
Mini Resin Turtle Figurine Moss Micro Landscape Decor Miniature Animal Ornament For Fairy Garden Terrarium DIY Decoration
Mini Resin Turtle Figurine Moss Micro Landscape Decor Miniature Animal Ornament For Fairy Garden Terrarium DIY Decoration
like
Find Similar
Miniature resin turtle figurines for moss micro-landscapes and garden decor - Realistic Spotted Pattern / Coffee
Miniature resin turtle figurines for moss micro landscapes and flower pot decor - Warm Dual Tone Style / Orange
Mini Resin Turtle Figurine Moss Micro Landscape Decor Miniature Animal Ornament For Fairy Garden Terrarium DIY Decoration
$0.12
No MOQ
 · 
15 views
Christmas Tree Hanging Ornaments Cartoon Plush Santa Claus Snowman Reindeer Bear Metal Bell Pendants For Holiday Party Decor
Christmas Tree Hanging Ornaments Cartoon Plush Santa Claus Snowman Reindeer Bear Metal Bell Pendants For Holiday Party Decor
like
Find Similar
Christmas plush bear ornament with a large white metal bell and blue plaid hat decor - Bear White Bell
Christmas snowman plush ornament with a large golden metal bell and festive red bow - Snowman Golden Bell
Cute Santa Claus plush ornament with a red metal bell and star cutouts for Christmas - Santa Claus Red Bell
Plush Christmas bear ornament in red hat holding a golden star-cutout bell - Bear Golden Bell
+4
Christmas Tree Hanging Ornaments Cartoon Plush Santa Claus Snowman Reindeer Bear Metal Bell Pendants For Holiday Party Decor
-5%
$0.52
Mix MOQ : 4
Christmas Cartoon Stacking Animals PVC Wall Sticker Removable Self Adhesive Lion Cat Tiger Decal For Home Bedroom Decor
Christmas Cartoon Stacking Animals PVC Wall Sticker Removable Self Adhesive Lion Cat Tiger Decal For Home Bedroom Decor
like
Find Similar
Detail view showing dimensions of Christmas cat and lion wall sticker for home decor - Stacking Animals Style (HY-H018)
Christmas Cartoon Stacking Animals PVC Wall Sticker Removable Self Adhesive Lion Cat Tiger Decal For Home Bedroom Decor
$1.59
No MOQ
Halloween Wall Sticker Watercolor Pumpkin Skeleton Wizard Owl Bat Scarecrow Removable PVC Holiday Decal Living Room Decor
Halloween Wall Sticker Watercolor Pumpkin Skeleton Wizard Owl Bat Scarecrow Removable PVC Holiday Decal Living Room Decor
like
Find Similar
Detailed sheet size for Halloween wall decals featuring pumpkins, ghosts and skulls - Illustration Style (KSW-25)
Halloween Wall Sticker Watercolor Pumpkin Skeleton Wizard Owl Bat Scarecrow Removable PVC Holiday Decal Living Room Decor
$1.30
No MOQ
Halloween Mummy Dinosaur Wall Sticker Cartoon T-Rex Skeleton Holding Pumpkin Basket PVC Self-Adhesive Decal For Kids Room Decor
Halloween Mummy Dinosaur Wall Sticker Cartoon T-Rex Skeleton Holding Pumpkin Basket PVC Self-Adhesive Decal For Kids Room Decor
like
Find Similar
Cartoon skeleton dinosaur Halloween wall sticker size guide 60cm x 40cm dimensions - 40*60cm(fun-e106)
Halloween Mummy Dinosaur Wall Sticker Cartoon T-Rex Skeleton Holding Pumpkin Basket PVC Self-Adhesive Decal For Kids Room Decor
$1.44
No MOQ
Gothic Halloween Skeleton Hanging Garland Decoration With Rose Butterfly Star Paper Banner For Party Home Wall Decor
Gothic Halloween Skeleton Hanging Garland Decoration With Rose Butterfly Star Paper Banner For Party Home Wall Decor
like
Find Similar
Detailed size chart for Halloween skeleton skull hanging ornaments with dimensions - Gothic Skeleton Style
Gothic Halloween Skeleton Hanging Garland Decoration With Rose Butterfly Star Paper Banner For Party Home Wall Decor
$2.31
No MOQ
Christmas Hot Air Balloon Hanging Ornament Iron Painted Santa Claus Reindeer Snowman Star Pattern Christmas Tree Home Decor
Christmas Hot Air Balloon Hanging Ornament Iron Painted Santa Claus Reindeer Snowman Star Pattern Christmas Tree Home Decor
like
Find Similar
Christmas Santa Claus in red hot air balloon ornament for holiday scene decoration - Santa Claus
Christmas reindeer metal parachute ornament in classic red and green festive colors - Elk
Christmas snowman hanging ornament in red and white hot air balloon for holiday decor - Snowman
Christmas Hot Air Balloon Hanging Ornament Iron Painted Santa Claus Reindeer Snowman Star Pattern Christmas Tree Home Decor
$4.55
Mix MOQ : 2
Halloween Large Mesh Bow Hanging Decoration With LED Lights Silver Skull Print Gothic Party Decor For Indoor Outdoor Wall
Halloween Large Mesh Bow Hanging Decoration With LED Lights Silver Skull Print Gothic Party Decor For Indoor Outdoor Wall
like
Find Similar
Black mesh Halloween bow with LED lights for festive atmosphere, 37.5cm decorative size - Halloween Bow Style A (Multi-color LED)
Detail of Halloween black lace bow with colorful LED lights and measurement markers - Halloween Bow Style B (Multi-color LED)
Macro shot of Halloween LED mesh bow showing 38x23.5cm dimensions and silver skull patterns - Halloween Bow Style C (Warm LED)
Close-up of black gauze Halloween bow with skull patterns and integrated LED lights - Halloween Bow Style D (Multi-color LED)
+1
Halloween Large Mesh Bow Hanging Decoration With LED Lights Silver Skull Print Gothic Party Decor For Indoor Outdoor Wall
-3%
$1.67
Mix MOQ : 2
Large Colorful Imitation Hemp Bow Holiday Party Decoration Multi-Layer Ribbon Hanging Ornament For Easter Birthday DIY Crafts
Large Colorful Imitation Hemp Bow Holiday Party Decoration Multi-Layer Ribbon Hanging Ornament For Easter Birthday DIY Crafts
like
Find Similar
Light blue faux burlap bow decoration with measurements 50.5x22.5cm for festive wreaths - 9-Loop Bow / Blue
Pink burlap bow ornament 50.5cm height with long ribbons for party DIY decor - 9-Loop Bow / Pink
Yellow burlap Christmas bow dimensions showing 19.88 inch length and 8.86 inch width - 9-Loop Bow / Yellow
Large light green faux linen Christmas bow ornament for tree and holiday decoration - 9-Loop Bow / Green
+1
Large Colorful Imitation Hemp Bow Holiday Party Decoration Multi-Layer Ribbon Hanging Ornament For Easter Birthday DIY Crafts
-5%
$1.04
Mix MOQ : 50
Halloween LED Glowing Mesh Ribbon Double Layer Hot Stamping Skeleton Pumpkin Spider Web Decorative Ribbon For Party Home Decor
Halloween LED Glowing Mesh Ribbon Double Layer Hot Stamping Skeleton Pumpkin Spider Web Decorative Ribbon For Party Home Decor
like
Find Similar
Halloween LED glowing ribbon with spider web and pumpkin patterns on mesh fabric - Bronzing Silver Pumpkin Spider Web Style / Without Lights / Silver (Long)
Halloween black mesh ribbon with pumpkin and spider web prints for festive party decor - 2M-Black Pumpkin Spider Web (No Light)
Halloween black mesh ribbon with silver skull prints and integrated LED lights for party decor - 2M-Silver Skull Ribbon (No Light)
Halloween black mesh ribbon with skull pattern for party decoration and DIY crafting - 2M-Black Skull Ribbon (No Light)
+28
Halloween LED Glowing Mesh Ribbon Double Layer Hot Stamping Skeleton Pumpkin Spider Web Decorative Ribbon For Party Home Decor
-5%
$1.04-5.20
Mix MOQ : 2
Free Shipping
Hand Carved Basswood Snake Ornament Cow Dinosaur Costume Figurine Year Of Snake Desktop Car Decor Cartoon Mascot
Hand Carved Basswood Snake Ornament Cow Dinosaur Costume Figurine Year Of Snake Desktop Car Decor Cartoon Mascot
like
Find Similar
Detailed close-up of a green dinosaur-themed wooden carved figurine on a vintage book - Dinosaur Style (Social Phobia)
Detailed view of a cute cow-costume wooden figurine on a French book cover - Cow Style (Social Butterfly)
Hand Carved Basswood Snake Ornament Cow Dinosaur Costume Figurine Year Of Snake Desktop Car Decor Cartoon Mascot
-4%
$9.29
No MOQ
Free Shipping
Modern 3D Hollow Pearlescent Paper Butterfly Wall Stickers For Home Decor Bedroom Living Room Wedding Party Wall Art Decoration
Modern 3D Hollow Pearlescent Paper Butterfly Wall Stickers For Home Decor Bedroom Living Room Wedding Party Wall Art Decoration
like
Find Similar
3D hollow pearl paper butterfly wall stickers in assorted colors for home party decoration - Mixed Colors
3D purple pearlescent paper butterflies with hollow laser-cut design for wall decor - Light Purple
Light blue 3D hollow butterfly wall stickers with elegant pearlescent floral patterns - Light Blue
Detailed 3D pink hollowed paper butterflies decoration with intricate laser-cut patterns - Rose Red
+5
NewModern 3D Hollow Pearlescent Paper Butterfly Wall Stickers For Home Decor Bedroom Living Room Wedding Party Wall Art Decoration
-12%
$0.71
No MOQ
Autumn Eucalyptus Pumpkin Wreath For Fall Harvest Front Door Thanksgiving Halloween Handmade Floral Berry Decor
Autumn Eucalyptus Pumpkin Wreath For Fall Harvest Front Door Thanksgiving Halloween Handmade Floral Berry Decor
like
Find Similar
Autumn eucalyptus wreath with white pumpkins and purple peonies on a bamboo fence - Colored Pumpkin Style
Autumn Eucalyptus Pumpkin Wreath For Fall Harvest Front Door Thanksgiving Halloween Handmade Floral Berry Decor
$8.65
Mix MOQ : 2
 · 
20 views
Gothic Halloween Wall Stickers Skull Tombstone Red Rose Bat PVC Removable Decal For Living Room Bedroom Party Home Decor
Gothic Halloween Wall Stickers Skull Tombstone Red Rose Bat PVC Removable Decal For Living Room Bedroom Party Home Decor
like
Find Similar
Detail of Halloween wall sticker showing skull, roses and tombstone layout dimensions - 29x90cm
Gothic Halloween Wall Stickers Skull Tombstone Red Rose Bat PVC Removable Decal For Living Room Bedroom Party Home Decor
$1.44
No MOQ
Halloween Party Decorations Paper Banner Cake Toppers Swirl Decorations For Bar Haunted House Ghost Pumpkin Party Decor
Halloween Party Decorations Paper Banner Cake Toppers Swirl Decorations For Bar Haunted House Ghost Pumpkin Party Decor
like
Find Similar
Detailed Happy Halloween banner with scary illustrations and precise size measurements - Banner
Halloween party cake toppers set featuring spooky castle banners and themed icons - Cake Toppers
6-pack Halloween hanging swirls with metallic PVC coils and colorful cartoon card pendants - Double Sided Hanging Swirls
Halloween Party Decorations Paper Banner Cake Toppers Swirl Decorations For Bar Haunted House Ghost Pumpkin Party Decor
$0.81-0.92
Mix MOQ : 2
3D Halloween Wall Sticker Broken Wall Zombie Hand Moon Graveyard PVC Scary Wall Decal For Living Room Bedroom Party Decor
3D Halloween Wall Sticker Broken Wall Zombie Hand Moon Graveyard PVC Scary Wall Decal For Living Room Bedroom Party Decor
like
Find Similar
Size specifications for 3D Halloween broken wall sticker with zombie hand and moon - Halloween 3D Broken Wall Style (MG-E036) / 40x60cm
3D Halloween Wall Sticker Broken Wall Zombie Hand Moon Graveyard PVC Scary Wall Decal For Living Room Bedroom Party Decor
$1.44
No MOQ
Pink Christmas Gnome Ornaments Sequin Santa Snowman Reindeer Plush Sitting Dolls For Home Window Holiday Party Decoration
Pink Christmas Gnome Ornaments Sequin Santa Snowman Reindeer Plush Sitting Dolls For Home Window Holiday Party Decoration
like
Find Similar
Pink Christmas gnome figurine with sparkling sequins and white beard on wood base - Pink Standing Santa Gnome
Pink sequined Christmas snowman figurine with plush scarf on a round wooden base - Pink Standing Snowman
Pink plush Christmas reindeer ornament with gold sequins and pink knit scarf on wooden base - Pink Standing Reindeer
Pink Christmas Gnome Ornaments Sequin Santa Snowman Reindeer Plush Sitting Dolls For Home Window Holiday Party Decoration
$3.60
Mix MOQ : 2
Halloween Bat Foil Fringe Curtain Metallic PET Bat Streamers Backdrop For Haunted House Party Door Wall Decor
Halloween Bat Foil Fringe Curtain Metallic PET Bat Streamers Backdrop For Haunted House Party Door Wall Decor
like
Find Similar
Red bat-shaped foil fringe curtain for Halloween party decoration on white background - Red / 100x200cm
Golden bat-shaped foil fringe curtain for Halloween and festive party wall decorations - Gold / 100x200cm
Pink bat foil fringe curtain for Halloween party decor with hollow cutout design - Rose Red / 100x200cm
Light pink bat-shaped foil fringe curtain for Halloween party decoration with smiley cutouts - Rose Gold / 100x200cm
+5
Halloween Bat Foil Fringe Curtain Metallic PET Bat Streamers Backdrop For Haunted House Party Door Wall Decor
$1.67
No MOQ
Swedish Dala Horse Wooden Hand Painted Nordic Style Desktop Ornament Colorful Folk Art Home Decor Animal Figurine
Swedish Dala Horse Wooden Hand Painted Nordic Style Desktop Ornament Colorful Folk Art Home Decor Animal Figurine
like
Find Similar
Set of two red Dala Horse decorative figurines with Nordic folk art patterns - A Pair Of Red Wooden Horses
Set of two green wooden Dala horses with traditional hand-painted floral folk patterns - A Pair Of Green Rocking Horses
Traditional 16cm red Dala horse wooden figurine with floral hand-painted details - Red Horse Trumpet
Red wooden Dala Horse statue for home decor, large 24cm size, traditional Swedish style - Red Horse Large
Swedish Dala Horse Wooden Hand Painted Nordic Style Desktop Ornament Colorful Folk Art Home Decor Animal Figurine
-5%
$2.74-6.57
No MOQ
 · 
16 views
Black Bear Garden Statue Resin Sleeping Bear On Tree Branch With Beehive Bees Figurine Outdoor Yard Decor Ornament
Black Bear Garden Statue Resin Sleeping Bear On Tree Branch With Beehive Bees Figurine Outdoor Yard Decor Ornament
like
Find Similar
Residue black bear sleeping on tree branch with bee and honeycomb garden ornament - Tree Branch Bear Hanging Ornament
Black Bear Garden Statue Resin Sleeping Bear On Tree Branch With Beehive Bees Figurine Outdoor Yard Decor Ornament
-11%
$4.84
No MOQ
 · 
14 sold recently
Wooden Christmas House Pendant Santa Snowman Reindeer Laser Cut Hollow Ornament For Xmas Tree Holiday Home Decoration
Wooden Christmas House Pendant Santa Snowman Reindeer Laser Cut Hollow Ornament For Xmas Tree Holiday Home Decoration
like
Find Similar
3 options
Wooden Christmas House Pendant Santa Snowman Reindeer Laser Cut Hollow Ornament For Xmas Tree Holiday Home Decoration
-4%
$0.69
No MOQ
Natural Crystal Resin Filling Horse Figurine Wealth Success Statue Home Office Desktop Decor Animal Sculpture Lucky Ornament Gift
Natural Crystal Resin Filling Horse Figurine Wealth Success Statue Home Office Desktop Decor Animal Sculpture Lucky Ornament Gift
like
Find Similar
Kneeling horse figurine made of clear resin with embedded natural crystal stones - White Crystal
Polished black resin horse sculpture in a reclining pose for home office decor - Obsidian
Pink natural crystal resin horse statue ornament with smooth stone texture finish - Rose Quartz
Running horse resin ornament with purple and white natural crystals for home decor - Dreamy Purple
+20
Natural Crystal Resin Filling Horse Figurine Wealth Success Statue Home Office Desktop Decor Animal Sculpture Lucky Ornament Gift
$4.84
Mix MOQ : 2
Handmade Wool Felt Mushroom Hanging Pendant Polka Dot Christmas Tree Ornament For Holiday Home Party Decor Christmas Gift
Handmade Wool Felt Mushroom Hanging Pendant Polka Dot Christmas Tree Ornament For Holiday Home Party Decor Christmas Gift
like
Find Similar
Red felt mushroom ornament with white polka dots for Christmas tree decoration, 7cm height - Red
Handmade pink plush mushroom ornament with white polka dots for Christmas tree decor - Pink
Handmade plush mushroom Christmas ornament in orange and white with a brown hanging loop - Brown
Handmade grey and white wool felt mushroom ornament with hanging string for Christmas tree - Gray
Handmade Wool Felt Mushroom Hanging Pendant Polka Dot Christmas Tree Ornament For Holiday Home Party Decor Christmas Gift
$1.15
No MOQ
Free Shipping
Miniature Warning Sign Plastic Cat Dog Vomit Caution No Smoking Novelty Desktop Decor Humor Gag Gift Funny Decoration
Miniature Warning Sign Plastic Cat Dog Vomit Caution No Smoking Novelty Desktop Decor Humor Gag Gift Funny Decoration
like
Find Similar
Mini red A-frame floor sign with white text A Little Sign To Say I Love You - Red Love Style (English)
Close-up of a yellow folding warning sign with No Smoking icon and bilingual text - Yellow No Smoking (Bilingual)
Detailed view of a yellow A-frame plastic No Smoking caution sign on white background - Yellow No Smoking (English Only)
+2
Miniature Warning Sign Plastic Cat Dog Vomit Caution No Smoking Novelty Desktop Decor Humor Gag Gift Funny Decoration
$0.32-60.52
Mix MOQ : 3
 · 
303 sold recently
Merry Christmas Letters Hanging Sign Glitter Powder Letter Ornament For Christmas Tree Decoration Festive Home Party Decor
Merry Christmas Letters Hanging Sign Glitter Powder Letter Ornament For Christmas Tree Decoration Festive Home Party Decor
like
Find Similar
Red glitter Merry Christmas sign hanging ornament for festive tree decoration 16cm - Red
Detail of Merry Christmas golden glitter ornament with precise product dimensions - Gold
Silver glitter Merry Christmas letter sign ornament with dimensions of 15cm x 9.5cm - Silver
Detailed dimension guide for white glitter Merry Christmas hanging ornament and tree decor - White
+1
Merry Christmas Letters Hanging Sign Glitter Powder Letter Ornament For Christmas Tree Decoration Festive Home Party Decor
$0.36
No MOQ
Easter Bunny Gnome Plush Doll Handmade Knitted Faceless Elf Figurine Spring Tabletop Home Decor For Easter Party Decorations
Easter Bunny Gnome Plush Doll Handmade Knitted Faceless Elf Figurine Spring Tabletop Home Decor For Easter Party Decorations
like
Find Similar
Pink knitted Easter gnome plush with bunny ears, small flower and carrot accents - Pink Faceless Bunny (L-FH06)
Easter gnome plush doll with green knitted hat, bunny ears and carrot decorations - Green Faceless Bunny (L-FH07)
Easter gnome plush in light blue with knitted bunny ear hat and carrot decoration - Blue Faceless Bunny (L-FH08)
Yellow knitted Easter gnome plush with bunny ears and a small carrot on a desk - Yellow Faceless Bunny (L-FH05)
Easter Bunny Gnome Plush Doll Handmade Knitted Faceless Elf Figurine Spring Tabletop Home Decor For Easter Party Decorations
$1.50
No MOQ
Christmas Gingerbread Man Gnome Plush Doll Rudolph Faceless Doll For Home Xmas Window Decor Christmas Ornament Gift
Christmas Gingerbread Man Gnome Plush Doll Rudolph Faceless Doll For Home Xmas Window Decor Christmas Ornament Gift
like
Find Similar
Charming Christmas gingerbread gnome plush with a tall pointed hat for holiday window display - Gingerbread Man Pointed Hat Long Beard (Male) / Male Style
Christmas Gingerbread Gnome plush with knitted hat and holly berry festive decorations - Gingerbread Man Pointed Hat Braided Pigtails (Female) / Female Style
Christmas Gingerbread Man Gnome Plush Doll Rudolph Faceless Doll For Home Xmas Window Decor Christmas Ornament Gift
$3.43
No MOQ
Hollow Star Hanging Decorations Glitter Cardstock Ornaments For Christmas New Year Birthday Party Ceiling Garland Gold Silver Blue Rose Gold Stars
Hollow Star Hanging Decorations Glitter Cardstock Ornaments For Christmas New Year Birthday Party Ceiling Garland Gold Silver Blue Rose Gold Stars
like
Find Similar
Golden glitter hanging paper star garland decorations for Christmas and New Year holiday parties - Gold
7-piece set of silver glitter hollow star ornaments with strings for festive party decor - Silver
Purple glitter hollow star paper garland hanging decor for Christmas and party decoration - Purple
Set of 7 rose gold hollow star ornaments with glitter finish for festive party decor - Rose Gold
+3
Hollow Star Hanging Decorations Glitter Cardstock Ornaments For Christmas New Year Birthday Party Ceiling Garland Gold Silver Blue Rose Gold Stars
$0.72
Mix MOQ : 2
Nordic Style Christmas Faceless Gnome Plush Doll Sequin Hat Ornament Pink Grey White Christmas Decor For Home Xmas Party
Nordic Style Christmas Faceless Gnome Plush Doll Sequin Hat Ornament Pink Grey White Christmas Decor For Home Xmas Party
like
Find Similar
Nordic Christmas gnome plush doll in light pink and white with sequins and snow trees - Short-Legged Pink Gnome
Nordic Christmas gnome with gray sequined knit hat and soft white beard festive decor - Short-Legged Gray Gnome
Nordic white Christmas gnome plush with sequined pointed hat and long faux fur beard - Short-Legged Off-White Gnome
Nordic Style Christmas Faceless Gnome Plush Doll Sequin Hat Ornament Pink Grey White Christmas Decor For Home Xmas Party
-4%
$2.74
Mix MOQ : 2
Christmas Elf Legs Tree Skirt Decorations Red Green Striped Hanging Ornament For Xmas Party Holiday Car Trunk Decor
Christmas Elf Legs Tree Skirt Decorations Red Green Striped Hanging Ornament For Xmas Party Holiday Car Trunk Decor
like
Find Similar
Christmas elf leg hanging ornament in red and black plush for holiday decoration - Car Elf Feet Style B
Christmas Elf Legs Tree Skirt Decorations Red Green Striped Hanging Ornament For Xmas Party Holiday Car Trunk Decor
-5%
$3.56
Mix MOQ : 2
Halloween Horror 3D Zombie Wall Sticker Broken Wall Effect PVC Decal For Haunted House Living Room Party Decoration
Halloween Horror 3D Zombie Wall Sticker Broken Wall Effect PVC Decal For Haunted House Living Room Party Decoration
like
Find Similar
Detail showing the 50x40cm 3D zombie wall decal dimensions and product size specs - Zombie Broken Wall Style (MG-F067)
Halloween Horror 3D Zombie Wall Sticker Broken Wall Effect PVC Decal For Haunted House Living Room Party Decoration
$1.21
No MOQ
3D Simulation Butterfly Wall Stickers PVC Waterproof Magnetic Aesthetic Room Decor For Living Room Bedroom Kids Room
3D Simulation Butterfly Wall Stickers PVC Waterproof Magnetic Aesthetic Room Decor For Living Room Bedroom Kids Room
like
Find Similar
Set of 12 yellow 3D butterfly wall stickers with realistic patterns for home wall decor - Yellow
Set of 12 colorful 3D butterfly wall stickers with realistic wings on white background - Purple
Set of 12 green 3D butterfly wall stickers with realistic textures for home wall decor - Green
Set of 12 blue 3D butterfly wall stickers with realistic patterns for home wall decoration - Blue
New3D Simulation Butterfly Wall Stickers PVC Waterproof Magnetic Aesthetic Room Decor For Living Room Bedroom Kids Room
$0.92
No MOQ
Owl Figurine Crystal Crushed Stone Resin Animal Statue For Home Office Desk Tabletop Healing Gemstone Ornament Small Gift
Owl Figurine Crystal Crushed Stone Resin Animal Statue For Home Office Desk Tabletop Healing Gemstone Ornament Small Gift
like
Find Similar
Cute purple crystal owl figurine made of translucent resin with sparkling texture - 01 Amethyst + Colorful Sequins
Colorful resin owl figurine with natural crystal stone inclusions for desk decor - 02 Colorful Shell
Cute owl owl figurine made of natural tiger eye crystal resin stone on white background - 03 Tiger Eye
Blue natural crystal owl resin figurine ornament for desktop or home office decor - 04 Lapis Lazuli
+9
Owl Figurine Crystal Crushed Stone Resin Animal Statue For Home Office Desk Tabletop Healing Gemstone Ornament Small Gift
-4%
$0.41
No MOQ
 · 
351 sold recently
Christmas Standing Doll Santa Claus Snowman Reindeer Plush Ornament Burlap Plaid Design Home Festive Holiday Decoration
Christmas Standing Doll Santa Claus Snowman Reindeer Plush Ornament Burlap Plaid Design Home Festive Holiday Decoration
like
Find Similar
3 options
Christmas Standing Doll Santa Claus Snowman Reindeer Plush Ornament Burlap Plaid Design Home Festive Holiday Decoration
$2.97
Mix MOQ : 2
Christmas Feather Angel Doll Standing Ornaments With Sequin Hat Plush Wings For Tree Tabletop Holiday Home Party Decor
Christmas Feather Angel Doll Standing Ornaments With Sequin Hat Plush Wings For Tree Tabletop Holiday Home Party Decor
like
Find Similar
Detail view of angel ornament with white feathers and gold heart for Christmas tree decor - White Feather Standing Angel
Detail of Christmas angel tree topper with pink feather skirt and golden glitter accents - Pink Feather Standing Angel
Detail of Christmas angel ornament featuring silver sequin hat and white feather wings - Gray Feather Standing Angel
Christmas Feather Angel Doll Standing Ornaments With Sequin Hat Plush Wings For Tree Tabletop Holiday Home Party Decor
-5%
$2.46
No MOQ
Cute Cartoon Panda Miniature Resin Ornament Desktop Car Figurine Animal Decor Lotus Leaf Raincoat Bamboo Shoot Yellow Hat
Cute Cartoon Panda Miniature Resin Ornament Desktop Car Figurine Animal Decor Lotus Leaf Raincoat Bamboo Shoot Yellow Hat
like
Find Similar
Cute resin panda figurine wearing a green lotus leaf hat on natural stone decor - Lotus Leaf Panda
Detail of cartoon panda resin craft with yellow sun hat on a green leafy background - Yellow Hat Panda
Cute panda in bamboo shoot resin figurine for desktop micro landscape decoration - Panda with Bamboo Shoot
Cute panda in yellow duck costume figurine on pebble with green leaves background - Raincoat Panda
Cute Cartoon Panda Miniature Resin Ornament Desktop Car Figurine Animal Decor Lotus Leaf Raincoat Bamboo Shoot Yellow Hat
$1.44
Mix MOQ : 2
3D Fake Window Floral Wall Stickers PVC Removable Botanical Butterfly Cat Mural For Living Room Bedroom Background Home Decor
3D Fake Window Floral Wall Stickers PVC Removable Botanical Butterfly Cat Mural For Living Room Bedroom Background Home Decor
like
Find Similar
Size chart for 3D faux window wall sticker with floral butterfly motif 60x30cm - Blue Window Flower Butterfly (MS7129)
Size guide for creative 3D window wall sticker with floral and butterfly decals - Pink Window Flower Butterfly (MS7130)
Watercolor arched window flower wall sticker set with plant pots and butterfly decals - Blue Shutter Window Rose (MS7646)
3D window wall sticker with cat and flower pattern including size measurement details - Orange Cat Wooden Window Landscape (MS9010)
+1
3D Fake Window Floral Wall Stickers PVC Removable Botanical Butterfly Cat Mural For Living Room Bedroom Background Home Decor
$1.82-2.10
Mix MOQ : 2
Halloween Witch Doll Pumpkin Tabletop Decoration Broom Ghost Star Wizard Ornament For Home Party Desk Holiday Decor
Halloween Witch Doll Pumpkin Tabletop Decoration Broom Ghost Star Wizard Ornament For Home Party Desk Holiday Decor
like
Find Similar
Halloween witch doll with red hair and pumpkin base for festive tabletop decoration - Star Witch
Halloween plush witch doll with pink braids and ghost in a bright orange pumpkin base - Ghost Witch
Halloween Witch Doll Pumpkin Tabletop Decoration Broom Ghost Star Wizard Ornament For Home Party Desk Holiday Decor
$3.03
Mix MOQ : 2
Pink Christmas Plush Dolls Sequin Reindeer Snowman Santa Claus Ornaments Nordic Style Xmas Home Window Display Figurines
Pink Christmas Plush Dolls Sequin Reindeer Snowman Santa Claus Ornaments Nordic Style Xmas Home Window Display Figurines
like
Find Similar
Plush pink Christmas reindeer doll with gold antlers and sequin hat decoration - Pink Reindeer Doll
Pink sequin Christmas gnome plush doll with measurements 23cm height and 15cm width - Pink Santa Claus Doll
Pink Christmas snowman plush doll with sequins and knitted scarf for holiday decor - Pink Snowman Doll
Pink Christmas Plush Dolls Sequin Reindeer Snowman Santa Claus Ornaments Nordic Style Xmas Home Window Display Figurines
-5%
$3.56
Mix MOQ : 2
Halloween Witch Bat Wall Stickers PVC Removable Silhouette Decals For Living Room Bedroom Home Atmosphere Decoration
Halloween Witch Bat Wall Stickers PVC Removable Silhouette Decals For Living Room Bedroom Home Atmosphere Decoration
like
Find Similar
Detailed size chart for Halloween witch and bat wall stickers with layout and dimensions - Witch Bat Casting Magic Style (fun-c118)
Halloween Witch Bat Wall Stickers PVC Removable Silhouette Decals For Living Room Bedroom Home Atmosphere Decoration
$2.02
No MOQ
Creative Middle Finger Duck Resin Ornament Funny Humorous Rude Gesture Goose Figurine Desk Decor Home Office Decoration Gift
Creative Middle Finger Duck Resin Ornament Funny Humorous Rude Gesture Goose Figurine Desk Decor Home Office Decoration Gift
like
Find Similar
Creative resin white duck figurine with middle finger gesture for quirky home office decor - White
Funny duck resin figurine with middle finger gesture for creative desk decor - Yellow
Creative Middle Finger Duck Resin Ornament Funny Humorous Rude Gesture Goose Figurine Desk Decor Home Office Decoration Gift
$3.11
No MOQ
US Independence Day Gnome Patriotic Plush July 4th Decorations Stars And Stripes American Flag Faceless Doll Ornament For Home Party
US Independence Day Gnome Patriotic Plush July 4th Decorations Stars And Stripes American Flag Faceless Doll Ornament For Home Party
like
Find Similar
Patriotic Independence Day gnome plush with red striped hat and blue denim body - Blue Male Style
Denim fabric 4th of July gnome with red star and white braids on white background - Blue Female Style
Patriotic 4th of July faceless gnome with American flag stars and stripes hat - Red Male Santa Claus
Patriotic Independence Day gnome plush with red-white stripes and blue brim - Red Female Santa Claus
+1
US Independence Day Gnome Patriotic Plush July 4th Decorations Stars And Stripes American Flag Faceless Doll Ornament For Home Party
$2.85
No MOQ
Vintage Solid Brass Butterfly Figurine Ornament Antique Bronze Insect Statue For Home Office Desk Decor
Vintage Solid Brass Butterfly Figurine Ornament Antique Bronze Insect Statue For Home Office Desk Decor
like
Find Similar
Solid brass butterfly ornament with antique finish showing 30.2mm height and wings detail - Small Butterfly Ornament
Vintage Solid Brass Butterfly Figurine Ornament Antique Bronze Insect Statue For Home Office Desk Decor
-4%
$0.96
No MOQ
 · 
39 views
Free Shipping
Christmas Tree Hanging Pendants Plastic Gourd Ball Ornaments With Glitter Painted Festive Home Party Holiday Decoration
Christmas Tree Hanging Pendants Plastic Gourd Ball Ornaments With Glitter Painted Festive Home Party Holiday Decoration
like
Find Similar
Set of 3 silver grid pattern Christmas stocking ornaments for holiday tree decor - Sock Shape (Silver Grid Texture) / Silver Sock
Set of 6 red and white striped Christmas ball ornaments in a clear storage box - Red and White Striped Ball
Red and pink glitter Christmas ball gourd ornaments in clear box packaging - Glossy Red Gourd
Red and white gourd-shaped Christmas tree bauble ornaments in clear packaging box. - Matte Red Gourd
+77
Christmas Tree Hanging Pendants Plastic Gourd Ball Ornaments With Glitter Painted Festive Home Party Holiday Decoration
$1.44-3.11
No MOQ
Christmas Plush Doll Santa Claus Snowman Reindeer Figurine With Let It Snow Sign Embroidered Knitted Xmas Home Table Decor Gift
Christmas Plush Doll Santa Claus Snowman Reindeer Figurine With Let It Snow Sign Embroidered Knitted Xmas Home Table Decor Gift
like
Find Similar
Charming 18cm Santa plush figurine with Let It Snow sign for festive home decor - Santa Claus
18cm plush Christmas snowman figure with red knitted hat, scarf and wooden shovel - Snowman
Christmas reindeer plush figure with striped scarf and red gloves for festive home decor - Christmas Reindeer
Christmas Plush Doll Santa Claus Snowman Reindeer Figurine With Let It Snow Sign Embroidered Knitted Xmas Home Table Decor Gift
$2.45
No MOQ
3D Halloween Zombie Wall Decal Broken Wall Terror Female Ghost PVC Sticker For Bedroom Living Room Spooky Home Decoration
3D Halloween Zombie Wall Decal Broken Wall Terror Female Ghost PVC Sticker For Bedroom Living Room Spooky Home Decoration
like
Find Similar
Halloween 3D wall sticker dimensions 60x35cm featuring a scary zombie girl design - 35x60cm(HY-G011)
New3D Halloween Zombie Wall Decal Broken Wall Terror Female Ghost PVC Sticker For Bedroom Living Room Spooky Home Decoration
$1.38
No MOQ
USA Independence Day Gnome Plush Decorations Patriotic July 4th Tomte Ornament With Stars Stripes Red White Blue Faceless Doll
USA Independence Day Gnome Plush Decorations Patriotic July 4th Tomte Ornament With Stars Stripes Red White Blue Faceless Doll
like
Find Similar
Patriotic Independence Day gnome plush decoration with star and flag colors, 26cm tall - Pointed Hat Style Holding Star
Patriotic July 4th gnome plush with stars stripes hat holding US flag and dimensions - Pointed Hat Style Holding Flag
Patriotic USA Independence Day gnome plush with red white and blue stars and stripes design - Top Hat Style
USA Independence Day Gnome Plush Decorations Patriotic July 4th Tomte Ornament With Stars Stripes Red White Blue Faceless Doll
$2.74
Mix MOQ : 2
Halloween Ghost Plush Doll Long Striped Legs Polyester Ornament Cute Wizard Hat With Wings Cape Festive Home Party Decoration
Halloween Ghost Plush Doll Long Striped Legs Polyester Ornament Cute Wizard Hat With Wings Cape Festive Home Party Decoration
like
Find Similar
2 options
Halloween Ghost Plush Doll Long Striped Legs Polyester Ornament Cute Wizard Hat With Wings Cape Festive Home Party Decoration
$3.46
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in dragon decor

homewallroomkidshandmadepartyshapestarsholdertassels
alloystyledesktopmetaldiydailyeyemakingsilverpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access