Everful

Wholesale clips

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Clips

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in clips

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Stainless Steel Chain Bracelet For Women Men Minimalist High Polished Adjustable Paperclip Curb Rope Snake Jewelry
Stainless Steel Chain Bracelet For Women Men Minimalist High Polished Adjustable Paperclip Curb Rope Snake Jewelry
like
Find Similar
Polished silver stainless steel 4mm bead chain bracelet with adjustable lobster clasp - Round Bead Chain - Steel Color / 4mm Width x 190mm Length + 50mm Extension
Polished golden bead chain bracelet with 4mm beads and adjustable lobster clasp - Bead Chain Gold / 4mm Width x 190mm Length + 50mm Extension
Golden titanium steel curb chain bracelet for women 5x180mm with adjustable lobster clasp - Curb Chain - Gold Color / 5mm Width x 180mm Length + 50mm Extension
Polished silver curb chain bracelet in stainless steel with a lobster clasp and extender - Curb Chain - Steel Color / 5mm Width x 180mm Length + 50mm Extension
+6
Stainless Steel Chain Bracelet For Women Men Minimalist High Polished Adjustable Paperclip Curb Rope Snake Jewelry
$0.92-1.85
No MOQ
 · 
10 views
Free Shipping
Stainless Steel Paperclip Link Chain Necklace And Bracelet Vacuum Plated Fashion Jewelry For Men Women Unisex
Stainless Steel Paperclip Link Chain Necklace And Bracelet Vacuum Plated Fashion Jewelry For Men Women Unisex
like
Find Similar
16 options
Stainless Steel Paperclip Link Chain Necklace And Bracelet Vacuum Plated Fashion Jewelry For Men Women Unisex
$1.40-5.18
No MOQ
Free Shipping
Minimalist Hoop Earrings 304 Stainless Steel 18K Gold Plated Polished Geometric Round Jewelry For Men Women Unisex Classic
Minimalist Hoop Earrings 304 Stainless Steel 18K Gold Plated Polished Geometric Round Jewelry For Men Women Unisex Classic
like
Find Similar
Golden open jump rings 2.5mm wire diameter jewelry making kit with 45g weight mark - Small (Wire 2.5mm / Inner Dia 10.5mm)
Classic 2.5mm wide open hoop earrings in golden finish, individually packaged in clear bags - Medium (Wire 2.5mm / Inner Dia 12.5mm)
Golden 2.5mm wire earrings set of 20 pieces in clear packaging weighing 57g - Large (Wire 2.5mm / Inner Dia 15mm)
Set of 12 pairs of 2.5mm gold plated hoop earrings in clear plastic individual packaging - Extra Small (Wire 2.5mm / Inner Dia 8mm)
Minimalist Hoop Earrings 304 Stainless Steel 18K Gold Plated Polished Geometric Round Jewelry For Men Women Unisex Classic
$5.72
No MOQ
Free Shipping
Pig Nose Link Bracelet 304 Stainless Steel 18K Gold Plated Anchor Chain Coffee Bean Geometric Jewelry Adjustable For Women
Pig Nose Link Bracelet 304 Stainless Steel 18K Gold Plated Anchor Chain Coffee Bean Geometric Jewelry Adjustable For Women
like
Find Similar
Silver stainless steel pig nose link bracelet with lobster clasp and extension chain - Steel
18K gold plated stainless steel pig nose link chain bracelet with lobster clasp - 18K Gold
Pig Nose Link Bracelet 304 Stainless Steel 18K Gold Plated Anchor Chain Coffee Bean Geometric Jewelry Adjustable For Women
$2.24-2.49
No MOQ
 · 
12 sold recently
Free Shipping
Star Cartilage Earring Stud Titanium Steel Zircon Vibrant Star Flat Back Screw Piercing Jewelry For Women
Star Cartilage Earring Stud Titanium Steel Zircon Vibrant Star Flat Back Screw Piercing Jewelry For Women
like
Find Similar
Star-shaped cartilage piercing with zirconia and white enamel stars in silver finish - White
Pink star gemstone cartilage stud earring with silver celestial accents and flat back - Pink
Star shaped piercing earring with purple gemstone and silver accents for cartilage - Purple
Star-shaped cartilage earring featuring blue and white crystals in silver metal - Light Blue
NewStar Cartilage Earring Stud Titanium Steel Zircon Vibrant Star Flat Back Screw Piercing Jewelry For Women
$1.30-2.09
No MOQ
Free Shipping
Safety Pin Ear Stud Pink Star Blue Heart Zircon Titanium Steel Cartilage Earring For Women Y2K Jewelry
Safety Pin Ear Stud Pink Star Blue Heart Zircon Titanium Steel Cartilage Earring For Women Y2K Jewelry
like
Find Similar
Star and heart pendant safety pin stud earring in polished silver metal with pink and blue stones - Star Paperclip (A-584)
Safety Pin Ear Stud Pink Star Blue Heart Zircon Titanium Steel Cartilage Earring For Women Y2K Jewelry
$1.70
No MOQ
Free Shipping
Cute Rabbit Ear Pink Enamel Ear Cuff For Women Girls Sweet Non Pierced Silver Color Titanium Steel Copper Earring
Cute Rabbit Ear Pink Enamel Ear Cuff For Women Girls Sweet Non Pierced Silver Color Titanium Steel Copper Earring
like
Find Similar
Sweet silver bunny ear clip earrings with pink enamel detail for non-pierced ears - Rabbit Ear Cuff (Single) / Silver
Cute Rabbit Ear Pink Enamel Ear Cuff For Women Girls Sweet Non Pierced Silver Color Titanium Steel Copper Earring
$0.84
No MOQ
Free Shipping
Titanium Steel Heart Planet Cartilage Stud Earring With Zircon Long Chain Tassel Flat Back Screw Piercing For Women
Titanium Steel Heart Planet Cartilage Stud Earring With Zircon Long Chain Tassel Flat Back Screw Piercing For Women
like
Find Similar
Silver heart planet tassel earring featuring iridescent stones and fine metal chains - AB Color (Single)
Silver heart titanium steel cartilage stud with cubic zirconia and tassel chain detail - White (Single Piece)
Titanium steel silver heart stud earring with pink gemstones and chain drop detail - Pink (Single Piece)
Silver titanium steel heart stud earring with purple gems and delicate chain tassels - Purple (Single Piece)
Titanium Steel Heart Planet Cartilage Stud Earring With Zircon Long Chain Tassel Flat Back Screw Piercing For Women
$1.57
No MOQ
Free Shipping
Starburst Ear Cartilage Stud Titanium Steel Pink Zircon Sun Flower Screw Back Conch Piercing Jewelry For Women
Starburst Ear Cartilage Stud Titanium Steel Pink Zircon Sun Flower Screw Back Conch Piercing Jewelry For Women
like
Find Similar
Silver starburst helix earring with pink oval zircon and sparkling clear stones - Pink Zirconia Sunflower Style (A-459)
Starburst Ear Cartilage Stud Titanium Steel Pink Zircon Sun Flower Screw Back Conch Piercing Jewelry For Women
$1.17
No MOQ
Free Shipping
Wing Ear Cuff Copper Rhombus Red Zircon No Piercing Jewelry For Women Cool Style Unique Non Pierced Earring
Wing Ear Cuff Copper Rhombus Red Zircon No Piercing Jewelry For Women Cool Style Unique Non Pierced Earring
like
Find Similar
Silver angel wing ear cuff featuring a rhombic red gemstone in a minimalist design - Right Side (Single) / Silver
Silver wing ear cuff featuring a rhombic orange zircon stone on a white background - Left Side (Single) / Silver
Wing Ear Cuff Copper Rhombus Red Zircon No Piercing Jewelry For Women Cool Style Unique Non Pierced Earring
$1.04
No MOQ
Free Shipping
Wing Ear Cuff Gothic Copper Wrap Earring Featuring Red Rhombus Gemstone No Piercing Dark Cool Punk Style Jewelry
Wing Ear Cuff Gothic Copper Wrap Earring Featuring Red Rhombus Gemstone No Piercing Dark Cool Punk Style Jewelry
like
Find Similar
Unique gun-metal wing ear cuff for women featuring a faceted red geometric gemstone - A453-Right Side (Single Piece)
Gothic style black metal wing open ring featuring a vibrant red kite-shaped gemstone - A453-Left Side (Single Piece)
Wing Ear Cuff Gothic Copper Wrap Earring Featuring Red Rhombus Gemstone No Piercing Dark Cool Punk Style Jewelry
$1.04
No MOQ
 · 
10 sold recently
Free Shipping
Zircon Flower Stud Earrings With Titanium Steel Screw Post Sparkly Sweet Floral Piercing Body Jewelry For Women
Zircon Flower Stud Earrings With Titanium Steel Screw Post Sparkly Sweet Floral Piercing Body Jewelry For Women
like
Find Similar
Sparkling zircon flower ear stud crafted in silver titanium steel with crystal petals - Flower Shape (A234)
NewZircon Flower Stud Earrings With Titanium Steel Screw Post Sparkly Sweet Floral Piercing Body Jewelry For Women
$1.57
No MOQ
Free Shipping
Punk Skull Stud Earrings For Men Stainless Steel Gothic Rock Pirate Cheetah Head Retro Hip Hop Unisex Piercing Jewelry
Punk Skull Stud Earrings For Men Stainless Steel Gothic Rock Pirate Cheetah Head Retro Hip Hop Unisex Piercing Jewelry
like
Find Similar
Men's retro skull and crossbones stud earring in antique silver stainless steel - Skull Style (S196)
Mens stainless steel leopard head stud earring in retro finish with 1.1cm size - Leopard Head Style (S198)
Silver skull earring stud for men on dark rock background, size 1.45cm x 0.89cm - Skull Style (S199)
Gothic skull and crossbones pirate earring in silver stainless steel finish - Pirate Skull Style (S200)
+2
Punk Skull Stud Earrings For Men Stainless Steel Gothic Rock Pirate Cheetah Head Retro Hip Hop Unisex Piercing Jewelry
$0.76-1.65
No MOQ
Free Shipping
Titanium Steel Ear Cartilage Studs Pink Zircon Heart Butterfly Swan Cupid Arrow Piercing Jewelry For Women
Titanium Steel Ear Cartilage Studs Pink Zircon Heart Butterfly Swan Cupid Arrow Piercing Jewelry For Women
like
Find Similar
Silver butterfly ear stud with pink and white zirconia stones on a gray texture surface - Butterfly Style (A015-1#) / Single Piece
Titanium steel stud earring with pink zircon heart butterfly wings and screw back - Floral Style (A015-2#) / Single Piece
Silver swan stud earrings with pink marquise zircon wings and flat back closure - Swan Style (A015-3#) / Single Piece
Pink heart zircon titanium steel stud earring with cupid arrow design on gray background - Heart Arrow Style (A015-4#) / Single Piece
+2
Titanium Steel Ear Cartilage Studs Pink Zircon Heart Butterfly Swan Cupid Arrow Piercing Jewelry For Women
$1.16-1.56
No MOQ
Free Shipping
Blue Zircon Opal Cartilage Stud Earrings Titanium Steel Screw Flat Back Piercing Jewelry Heart Wing Star For Women
Blue Zircon Opal Cartilage Stud Earrings Titanium Steel Screw Flat Back Piercing Jewelry Heart Wing Star For Women
like
Find Similar
Titanium steel stud earring with clover shape design and four blue zircon gemstones - Clover Style (A06-1#)
Titanium steel winged ear stud with blue zircon and clear stones on white background - Wings Blue Main Stone (A06-2#)
Exquisite titanium steel ear stud with radiant blue zircon and opal stones in curved design - Curved Pave Design (A06-3#)
Silver titanium steel stud earring with planet design, pink star, and blue gemstone link - Planet Chain Style (A06-4#)
+2
Blue Zircon Opal Cartilage Stud Earrings Titanium Steel Screw Flat Back Piercing Jewelry Heart Wing Star For Women
$1.17-1.83
No MOQ
Free Shipping
Ear Cuffs Non Piercing Copper Enamel Star Cross Heart U Shaped Fashion Jewelry For Women Gold Color Black White
Ear Cuffs Non Piercing Copper Enamel Star Cross Heart U Shaped Fashion Jewelry For Women Gold Color Black White
like
Find Similar
6 options
Ear Cuffs Non Piercing Copper Enamel Star Cross Heart U Shaped Fashion Jewelry For Women Gold Color Black White
$0.76
No MOQ
Free Shipping
Fashion Ear Cuff Earrings Micro Pave Zircon Star Pendant Copper No Piercing Creative Jewelry For Women
Fashion Ear Cuff Earrings Micro Pave Zircon Star Pendant Copper No Piercing Creative Jewelry For Women
like
Find Similar
3 options
Fashion Ear Cuff Earrings Micro Pave Zircon Star Pendant Copper No Piercing Creative Jewelry For Women
$1.42-1.61
No MOQ
Free Shipping
Minimalist Paperclip Chain Necklace Stainless Steel Chic Fashion Jewelry For Women Adjustable Link Chain
Minimalist Paperclip Chain Necklace Stainless Steel Chic Fashion Jewelry For Women Adjustable Link Chain
like
Find Similar
Detail of silver paperclip chain necklace in stainless steel with polished finish - Silver
Minimalist gold stainless steel paperclip chain necklace for women on white background - Gold
Minimalist Paperclip Chain Necklace Stainless Steel Chic Fashion Jewelry For Women Adjustable Link Chain
$0.68-1.21
No MOQ
 · 
13 sold recently
Free Shipping
Stainless Steel Stackable Chain Bracelet For Women Gold Silver Plated Minimalist Adjustable Jewelry Personality Trendy Style
Stainless Steel Stackable Chain Bracelet For Women Gold Silver Plated Minimalist Adjustable Jewelry Personality Trendy Style
like
Find Similar
Silver stainless steel coffee bean link chain bracelet with adjustable lobster clasp - Silver Coffee Bean Chain Stainless Steel Bracelet (B781)
Silver stainless steel anchor chain bracelet with lobster clasp and adjustable tail - Silver Pig Nose Buckle Stainless Steel Bracelet (B296)
Elegant gold-plated stainless steel snake chain bracelet with adjustable lobster clasp - Gold Snake Bone Chain Stainless Steel Bracelet (B528)
Sleek silver stainless steel snake bone chain bracelet with lobster clasp and tag - Silver Snake Bone Chain Stainless Steel Bracelet (B528)
+15
Stainless Steel Stackable Chain Bracelet For Women Gold Silver Plated Minimalist Adjustable Jewelry Personality Trendy Style
$2.70-5.85
No MOQ
 · 
14 views
Free Shipping
Minimalist Stainless Steel Paperclip Link Chain Bracelet Adjustable Geometric Hollow Jewelry For Women
Minimalist Stainless Steel Paperclip Link Chain Bracelet Adjustable Geometric Hollow Jewelry For Women
like
Find Similar
Detail of gold paperclip chain bracelet with adjustable clasp and small round tag - Golden (YB-639G)
Minimalist black stainless steel paperclip chain bracelet with adjustable lobster clasp - Black (YB-639BLK)
Close-up of silver stainless steel paperclip chain bracelet with lobster clasp and tag - Silver (YB-639S)
Minimalist Stainless Steel Paperclip Link Chain Bracelet Adjustable Geometric Hollow Jewelry For Women
-5%
$0.62-1.15
No MOQ
 · 
66 sold recently
Free Shipping
Stainless Steel Jewelry Necklace Earrings Bracelet For Women Gold Plated Heart Star Pendant Zircon Non-Fading Elegant
Stainless Steel Jewelry Necklace Earrings Bracelet For Women Gold Plated Heart Star Pendant Zircon Non-Fading Elegant
like
Find Similar
Minimalist golden Cuban chain necklace with small star charms and polished metallic finish - Gold Star Charm Cuban Link Necklace (KCD475)
Gold-plated C-shaped hoop earrings featuring sparkling crystals on a white background - Gold C-Shape Crystal Inlaid Hoop Earrings (KDE879)
Three-tier linked gold round earrings in polished stainless steel for women - Gold Triple Link Chain Hoop Earrings (KDE444)
Golden double heart drop earrings in polished stainless steel minimalist jewelry - Gold Simple Double Heart Drop Earrings (KDE314)
+16
Stainless Steel Jewelry Necklace Earrings Bracelet For Women Gold Plated Heart Star Pendant Zircon Non-Fading Elegant
$2.75-5.82
No MOQ
Free Shipping
Four Leaf Clover Stainless Steel Bangle White Mother Of Artificial Pearl Zircon Rose Gold Plated Flower Elegant Jewelry For Women
Four Leaf Clover Stainless Steel Bangle White Mother Of Artificial Pearl Zircon Rose Gold Plated Flower Elegant Jewelry For Women
like
Find Similar
1 option
Four Leaf Clover Stainless Steel Bangle White Mother Of Artificial Pearl Zircon Rose Gold Plated Flower Elegant Jewelry For Women
$3.68
No MOQ
Free Shipping
Rose Gold Plated Stainless Steel Bangle Bracelet For Women With Zircon Rhinestone Hollow Geometric Double Layer Design
Rose Gold Plated Stainless Steel Bangle Bracelet For Women With Zircon Rhinestone Hollow Geometric Double Layer Design
like
Find Similar
1 option
Rose Gold Plated Stainless Steel Bangle Bracelet For Women With Zircon Rhinestone Hollow Geometric Double Layer Design
$3.93
No MOQ
 · 
1 reviews
Free Shipping
Stainless Steel Ear Cuffs Non Piercing Earrings Vacuum Gold Plated Hollow Geometric Star Textured Hip Hop Jewelry
Stainless Steel Ear Cuffs Non Piercing Earrings Vacuum Gold Plated Hollow Geometric Star Textured Hip Hop Jewelry
like
Find Similar
18K gold plated chunky C-shaped hoop earrings with unique scale-textured metal finish - Fish Scale Pattern Style / Gold
Silver hollow cuff earring with textured surface shown on model ear in professional style - Textured Cylinder Style (F612) / Silver
Close-up of silver stainless steel C-hoop earrings with black engraved star patterns - Star Pattern Style (F615) / Silver
Gold stainless steel thick hollow star pattern hoop earrings with 30mm diameter size details - Star Pattern Style (F614) / Gold
+5
Stainless Steel Ear Cuffs Non Piercing Earrings Vacuum Gold Plated Hollow Geometric Star Textured Hip Hop Jewelry
$3.11-4.36
No MOQ
 · 
10 views
Free Shipping
Butterfly Earrings Rhinestone Alloy With Silver Earring Post Luxury Elegant Fashion Jewelry For Women
Butterfly Earrings Rhinestone Alloy With Silver Earring Post Luxury Elegant Fashion Jewelry For Women
like
Find Similar
Macro shot of silver-edged black butterfly stud earrings in a soft jewelry box - Silver Needle Black Butterfly Earrings
Detailed close-up of a large black butterfly ring on a hand with silver textured borders - Black Butterfly Ring
Detail of elegant black butterfly pendant with silver snake chain necklace on model - Black Butterfly Necklace
Elegant gold-tone butterfly ring with translucent pink iridescent wings on white tray - Pink Butterfly Enamel Ear Clip (Single)
+2
Butterfly Earrings Rhinestone Alloy With Silver Earring Post Luxury Elegant Fashion Jewelry For Women
$1.44-2.09
No MOQ
Free Shipping
Green Gemstone Gourd Wu Lou Stud Earrings With Zircon Copper Base And Silver Earring Post Vintage Chinese Style For Women
Green Gemstone Gourd Wu Lou Stud Earrings With Zircon Copper Base And Silver Earring Post Vintage Chinese Style For Women
like
Find Similar
Detailed close-up of emerald green gourd stud earrings with zircon inlay in a jewelry box - Silver Earring Post Style / Silver-Green
Close-up of elegant green gourd pearl ear clips nestled in a premium jewelry gift box - Clip-on Earrings / Silver-Green
Green Gemstone Gourd Wu Lou Stud Earrings With Zircon Copper Base And Silver Earring Post Vintage Chinese Style For Women
$2.86
No MOQ
Free Shipping
Cubic Zirconia Tennis Bracelet Stainless Steel 18K Gold Plated Rectangular Stone Paperclip Chain Waterproof For Women
Cubic Zirconia Tennis Bracelet Stainless Steel 18K Gold Plated Rectangular Stone Paperclip Chain Waterproof For Women
like
Find Similar
Waterproof 18k gold plated stainless steel chain bracelet with clear zircon stones - Gold
Cubic Zirconia Tennis Bracelet Stainless Steel 18K Gold Plated Rectangular Stone Paperclip Chain Waterproof For Women
$4.19
No MOQ
Free Shipping
Vintage Baroque Silver Tone Alloy Rhinestone Long Drop Earrings For Women Hollow Cutout Elegant Palace Style Bridal Jewelry
Vintage Baroque Silver Tone Alloy Rhinestone Long Drop Earrings For Women Hollow Cutout Elegant Palace Style Bridal Jewelry
like
Find Similar
Vintage palace style long silver drop earrings with hollow diamonds on white background - Silver (Clip-on)
Vintage Baroque Silver Tone Alloy Rhinestone Long Drop Earrings For Women Hollow Cutout Elegant Palace Style Bridal Jewelry
$1.44
Mix MOQ : 3
 · 
1 reviews
Free Shipping
Polka Dot Fabric Scrunchies Sweet Retro Bow Hair Ties Elastic Ponytail Holder Women Girls
Polka Dot Fabric Scrunchies Sweet Retro Bow Hair Ties Elastic Ponytail Holder Women Girls
like
Find Similar
Detail view of pink polka dot scrunchie with a burgundy bow and AE fabric label - Red Polka Dot Hair Rope / Red
Polka Dot Fabric Scrunchies Sweet Retro Bow Hair Ties Elastic Ponytail Holder Women Girls
-9%
$1.36
No MOQ
 · 
12 sold recently
Free Shipping
Christmas Tree Flower Decoration Glitter Hollow Poinsettia Ornaments For Party Wedding Festival Home Decor
Christmas Tree Flower Decoration Glitter Hollow Poinsettia Ornaments For Party Wedding Festival Home Decor
like
Find Similar
Sparkling gold glitter Poinsettia flower decoration for Christmas tree 9cm - Gold
Sparkling silver glitter poinsettia flower for Christmas tree and wreath decoration - Silver
Glittering red hollow artificial Christmas flower for tree decoration 9cm diameter - Red
Pink glitter poinsettia Christmas flower decoration for tree, 9cm hollow mesh design - Pink
+9
Christmas Tree Flower Decoration Glitter Hollow Poinsettia Ornaments For Party Wedding Festival Home Decor
$0.20
Mix MOQ : 10
Asymmetric Moon Dangle Earrings Alloy Blue Rhinestone Water Drop Silver Earring Post Elegant Jewelry For Women
Asymmetric Moon Dangle Earrings Alloy Blue Rhinestone Water Drop Silver Earring Post Elegant Jewelry For Women
like
Find Similar
Elegant s925 asymmetric moon and water drop earrings with blue crystals and pearls - Silver Needle
Asymmetric Moon Dangle Earrings Alloy Blue Rhinestone Water Drop Silver Earring Post Elegant Jewelry For Women
$1.45-1.75
Mix MOQ : 2
Free Shipping
Chunky Hoop Earrings For Women Stainless Steel 18K Gold Plated Thick Round Tube Minimalist Mirror Polished Ins Style
Chunky Hoop Earrings For Women Stainless Steel 18K Gold Plated Thick Round Tube Minimalist Mirror Polished Ins Style
like
Find Similar
2 options
Chunky Hoop Earrings For Women Stainless Steel 18K Gold Plated Thick Round Tube Minimalist Mirror Polished Ins Style
-12%
$0.88-1.04
No MOQ
 · 
22 views
Free Shipping
Mini Kraft Paper Square Candy Box DIY Vintage Gift Containers With Hemp Rope For Wedding Party Favors Souvenirs Rustic
Mini Kraft Paper Square Candy Box DIY Vintage Gift Containers With Hemp Rope For Wedding Party Favors Souvenirs Rustic
like
Find Similar
Vintage small 5x5x5cm square kraft paper favor gift box with rustic jute twine string - 5cm Cowhide Leather + Round Tag
Elegant white 5x5x5cm square DIY candy favor box featuring white twine and gift tag - 5cm White Cowhide + Round Hanging Clip
Mini Kraft Paper Square Candy Box DIY Vintage Gift Containers With Hemp Rope For Wedding Party Favors Souvenirs Rustic
$0.06
Mix MOQ : 50
 · 
101 sold recently
Father's Day Honeycomb Centerpieces Cardboard Table Ornaments Party Desktop Decorations Best Dad Ever Theme Blue Black
Father's Day Honeycomb Centerpieces Cardboard Table Ornaments Party Desktop Decorations Best Dad Ever Theme Blue Black
like
Find Similar
9-piece Father's Day honeycomb centerpieces featuring Best Dad Ever themes in deep blue and black - Blue Series
Father's Day Honeycomb Centerpieces Cardboard Table Ornaments Party Desktop Decorations Best Dad Ever Theme Blue Black
-4%
$3.70
Mix MOQ : 5
Artificial Christmas Poinsettia Flowers Fabric With Glitter Edges Shiny Multi Layer For Tree Wreath Decoration Party Ornament
Artificial Christmas Poinsettia Flowers Fabric With Glitter Edges Shiny Multi Layer For Tree Wreath Decoration Party Ornament
like
Find Similar
Red artificial poinsettia flower with gold glitter edges for Christmas tree decoration - Red Gold Edge
Artificial gold poinsettia flower decoration with gold leaf edges for Christmas trees - Gold Gold Edge
Artificial purple Christmas poinsettia flower with gold glitter edges and green stamens - Purple Gold Edge
Macro view of a 15cm silver glitter Christmas flower on a white wooden background - Silver with Silver Edge
+2
Artificial Christmas Poinsettia Flowers Fabric With Glitter Edges Shiny Multi Layer For Tree Wreath Decoration Party Ornament
$0.14
Mix MOQ : 2
Elf Ears And Vampire Teeth Dentures Halloween Cosplay Costume Props Latex Resin Pointed Ears Fangs For Masquerade Party
Elf Ears And Vampire Teeth Dentures Halloween Cosplay Costume Props Latex Resin Pointed Ears Fangs For Masquerade Party
like
Find Similar
Green latex elf ears cosplay props on illustration card for Halloween party - Long Style (Cardboard Packaging) / Green
Green elf ears cosplay props made of soft silicone for Halloween party costumes - Long Style (OPP Bag) / Green
Flesh-colored latex elf ears for Halloween party cosplay presented in illustrated packaging - Long Style (Cardboard Packaging) / Pink
Cosplay latex elf ears in red color for Halloween party costume accessories - Long Style (Cardboard Packaging) / Red
+31
Elf Ears And Vampire Teeth Dentures Halloween Cosplay Costume Props Latex Resin Pointed Ears Fangs For Masquerade Party
$0.16-0.52
Mix MOQ : 2
 · 
489 sold recently
Christmas Butterfly Decorations Sparkling Glitter Rhinestones Velvet Artificial Butterflies For Tree Wreath Gift Box
Christmas Butterfly Decorations Sparkling Glitter Rhinestones Velvet Artificial Butterflies For Tree Wreath Gift Box
like
Find Similar
White Christmas butterfly ornament with gold sequins and 20cm clip-on attachment - 20cm / Platinum
20cm Sequin butterfly Christmas tree ornament with golden glitter and white beads - 20cm / Gold
Red fabric butterfly Christmas ornament with gold glitter and silver rhinestones, size 20cm - 20cm / Red
Pink fabric butterfly ornament with gold sequins and crystals for Christmas tree decor - 20cm / Light Pink
Christmas Butterfly Decorations Sparkling Glitter Rhinestones Velvet Artificial Butterflies For Tree Wreath Gift Box
$1.97
No MOQ
 · 
16 sold recently
Christmas Butterfly Ornaments Mesh Glitter Rhinestone Feather Tree Hanging Decorations Festival Atmosphere Party Props
Christmas Butterfly Ornaments Mesh Glitter Rhinestone Feather Tree Hanging Decorations Festival Atmosphere Party Props
like
Find Similar
Elegant white sequin butterfly pendant with gold glitter and rhinestones in gift box - Champagne
White butterfly Christmas tree ornaments with silver glitter edges in a 5-piece set - Silver
Set of 4 lake blue Christmas butterfly ornaments with glitter and rhinestones in box - Blue
Christmas Butterfly Ornaments Mesh Glitter Rhinestone Feather Tree Hanging Decorations Festival Atmosphere Party Props
$4.27
Mix MOQ : 2
Glitter Butterfly Ornaments Christmas Tree Decorations Mesh Fabric Feather Hanging Decor For Holiday Party Festive Home
Glitter Butterfly Ornaments Christmas Tree Decorations Mesh Fabric Feather Hanging Decor For Holiday Party Festive Home
like
Find Similar
Five pack of white mesh butterfly Christmas tree ornaments with silver glitter edges - Style A (Large)
Set of 6 white mesh Christmas butterfly ornaments with gold glitter finish 8x9cm - Style C (Large)
Set of 10 emerald green feather butterfly ornaments with glitter finish in a black gift box - Peacock Green Combination
Set of 10 red mesh glitter butterfly ornaments in black packaging for Christmas tree - Red Combo
+14
Glitter Butterfly Ornaments Christmas Tree Decorations Mesh Fabric Feather Hanging Decor For Holiday Party Festive Home
$3.11-5.71
Mix MOQ : 2
 · 
18 sold recently
Free Shipping
Christmas Slap Bracelets LED Light Up Sequin Plush Cartoon Santa Claus Snowman Reindeer Polar Bear Holiday Party Decor Gift
Christmas Slap Bracelets LED Light Up Sequin Plush Cartoon Santa Claus Snowman Reindeer Polar Bear Holiday Party Decor Gift
like
Find Similar
Pink and purple sequin Christmas snowman snap bracelet on a wooden display stand - Sequin Snowman - With LED
Close-up of blue sequin Christmas slap bracelet with a plush polar bear on wood - Sequin Bear - With LED
Close-up of glowing Santa Claus slap bracelet with red sequins on a rustic wooden table - Sequin Santa Claus - No Light
Close-up of pink sequined Christmas slap bracelet featuring a cute plush snowman character - Sequin Snowman - No Light
+15
Christmas Slap Bracelets LED Light Up Sequin Plush Cartoon Santa Claus Snowman Reindeer Polar Bear Holiday Party Decor Gift
$0.26-2.16
No MOQ
 · 
30 sold recently
Mini Hair Claws Acrylic Resin Cute Ocean Sea Animal Shapes Dolphin Octopus Crab Starfish Shell For Women Girls Kids
Mini Hair Claws Acrylic Resin Cute Ocean Sea Animal Shapes Dolphin Octopus Crab Starfish Shell For Women Girls Kids
like
Find Similar
Blue and white dolphin hair claw clip made of resin for ocean style hairstyles - Light Blue Dolphin
Blue and white whale resin hair claw clip held in hand against green leaf background - Dark Blue Dolphin
Cute pink starfish hair clip with polka dots and smiley face held against green leaves - Starfish
Orange seahorse hair clip made of translucent resin shown held in hand outdoors - Seahorse
+39
Mini Hair Claws Acrylic Resin Cute Ocean Sea Animal Shapes Dolphin Octopus Crab Starfish Shell For Women Girls Kids
$0.37-2.97
No MOQ
 · 
819 sold recently
Knitted Mini Christmas Hats Small Santa Hat For Doll Decoration Holiday Festive DIY Craft Accessories
Knitted Mini Christmas Hats Small Santa Hat For Doll Decoration Holiday Festive DIY Craft Accessories
like
Find Similar
Mini red and white knitted Christmas hat shown with rulers to indicate 6cm height and 4.5cm width - Folded Christmas Hat (Cashmere Pom-pom)
Detailed view of mini knitted Christmas hat with rulers showing 4cm width and 6.5cm height - Pointed Christmas Hat (Cashmere Pom-pom)
Close-up of two mini knitted Christmas hats with white pom-poms on a woven mat - Christmas Hat with Pom-pom 4*7CM
Mini red and white knitted Christmas hat detail showing 7.5cm height measurement - Pointed Christmas Hat (Elastic Pom-pom)
+3
Knitted Mini Christmas Hats Small Santa Hat For Doll Decoration Holiday Festive DIY Craft Accessories
$0.11-0.23
Mix MOQ : 2
 · 
23 sold recently
Heart Locket Necklace Gold Plated Copper Zircon Butterfly Star Evil Eye Photo Holder Jewelry For Women
Heart Locket Necklace Gold Plated Copper Zircon Butterfly Star Evil Eye Photo Holder Jewelry For Women
like
Find Similar
Gold heart locket necklace with evil eye zircon pendant and delicate beaded chain - Eye Pattern (23346)
Gold heart locket necklace with star zircon on a vintage book with dried flowers - Star Pattern (23347)
Gold plated heart locket necklace with zircon butterfly and elegant gold bead chain - Butterfly Pattern (23348)
Gold locket necklace with zircon-encrusted girl charm on a detailed bead chain - Little Girl Pattern (23353)
+2
Heart Locket Necklace Gold Plated Copper Zircon Butterfly Star Evil Eye Photo Holder Jewelry For Women
-4%
$2.37-2.49
No MOQ
 · 
83 sold recently
Free Shipping
Halloween LED Light Up Earrings Glowing Pumpkin Jack O Lantern Skull Ghost Acrylic Novelty Party Jewelry For Women
Halloween LED Light Up Earrings Glowing Pumpkin Jack O Lantern Skull Ghost Acrylic Novelty Party Jewelry For Women
like
Find Similar
Detailed view of LED glowing transparent skull earrings for Halloween party night - Skull Hook Style / Transparent Blue Light
Close-up of glowing LED pumpkin earrings for Halloween with sparkling light effect - Pumpkin Clip-on Style / Orange Glowing
Close-up of glowing purple LED skull earrings with transparent plastic and metal clips - Skull Clip-on Style / Transparent Purple Light
Glowing orange LED pumpkin earrings for Halloween party with silver hooks on dark background - Pumpkin Hook Style / Orange
+3
Halloween LED Light Up Earrings Glowing Pumpkin Jack O Lantern Skull Ghost Acrylic Novelty Party Jewelry For Women
$1.26
Mix MOQ : 5
 · 
10 views
Free Shipping
Halloween LED Light Up Glowing Earrings Alloy Acrylic Skull Pumpkin Novelty Party Accessories
Halloween LED Light Up Glowing Earrings Alloy Acrylic Skull Pumpkin Novelty Party Accessories
like
Find Similar
Macro shot of skull-shaped earrings with glowing blue LED lights on dark background - Skull Drop Earrings / Blue Light
Glowing orange LED pumpkin earrings for Halloween party with silver hooks on dark background - Pumpkin Drop Earrings / Orange Light
Close-up of glowing LED pumpkin earrings for Halloween with sparkling light effect - Pumpkin Clip-on Earrings / Orange Light
Close-up of glowing purple LED skull earrings with transparent plastic and metal clips - Skull Clip-on Earrings / Purple Light
Halloween LED Light Up Glowing Earrings Alloy Acrylic Skull Pumpkin Novelty Party Accessories
$1.38
Mix MOQ : 5
Free Shipping
LED Glowing Slap Bracelet Halloween Sequins Bat Pumpkin Ghost Cartoon Wristband Party Favors For Kids
LED Glowing Slap Bracelet Halloween Sequins Bat Pumpkin Ghost Cartoon Wristband Party Favors For Kids
like
Find Similar
Detail of sequined pumpkin slap bracelet with plush orange texture and bow for Halloween - Glowing Pumpkin with Leaf
Detail of Halloween sequin slap bracelet featuring an orange ghost with a black top hat - Glowing Pumpkin with Hat
Macro detail of sequined Halloween slap bracelet with red plush character and festive decor - Glowing Red Monster Cat
Close-up of a white ghost Halloween LED slap bracelet with sparkly black sequins - Glowing Ghost
LED Glowing Slap Bracelet Halloween Sequins Bat Pumpkin Ghost Cartoon Wristband Party Favors For Kids
$0.69
No MOQ
 · 
24 sold recently
Geometric U-Shape Link Bracelet 18K Gold Plated Stainless Steel Adjustable Punk Hip Hop Style Jewelry For Women
Geometric U-Shape Link Bracelet 18K Gold Plated Stainless Steel Adjustable Punk Hip Hop Style Jewelry For Women
like
Find Similar
Adjustable 18k gold plated stainless steel bracelet with rectangular geometric chain links - 18K Gold / Gold
Geometric U-Shape Link Bracelet 18K Gold Plated Stainless Steel Adjustable Punk Hip Hop Style Jewelry For Women
$2.82
No MOQ
Free Shipping
Christmas Reindeer Antlers Headband Santa Hat Hair Hoop Festive Party Decoration Hair Accessories Polyester Sequin Plastic
Christmas Reindeer Antlers Headband Santa Hat Hair Hoop Festive Party Decoration Hair Accessories Polyester Sequin Plastic
like
Find Similar
Plush Christmas reindeer antler headband with red glitter and festive felt ears decor - Red Antler Ear Headband
Christmas reindeer headband featuring golden sequins and brown plush ears for party - Gold Antler Ear Headband
Pink sequin reindeer antler headband with plush ears for Christmas party costume - Pink Antler Ear Headband
Sparkly red Christmas reindeer antler headband for adult and kids festive party - Glitter Red Antler Headband
+15
Christmas Reindeer Antlers Headband Santa Hat Hair Hoop Festive Party Decoration Hair Accessories Polyester Sequin Plastic
$0.55-0.86
Mix MOQ : 2
 · 
12 views
Heart Headband And Sunglasses Sequin Feather Spring Valentine's Day Party Favor Accessories Cute For Women
Heart Headband And Sunglasses Sequin Feather Spring Valentine's Day Party Favor Accessories Cute For Women
like
Find Similar
Close-up of pink glitter hearts on spring headband with soft light background - Headband / Pink Glitter Heart
Sparkly red sequin double heart headband with soft feathers for Valentine's Day party - Feather Headband / Red Glitter Heart + Feather
Hot pink heart headband with feathers on a white display stand for party outfits - Feather Headband / Rose Red Glitter Heart + Feather
Sparkly red sequin heart headband with red feathers on spring mounts for party wear - Feather Headband / Red Sequin Heart + Feather
+46
Heart Headband And Sunglasses Sequin Feather Spring Valentine's Day Party Favor Accessories Cute For Women
$0.19-1.30
No MOQ
 · 
692 sold recently
Christmas Reindeer Antlers Headband Plush Ears Tulle Skirt For Holiday Party Cosplay Accessories Adults Kids
Christmas Reindeer Antlers Headband Plush Ears Tulle Skirt For Holiday Party Cosplay Accessories Adults Kids
like
Find Similar
Christmas elf headband in green felt with red stripes and 17cm by 24cm size markings - Christmas Hat Green
Brown plush reindeer antler headband with festive plaid bows and golden bells - Dark Brown Large Antlers
Cute green Christmas tree headband with glitter, yellow star, and festive feathers - Christmas Tree Large
Cute brown plush reindeer antler headband with red band, green leaves and gold bell - Reindeer Antlers Large
+65
Christmas Reindeer Antlers Headband Plush Ears Tulle Skirt For Holiday Party Cosplay Accessories Adults Kids
$0.35-10.52
Mix MOQ : 2
Monkey Animal Costume Accessories Plush Ear Headband Long Tail Bow Tie Gloves Tutu For Cosplay Halloween Party Performance
Monkey Animal Costume Accessories Plush Ear Headband Long Tail Bow Tie Gloves Tutu For Cosplay Halloween Party Performance
like
Find Similar
Black plush monkey costume set with cat ears hair clips, sequin bowtie, and fuzzy tail - Black Cat 4-Piece Set
Leopard print plush tail and white collar with black sequin bow costume set - Bowtie Tail Set
Plush monkey costume set with brown fur ear headband and cream faux fur tail accessory - Dog 2-Piece Set
Sparkly black sequin bowtie with white stand-up collar for stage costumes and pet wear - White Bowknot
+25
Monkey Animal Costume Accessories Plush Ear Headband Long Tail Bow Tie Gloves Tutu For Cosplay Halloween Party Performance
$1.04-5.04
Mix MOQ : 2
Free Shipping
Bunny Ears Costume Accessories Headband Bowtie Tail Cuffs For Easter Halloween Cosplay Party Plush Satin Rabbit Girl
Bunny Ears Costume Accessories Headband Bowtie Tail Cuffs For Easter Halloween Cosplay Party Plush Satin Rabbit Girl
like
Find Similar
Detail of burgundy satin rabbit cosplay set with long gloves, headband and fluffy tail - 5-Piece Set (Headband+Gloves+Collar+Cuffs+Tail) / Wine Red 5-Piece Set
Close-up of soft gray and pink plush rabbit ear headband on a lavender background - Grey Headband
Black plush rabbit ear headband with red satin lining for Easter costume set - Black and Red Long Ear Headband
White plush bunny ear headband with pink inner lining for Easter costume set - White and Pink Long Ear Headband
+28
Bunny Ears Costume Accessories Headband Bowtie Tail Cuffs For Easter Halloween Cosplay Party Plush Satin Rabbit Girl
$0.52-6.28
Mix MOQ : 2
 · 
20 views
Animal Costume Accessory Faux Fur Ears Headband Tail Bowtie Gloves Tutu Skirt For Cosplay Party Halloween Performance Cute
Animal Costume Accessory Faux Fur Ears Headband Tail Bowtie Gloves Tutu Skirt For Cosplay Party Halloween Performance Cute
like
Find Similar
Kids tiger cosplay set with black and white striped plush headband tail and tutu skirt - White Tiger 4-Piece Set (with Tutu)
Three-piece white faux fur animal costume set with ears headband, tail, and tutu - White Leopard 3-Piece Set (with Tutu)
Faux fur leopard print costume set featuring plush animal ears headband and long tail - Leopard 2-Piece Set (Headband + Tail)
Detailed view of plush tiger ears headband and long tail accessory set with striped fur - Tiger 2-Piece Set (Headband + Tail)
+29
Animal Costume Accessory Faux Fur Ears Headband Tail Bowtie Gloves Tutu Skirt For Cosplay Party Halloween Performance Cute
$0.55-32.62
Mix MOQ : 10
 · 
10 sold recently
Dalmatian Dog Costume Accessories Plush Headband Tail Bow Tie Mesh Tutu Halloween Party Performance Cosplay Kids
Dalmatian Dog Costume Accessories Plush Headband Tail Bow Tie Mesh Tutu Halloween Party Performance Cosplay Kids
like
Find Similar
Dalmatian spotted faux fur headband featuring plush ears with soft pink inner lining - Plush Dalmatian Headband
Dalmatian spotted dog ears headband for costumes with a 15.0 x 14.2 inch unfolded size - Dalmatian Headband
Plush brown and pink dalmatian dog ears headband for Halloween cosplay costume - Brown Dog Headband
Detailed close-up of bright green and purple plush dalmatian dog ears headband for costumes - Green Dog Headband
+22
Dalmatian Dog Costume Accessories Plush Headband Tail Bow Tie Mesh Tutu Halloween Party Performance Cosplay Kids
$0.35-10.95
Mix MOQ : 2
Halloween Cat Ear Headband Tail Bowtie Tutu Skirt Plush Mesh Animal Costume Accessories For Kids Girls
Halloween Cat Ear Headband Tail Bowtie Tutu Skirt Plush Mesh Animal Costume Accessories For Kids Girls
like
Find Similar
Three-piece black plush cat costume set featuring soft cat ears, tail, and a bow tie - Black Cat 3-Piece Set
Detailed set of pink leopard print cat ears headband with matching bowtie and plush tail - Leopard Print Set
Three-piece tiger stripe cosplay set with cat ear headband, bow tie and plush tail detail - Tiger Set
Detail of a 4-piece black cat costume set with star sequin skirt and plush tail - Sequin 4-Piece Set
+25
Halloween Cat Ear Headband Tail Bowtie Tutu Skirt Plush Mesh Animal Costume Accessories For Kids Girls
$0.43-8.21
Mix MOQ : 5
Cow Costume Accessories Plush Animal Ears Headband Tail Nose Bowtie Tutu Skirt For Halloween Cosplay Party Kids Adults
Cow Costume Accessories Plush Animal Ears Headband Tail Nose Bowtie Tutu Skirt For Halloween Cosplay Party Kids Adults
like
Find Similar
5-piece cow costume set with ears headband, nose, bowtie, tail and sequin tutu skirt - Black and White Cow 5-Piece Set (Adult Skirt)
Kids black and white spotted cow costume set with tutu dress and matching accessories - Black and White Cow 4-Piece Set
Cow costume set with spotted ears, tail, bowtie, gloves and black polka dot mesh skirt - Black and White Cow 7-Piece Set
Cow costume set including black and white plush ears headband with bells and matching tail - Medium Cow 2-Piece Set
+14
Cow Costume Accessories Plush Animal Ears Headband Tail Nose Bowtie Tutu Skirt For Halloween Cosplay Party Kids Adults
$2.36-5.71
Mix MOQ : 2
Vintage Enamel Artificial Pearl Earrings For Women French Retro Baroque Palace Style Alloy Jewelry With Silver Earring Post
Vintage Enamel Artificial Pearl Earrings For Women French Retro Baroque Palace Style Alloy Jewelry With Silver Earring Post
like
Find Similar
Vintage enamel pearl earrings with gold frame and floral pattern on shell tray - Oval Drip Oil Flower Pearl Stud Earrings
Close-up of vintage red seal earrings with golden butterfly motif on white fabric - Drip Oil Irregular Round Butterfly Stud Earrings
Macro shot of vintage gold earrings with red enamel and pearl in a velvet jewelry box - 925 Sterling Silver Earring Post Drip Oil Pearl Square Stud Earrings
Macro shot of vintage round studs with cream enamel, red stones and iridescent gems - 925 Sterling Silver Earring Post Drip Oil Rhinestone Pearl Oval Stud Earrings
+46
Vintage Enamel Artificial Pearl Earrings For Women French Retro Baroque Palace Style Alloy Jewelry With Silver Earring Post
$0.92-5.50
No MOQ
 · 
213 sold recently
Free Shipping
Fabric Flower Tassel Dangle Earrings With Silver Earring Post Zircon Crystal Chiffon Summer Vacation Style For Women
Fabric Flower Tassel Dangle Earrings With Silver Earring Post Zircon Crystal Chiffon Summer Vacation Style For Women
like
Find Similar
Blue fabric flower tassel earrings with pearls on a model in soft summer lighting - Blue Pearl Fabric Flower Tassel (1#)
Golden mesh flower tassel earrings with sparkling rhinestones and crystal center - Gold Mesh Floral Zirconia Tassel (2#)
Colorful beaded flower tassel earrings with fabric floral accents in a clear acrylic finish - Colorful Beaded Flower Leaves (3#)
Vintage gold earrings with colorful crystal tassel fringe in a velvet jewelry box - Vintage Multi-color Crystal Tassel (4#)
+18
Fabric Flower Tassel Dangle Earrings With Silver Earring Post Zircon Crystal Chiffon Summer Vacation Style For Women
$0.84-5.04
No MOQ
Free Shipping
Floral Alloy Enamel Stud Earrings With 925 Sterling Silver Earring Post Vintage French Style Sweet Elegant For Women
Floral Alloy Enamel Stud Earrings With 925 Sterling Silver Earring Post Vintage French Style Sweet Elegant For Women
like
Find Similar
French vintage light blue enamel flower earrings with gold accents on a white plate - Blue Enamel Flower Ear Clips (1# Ear Clip-Gold-Blue)
Elegant gold C-shaped earrings with white enamel coating and crystal flower accents - White Enamel Flower Ear Clips (3# Ear Clip-Gold-White)
Detailed close-up of oval lavender floral earrings with golden frames on a white plush mat - Lavender Floral Oval Studs (4# Silver Pin-White)
Detailed shot of pink and grey geometric resin stud earrings on a ceramic dish - Geometric Acrylic Pink & Grey Studs (6# Silver Pin-Pink)
+7
Floral Alloy Enamel Stud Earrings With 925 Sterling Silver Earring Post Vintage French Style Sweet Elegant For Women
$0.84-2.85
No MOQ
 · 
153 sold recently
Top 10% Best Sellers
in Earrings
Free Shipping
Vintage Court Style Earrings With Artificial Pearl Rhinestone Enamel Geometric Floral Designs And Silver Earring Post For Women
Vintage Court Style Earrings With Artificial Pearl Rhinestone Enamel Geometric Floral Designs And Silver Earring Post For Women
like
Find Similar
Macro detail of vintage gold pearl earrings with sparkling diamond studs on beige fabric - Zirconia Flower Pearl Pendant Ear Hook
Detail of vintage enamel earrings with pearls and floral patterns on a wooden jewelry box - Silver Earring Post Enamel Oval Wheat Ear Pearl Stud Earrings
Detail of vintage heart and rectangular gemstones earrings on black leather case - Silver Earring Post Zirconia Exaggerated Heart Pendant Stud Earrings
Detailed close-up of gold bee earrings with clear rhinestones and hanging pearls - 18k Gold Plated Silver Earring Post Rhinestone Pearl Enamel Bee Stud Earrings
+16
Vintage Court Style Earrings With Artificial Pearl Rhinestone Enamel Geometric Floral Designs And Silver Earring Post For Women
$0.76-3.34
No MOQ
 · 
23 sold recently
Free Shipping
Go to

More in accessories

Explore more in clips

clawsharkartificialshapehandmadedesigncolorswirepearl hairshark clips
stylealloyhairpinheartsolidlongtasselbangspartyplastic hair claw

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access