Everful

Wholesale clips

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Clips

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in clips

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Handmade Elegant Flower Hair Clip Feather Faux Artificial Pearl Mesh Floral Hair Tie For Wedding Party Bridal Beach Women Girls Accessory
Handmade Elegant Flower Hair Clip Feather Faux Artificial Pearl Mesh Floral Hair Tie For Wedding Party Bridal Beach Women Girls Accessory
like
Find Similar
48 options
Handmade Elegant Flower Hair Clip Feather Faux Artificial Pearl Mesh Floral Hair Tie For Wedding Party Bridal Beach Women Girls Accessory
-6%
$0.43-0.51
Mix MOQ : 10
Hair Claw Clips Elegant Geometric Alloy Metal Hairpins With Faux Artificial Pearl Rhinestone For Women Party Daily Accessories
Hair Claw Clips Elegant Geometric Alloy Metal Hairpins With Faux Artificial Pearl Rhinestone For Women Party Daily Accessories
like
Find Similar
Macro shot of triangular gold hair claw with white pearls reflecting on a mirror - Gold Full Pearl Triangle Claw Clip
Detail of gold metal hair claw clip with inlaid white pearls on black background - Gold Full Pearl Square Claw Clip
Detail of a gold alloy claw clip with elegant pearls and sparkling rhinestones - Gold Rhinestone & Pearl Triangle Claw Clip
Macro shot of gold-plated hair claw clip with triangle design and shimmering rhinestones - Gold Full Rhinestone Triangle Claw Clip
+21
Hair Claw Clips Elegant Geometric Alloy Metal Hairpins With Faux Artificial Pearl Rhinestone For Women Party Daily Accessories
$0.52-0.80
No MOQ
Kids Girls Hair Clips Fabric Mesh Glitter Bow Rhinestone Snowflake Princess Style Elegant Hairpins Accessories
Kids Girls Hair Clips Fabric Mesh Glitter Bow Rhinestone Snowflake Princess Style Elegant Hairpins Accessories
like
Find Similar
Blue glitter mesh bow hair clip for girls with a faux gem center on a display card - 3-Crystal Style (Blue Gem)
Sparkly mint green and purple mesh bow hair clip for girls with a blue crystal center - 1-Streamer Style (Mint Green Gradient)
Blue glitter bow hair clip with silver snowflake and white lace on display card - 2-Snowflake Style (Blue Sequins)
Kids Girls Hair Clips Fabric Mesh Glitter Bow Rhinestone Snowflake Princess Style Elegant Hairpins Accessories
$1.15
No MOQ
 · 
17 views
Free Shipping
Elegant Long Tassel Rhinestone Hair Clip Ponytail Holder Sparkling Metal Hair Accessory For Women Party Jewelry
Elegant Long Tassel Rhinestone Hair Clip Ponytail Holder Sparkling Metal Hair Accessory For Women Party Jewelry
like
Find Similar
Elegant long tassel rhinestone ponytail clip with shimmering crystal chains in gold - Gold E6302 / Gold
Sparkling silver rhinestone long tassel hair clip for high ponytail styling on a model - Silver E6303 / Silver
Elegant Long Tassel Rhinestone Hair Clip Ponytail Holder Sparkling Metal Hair Accessory For Women Party Jewelry
$4.61
Mix MOQ : 2
Men's Business Metal Tie Clip Alloy Electroplated Simple Striped Tie Bar For Formal Shirt Suit Wedding Party Men Jewelry
Men's Business Metal Tie Clip Alloy Electroplated Simple Striped Tie Bar For Formal Shirt Suit Wedding Party Men Jewelry
like
Find Similar
Polished black metal necktie clip for men featuring three stylish vertical grooves - Black
Classic navy blue business tie clip for men with a polished metallic finish and grooves - Dark Blue
Classic gold-tone men's business tie clip with sleek parallel vertical grooves - Gold
Sleek purple metal necktie clip with vertical textured lines for business formal wear - Purple
+2
Men's Business Metal Tie Clip Alloy Electroplated Simple Striped Tie Bar For Formal Shirt Suit Wedding Party Men Jewelry
-9%
$1.00
No MOQ
Free Shipping
Acetate Bird Shape Hair Claw Clip For Women Colorful Parrot Hummingbird Design Non-Slip Large Hair Catch Barrette Accessories
Acetate Bird Shape Hair Claw Clip For Women Colorful Parrot Hummingbird Design Non-Slip Large Hair Catch Barrette Accessories
like
Find Similar
Vibrant red parrot acetate hair claw clip with colorful wings and marble texture - Red Parrot
Green parrot hair claw clip made of colorful acetate with measurement 12.3cm and 30g weight - Green Parrot
Colorful hummingbird acetate hair claw clip for women in vibrant green and orange - Orange Hummingbird
Colorful hummingbird acetate hair claw in purple and green marble texture finish - Blue-Green Hummingbird
+1
Acetate Bird Shape Hair Claw Clip For Women Colorful Parrot Hummingbird Design Non-Slip Large Hair Catch Barrette Accessories
$3.74-4.03
No MOQ
Free Shipping
Large Square Hair Claw Clips Hollow Rectangular Matte Glossy Leopard Print PC Plastic Hair Clips For Women
Large Square Hair Claw Clips Hollow Rectangular Matte Glossy Leopard Print PC Plastic Hair Clips For Women
like
Find Similar
Large translucent amber leopard print hair claw clip in a glossy resin finish - Jelly Tea Green
Square dark brown tortoiseshell hair claw clip in glossy finish on a woven mat - Red Tortoiseshell
Elegant tortoiseshell brown hollow square hair claw clip in a stylish glossy finish - Yellow Tortoiseshell
Matte black rectangular leopard hollow hair claw clip for elegant hair styling - Matte Black
+33
Large Square Hair Claw Clips Hollow Rectangular Matte Glossy Leopard Print PC Plastic Hair Clips For Women
-4%
$0.82-1.59
No MOQ
Acetate Hair Claw Clip Liquid Melting Design Marble Shell Shape Retro Hair Accessories Fashion For Women
Acetate Hair Claw Clip Liquid Melting Design Marble Shell Shape Retro Hair Accessories Fashion For Women
like
Find Similar
Pink and yellow acetate hair claw clip in a cute cake design with orange handle - 8.5cm / Yellow-Pink
Acetate hair claw clip in purple and yellow pattern with pink handle on wooden table - 8.5cm / Yellow & Purple
Acetate hair claw clip in purple and blue melt pattern with a green circular handle - 8.5cm / Blue and Purple
Pink handbag shaped acetate hair claw with white melting drip pattern detail - 8.5cm / Rose Pink
+22
Acetate Hair Claw Clip Liquid Melting Design Marble Shell Shape Retro Hair Accessories Fashion For Women
$0.60-3.68
No MOQ
Free Shipping
Handmade Crystal Beaded Headband Hair Clip Colorful Braided Gold Wire Geometric Fashion Bohemian Hair Accessories For Women
Handmade Crystal Beaded Headband Hair Clip Colorful Braided Gold Wire Geometric Fashion Bohemian Hair Accessories For Women
like
Find Similar
Irregular crystal headband with gold wire weaving and amber rhinestones on red silk - Hair Clip / Champagne
Elegant gold-wired hair clip with faceted red and amber crystal beads on metal base - Hair Clip / Red
Handmade Crystal Beaded Headband Hair Clip Colorful Braided Gold Wire Geometric Fashion Bohemian Hair Accessories For Women
$0.41
No MOQ
 · 
1 reviews
Velvet Bow Hair Clips Sweet Korean Style Side Duckbill Clips Fashion Hair Accessories For Women Girls
Velvet Bow Hair Clips Sweet Korean Style Side Duckbill Clips Fashion Hair Accessories For Women Girls
like
Find Similar
Detailed view of a dark red velvet bow hair clip resting on a soft white knit fabric texture - Burgundy
Close-up of dark brown velvet bow hair clip on a white knit sweater texture - Brown
Detail of a black velvet bow clip featuring rich texture on a cream knitted sweater - Black
Close-up of white velvet bow hair clip on beige knit fabric showing soft plush texture - Beige
Velvet Bow Hair Clips Sweet Korean Style Side Duckbill Clips Fashion Hair Accessories For Women Girls
-5%
$0.19
No MOQ
 · 
130 sold recently
Vintage Checkered Gingham Hair Claw Clip Plaid Resin Shark Clip For Women Elegant Korean Hair Styling Accessory Hairclip
Vintage Checkered Gingham Hair Claw Clip Plaid Resin Shark Clip For Women Elegant Korean Hair Styling Accessory Hairclip
like
Find Similar
Detail shot of U-shaped hair claw clip with black and white checkered pattern resin finish - Black
Top view of a blue and white gingham resin hair claw clip with a polished finish - Light Blue
Detail view of the vintage blue gingham resin hair claw clip on a lace background - Dark Blue
Detailed view of the red and white gingham pattern resin hair claw clip on white lace - Red
Vintage Checkered Gingham Hair Claw Clip Plaid Resin Shark Clip For Women Elegant Korean Hair Styling Accessory Hairclip
$0.81
No MOQ
 · 
11 sold recently
Acetate Hair Claw With Colorful Rhinestones French Style Elegant Shark Clip Non-slip Large Hair Accessory For Women
Acetate Hair Claw With Colorful Rhinestones French Style Elegant Shark Clip Non-slip Large Hair Accessory For Women
like
Find Similar
Detail of red acetate hair claw clip with colorful rhinestones on a beige display tray - Red
Acetate Hair Claw With Colorful Rhinestones French Style Elegant Shark Clip Non-slip Large Hair Accessory For Women
-4%
$2.99
No MOQ
 · 
15 sold recently
Large Acrylic Hair Claw Clip French Style Non Slip Strong Hold For Women Girls Elegant Leopard Print Solid Color Accessory
Large Acrylic Hair Claw Clip French Style Non Slip Strong Hold For Women Girls Elegant Leopard Print Solid Color Accessory
like
Find Similar
Detailed view of glossy dark red acrylic hair claw clip with multiple teeth on wood tray - Deep Red (27620A)
Detailed view of large dark brown hair claw clip on linen cloth with wooden tray background - Deep Coffee (27620B)
Detailed view of large black shark clip with high-gloss finish on a walnut tray - Glossy Black (27620C)
Detail shot of a large leopard print hair claw clip in a classic tortoiseshell pattern - Leopard Print (27620D)
Large Acrylic Hair Claw Clip French Style Non Slip Strong Hold For Women Girls Elegant Leopard Print Solid Color Accessory
$0.61
No MOQ
 · 
11 views
Pastoral Cute Daisy Flower Hair Clip Set For Women Girls Metal Alloy Enamel Drip Oil Alligator Clips Bobby Pins Headwear
Pastoral Cute Daisy Flower Hair Clip Set For Women Girls Metal Alloy Enamel Drip Oil Alligator Clips Bobby Pins Headwear
like
Find Similar
Cute daisy hair clip set with white petals and gold plating on a display card - Bobby Pin And Alligator Clip Set / White Flower Set
Cute pink daisy hair clip set with gold finish and floral drip oil design on white card - Bobby Pin And Alligator Clip Set / Pink Flower Set
Set of two daisy flower hair clips in gold alloy with yellow enamel on pink satin - Bobby Pin And Alligator Clip Set / Yellow Flower Set
Three-piece set of small daisy hair clips in white, yellow, and pink colors - Bobby Pin Set / Multicolor Bobby Pin Combination
+3
NewPastoral Cute Daisy Flower Hair Clip Set For Women Girls Metal Alloy Enamel Drip Oil Alligator Clips Bobby Pins Headwear
-5%
$0.86-2.46
No MOQ
Free Shipping
Children Bow Hair Clip Set Handmade Polyester Fabric Floral Check Pattern Mini Hairpins For Girls Toddlers Cute Hair Accessories
Children Bow Hair Clip Set Handmade Polyester Fabric Floral Check Pattern Mini Hairpins For Girls Toddlers Cute Hair Accessories
like
Find Similar
5-piece floral and green bow hair clip set for girls on a white display card - Fresh Green Series (5B)
5-piece set of girls cute hair clips with red bows and velvet fabric on card board - Vintage Red Brown Series (5C)
5-piece set of girls' cute hair clips with black and yellow bow tie patterns - Black White Fashion Series (5D)
Five-piece pink floral bow hair clip set with daisy embroidery and pearls on display card - Sweet Pink Series (5E)
+7
Children Bow Hair Clip Set Handmade Polyester Fabric Floral Check Pattern Mini Hairpins For Girls Toddlers Cute Hair Accessories
$1.33-3.89
No MOQ
Free Shipping
Matte Hair Claw Clips Korean Style Large Plastic Nonslip Shark Hair Clamps For Women Elegant Minimalist Flower Accessories
Matte Hair Claw Clips Korean Style Large Plastic Nonslip Shark Hair Clamps For Women Elegant Minimalist Flower Accessories
like
Find Similar
Matte black large shark hair claw clip with cross spiral design and 11.5cm length - Matte Black Cross Style
Elegant 6.2cm cream square matte claw clip for hair styling with minimalist design - Milk White Square
Elegant cream-colored matte claw clip with rabbit ear design and gold metal hinge - Milk White Butterfly
Brown butterfly hair claw clip in matte finish with gold spring, 6cm size for women - Milk Coffee Butterfly
+17
Matte Hair Claw Clips Korean Style Large Plastic Nonslip Shark Hair Clamps For Women Elegant Minimalist Flower Accessories
$0.23-0.37
No MOQ
 · 
27 sold recently
Alloy Metal Butterfly Square Hair Claw Clips With Long Tassel Beads Pendant Hollow Out Shark Clips For Women Elegant
Alloy Metal Butterfly Square Hair Claw Clips With Long Tassel Beads Pendant Hollow Out Shark Clips For Women Elegant
like
Find Similar
Gold rectangular metal hair claw clip with long tassels and champagne beads - Square - Beads / Gold
Detail of golden metal butterfly hair claw clip with long tassels and small butterfly charms - Butterfly - Tassel Butterfly / Gold
Golden butterfly hair claw clip with gradient butterfly tassels held by hand - Hollow Butterfly - Tassel Butterfly / Gold
Detail of golden butterfly hair claw clip with long fringe tassels and crystal beads - Butterfly - Beads / Gold
Alloy Metal Butterfly Square Hair Claw Clips With Long Tassel Beads Pendant Hollow Out Shark Clips For Women Elegant
$1.30
No MOQ
 · 
84 sold recently
Vintage Acetate Bowknot Hair Clip Elegant Twisted Ribbon Duckbill Clip For Women Minimalist Sweet Hair Accessories Headwear
Vintage Acetate Bowknot Hair Clip Elegant Twisted Ribbon Duckbill Clip For Women Minimalist Sweet Hair Accessories Headwear
like
Find Similar
Macro shot of a minimalist olive green acetate hair clip with a stylish knotted design - Lime Green
Elegant tortoiseshell pattern acetate ribbon bow hair clip with gold metal base - Coffee Tortoise Shell
Minimalist cream beige bow knot hair clip with high-quality resin finish and gold metal base - Cream White
Elegant milky white acetate bow hair clip with gold metal base for women's hairstyle - Pearl White
+2
Vintage Acetate Bowknot Hair Clip Elegant Twisted Ribbon Duckbill Clip For Women Minimalist Sweet Hair Accessories Headwear
$1.08
No MOQ
Free Shipping
Halloween Hair Accessories Bat Wings Devil Horns Pumpkin Ghost Headband Hair Clip Cosplay Party Decorations Ornament
Halloween Hair Accessories Bat Wings Devil Horns Pumpkin Ghost Headband Hair Clip Cosplay Party Decorations Ornament
like
Find Similar
Pair of red devil bat wing hair clips for Halloween party costume hair styling - Red Bat Wing Hair Clip
Pair of black bat wing hair clips for Halloween party with metal duckbill base - Black Bat Wing Hair Clip
Detail of purple and black sequin bat wing bow hair clip for Halloween costumes - Bowtie Bat Wing Hair Clip
Halloween orange bow hair clip with black glitter spider and web on display card - Spider Web And Spider Hair Clip - Yellow
+19
Halloween Hair Accessories Bat Wings Devil Horns Pumpkin Ghost Headband Hair Clip Cosplay Party Decorations Ornament
$0.17-1.53
No MOQ
 · 
22 sold recently
French Style Cellulose Acetate Hair Claw Clip Square Hollow Leopard Marble Print Minimalist Small Shark Hair Clip For Women
French Style Cellulose Acetate Hair Claw Clip Square Hollow Leopard Marble Print Minimalist Small Shark Hair Clip For Women
like
Find Similar
French tortoiseshell acetate hair claw clip with a square design for elegant styling - Leopard Print
Chic square hair claw clip featuring a stylish black and white cow print pattern - Cow Pattern
Beige and white marble patterned acetate hair claw clip with a square design - Off White
French style square hair claw clip in classic tortoiseshell resin finish for women - Light Leopard
+1
French Style Cellulose Acetate Hair Claw Clip Square Hollow Leopard Marble Print Minimalist Small Shark Hair Clip For Women
$1.87
No MOQ
Free Shipping
Flower Hair Claw Clip Iridescent Transparent Plastic Non Slip Strong Hold Styling Accessory For Women Elegant Plumeria
Flower Hair Claw Clip Iridescent Transparent Plastic Non Slip Strong Hold Styling Accessory For Women Elegant Plumeria
like
Find Similar
Iridescent light blue flower hair claw clip with triple blossom design in matte finish - 5# Gradient Pearlescent Light Blue Plumeria
Matte gold floral shark hair claw clip with rainbow iridescent finish for women - 6# Gradient Pearlescent Gold Plumeria
Detail of pink gradient resin flower hair claw clip with transparent 3D petals - 1# Gradient Pearlescent Pink Plumeria
Translucent matte floral hair claw clip with colorful iridescent finish on beige background - 3# Gradient Pearlescent Yellow-Green Plumeria
+6
Flower Hair Claw Clip Iridescent Transparent Plastic Non Slip Strong Hold Styling Accessory For Women Elegant Plumeria
$0.43-0.52
No MOQ
 · 
35 sold recently
Paisley Pattern Bowknot Hair Claw Clip Acrylic Fabric Retro French Style Hairpin Accessory For Women Girls
Paisley Pattern Bowknot Hair Claw Clip Acrylic Fabric Retro French Style Hairpin Accessory For Women Girls
like
Find Similar
French style paisley heart bow hair claw clip in black and white fabric finish - Hair Tie / Black and White Paisley Hair Tie
Classic black and white paisley heart hair claw clip with fabric bow knot detail - Bow Claw Clip / Black and White Paisley Double-sided Claw
Blue and purple paisley bow hair claw clip with vintage pattern on white paper background - Bow Claw Clip / Blue-Purple Gradient Paisley Claw
Classic black paisley heart hair claw clip with a white bow detail for women - Black Bowknot Print Claw
+11
Paisley Pattern Bowknot Hair Claw Clip Acrylic Fabric Retro French Style Hairpin Accessory For Women Girls
-34%
$0.28-1.70
No MOQ
Large Acetate Hair Claw Clip For Women French Style Non-Slip Matte Tortoise Shell Barrette Hair Styling Accessories
Large Acetate Hair Claw Clip For Women French Style Non-Slip Matte Tortoise Shell Barrette Hair Styling Accessories
like
Find Similar
Elegant deep red acetate hair claw clip with gold lettering on a vintage background - Burgundy
Detailed view of an amber acetate hair claw clip with French lettering on white silk fabric - Brown
Detailed close-up of cream acetate hair claw clip with Barrette La France gold lettering - White
Detail of tortoiseshell acetate hair claw clip with Barrette la France logo lettering - Blue Brown Marble
+1
Large Acetate Hair Claw Clip For Women French Style Non-Slip Matte Tortoise Shell Barrette Hair Styling Accessories
-5%
$2.41
No MOQ
Free Shipping
Rhinestone Faux Artificial Pearl Alloy Hair Clips Sparkling Star Moon Letter Snowflake Fashion Hairpins Decorative Headwear For Women
Rhinestone Faux Artificial Pearl Alloy Hair Clips Sparkling Star Moon Letter Snowflake Fashion Hairpins Decorative Headwear For Women
like
Find Similar
Detailed view of 6 gold rhinestone hair clips with exact measurements and sizes - HS-J6776 Gold 6-Piece Set
Set of 6 gold metal hair clips with colorful rhinestones in various shapes and sizes - HS-J6779 Colorful 6-Piece Set
Set of 5 colorful rhinestone hair clips with various sizes and detailed dimensions - HS-J6781 Candy Color 5-Piece Set
Purple rhinestone hair clip set for girls featuring detailed dimensions and materials - HS-J6778 Purple 4-Piece Set
+4
Rhinestone Faux Artificial Pearl Alloy Hair Clips Sparkling Star Moon Letter Snowflake Fashion Hairpins Decorative Headwear For Women
-5%
$2.74-4.65
No MOQ
 · 
12 views
Free Shipping
Large Scallop Shell Hair Claw Clips For Women Pearl Iridescent Plastic Hair Jaw Clips Elegant Summer Beach Hair Accessories
Large Scallop Shell Hair Claw Clips For Women Pearl Iridescent Plastic Hair Jaw Clips Elegant Summer Beach Hair Accessories
like
Find Similar
Pearlescent pink seashell claw clip with elegant fan-shaped texture for summer - Individual Packaging / Pearl Light Pink
Iridescent light blue scallop shell hair claw clip with a pearlescent textured finish - Bulk Packaging / Holographic Blue
Pearlescent white shell shaped hair claw clip with nautical design for women - Bulk Packaging / Pearlescent Milky White
Holographic seashell hair claw clip with iridescent finish and ribbed shell texture - Bulk Packaging / AB Iridescent Blue and Yellow
+18
Large Scallop Shell Hair Claw Clips For Women Pearl Iridescent Plastic Hair Jaw Clips Elegant Summer Beach Hair Accessories
$0.46-0.63
No MOQ
Handmade Crochet Christmas Hair Clips Knitted Santa Claus Christmas Tree Gingerbread Man Artificial Pearl Hairpin
Handmade Crochet Christmas Hair Clips Knitted Santa Claus Christmas Tree Gingerbread Man Artificial Pearl Hairpin
like
Find Similar
Handmade Christmas hair clip set with red plaid fabric and velvet bow design - Vintage Plaid Bow (Hanns) / White Red Striped Drop Clip Bow (25#)
Handmade spiral crochet hair tie with colorful yarn wrap in vibrant orange and purple - Christmas Colorful Telephone Wire Coil (20#)
Close-up of handmade crochet Christmas tree hair clip with red bow and pearl detail - Green Wavy Oval Red Bow (2#)
Detail of handmade crochet hair clip with vintage red base and green scalloped edge - Red Green Pleated Wool Clip (3#)
+21
Handmade Crochet Christmas Hair Clips Knitted Santa Claus Christmas Tree Gingerbread Man Artificial Pearl Hairpin
$0.84-1.67
No MOQ
Free Shipping
Handmade Large Grosgrain Ribbon Bow Hair Clip With Long Tails Sweet Polyester Solid Color Streamer Hairpins For Girls Kids
Handmade Large Grosgrain Ribbon Bow Hair Clip With Long Tails Sweet Polyester Solid Color Streamer Hairpins For Girls Kids
like
Find Similar
Handmade large purple cheer bow hair clip with long tails in grosgrain ribbon - Purple Bow (#1)
Handmade large lime green grosgrain ribbon hair bow with long tails for children - Lime Green Bow (#2)
Vibrant orange grosgrain ribbon bow hair clip with elegant long swallowtail streamers - Orange Bow (#3)
Handmade rose red grosgrain ribbon bow hair clip with long tails for children - Rose Red Bow (#4)
+21
NewHandmade Large Grosgrain Ribbon Bow Hair Clip With Long Tails Sweet Polyester Solid Color Streamer Hairpins For Girls Kids
$0.35
Mix MOQ : 2
Cute Cat Shape Acetate Hair Clip And Hair Tie Set Cartoon Leopard Print Rhinestone Bow Hair Accessories For Women Girls
Cute Cat Shape Acetate Hair Clip And Hair Tie Set Cartoon Leopard Print Rhinestone Bow Hair Accessories For Women Girls
like
Find Similar
Detail of white marble resin cat hair tie with pink rhinestone collar and brown bow decoration - 2# White Hair Tie
Detailed close-up of a brown leopard cat hair tie with crystal collar and bow on card - 3# Coffee Hair Tie
Cute leopard print cat hair tie with high elastic band and blue bowknot ornament - 4# Leopard Hair Tie
Detailed macro of leopard print cat hair clip with blue bow and colorful gemstones - 5# Leopard Hair Clip
+3
Cute Cat Shape Acetate Hair Clip And Hair Tie Set Cartoon Leopard Print Rhinestone Bow Hair Accessories For Women Girls
$1.59
No MOQ
Free Shipping
Elegant Rhinestone Star Hair Claw Clip Resin Shark Clip For Women Hair Styling Accessories
Elegant Rhinestone Star Hair Claw Clip Resin Shark Clip For Women Hair Styling Accessories
like
Find Similar
Elegant mint green hair claw clip with sparkling star rhinestones for women - 6cm / Green
Detailed macro view of white pearlescent hair claw clip with silver rhinestone star patterns - 6cm / White
Detail view of tortoiseshell hair claw clip with star shaped rhinestone embellishments - 6cm / Tortoise
Elegant black shark hair claw clip with sparkling rhinestones on a minimalist tray - 6cm / Black
+2
Elegant Rhinestone Star Hair Claw Clip Resin Shark Clip For Women Hair Styling Accessories
$0.40-0.48
Mix MOQ : 2
Handmade Fabric Floral Snap Hair Clips Sweet Girl Plaid Pattern Mini Hair Pins For Women Kids Hair Accessories
Handmade Fabric Floral Snap Hair Clips Sweet Girl Plaid Pattern Mini Hair Pins For Women Kids Hair Accessories
like
Find Similar
Floral fabric snap hair clip with pink base and red flower embroidery pattern - Pink Floral
Pink floral lace hair clip in teardrop shape with intricate floral embroidery - Pink Lace Embroidery (4)
Sweet cream floral embroidery teardrop hair clip with elegant scalloped edge detail - Off-White Handmade Embroidery (6)
Sweet pink fabric BB hair clip with white flower embroidery for girls - Pink White Flower Embroidery (1)
+42
Handmade Fabric Floral Snap Hair Clips Sweet Girl Plaid Pattern Mini Hair Pins For Women Kids Hair Accessories
$0.11
Mix MOQ : 10
Satin Bow Hair Clip Large Glossy Solid Color Lolita Academy Style Duckbill Hairpin For Girls Kids
Satin Bow Hair Clip Large Glossy Solid Color Lolita Academy Style Duckbill Hairpin For Girls Kids
like
Find Similar
Elegant navy blue satin bow hair clip with a smooth glossy finish for women and girls - Navy Blue (1)
Large black glossy satin bow hair clip with ribbons for girls in lolita school style - Black (4)
Navy blue satin bow hair clip with metallic finish and pearlescent texture for girls - Metallic Navy Blue (6)
Pink satin bow hair clip for girls with a glossy silk texture and Lolita style aesthetic - Champagne Pink (8)
+16
Satin Bow Hair Clip Large Glossy Solid Color Lolita Academy Style Duckbill Hairpin For Girls Kids
-5%
$0.33
Mix MOQ : 10
 · 
12 sold recently
Cute Cartoon Dog Hair Clip Acrylic Party Hat Birthday Hairpin Side Clips For Girls Kids Sweet Hair Accessories
Cute Cartoon Dog Hair Clip Acrylic Party Hat Birthday Hairpin Side Clips For Girls Kids Sweet Hair Accessories
like
Find Similar
Cute black puppy hair clip with pink birthday hat on beige leather background - Black Birthday Dog
Close-up of a cute yellow cartoon puppy hair clip with a party hat on a desk - Yellow Birthday Dog
Close-up of cream cartoon dog hair clip with striped party hat on a textured background - White Birthday Dog
Detail of pink cartoon dog hair clip with a blue striped party hat on a beige background - Pink Birthday Dog
+1
Cute Cartoon Dog Hair Clip Acrylic Party Hat Birthday Hairpin Side Clips For Girls Kids Sweet Hair Accessories
-5%
$0.37
No MOQ
 · 
13 sold recently
Vintage Velvet Hair Clips Geometric Teardrop Rectangle BB Pins Retro Alloy Headwear For Women Autumn Winter Style
Vintage Velvet Hair Clips Geometric Teardrop Rectangle BB Pins Retro Alloy Headwear For Women Autumn Winter Style
like
Find Similar
Macro detail of olive green velvet rectangular hair clip with silver metal interior - Square / Yellow
Detail of vintage olive green velvet hair clip against a minimalist aesthetic background - Water Drop / Yellow
Detail of dark green velvet teardrop hair clip with silver metal snap closure - Water Drop / Dark Green
Detailed view of coffee brown velvet waterdrop hair clip on elegant paper background - Water Drop / Brown
+8
Vintage Velvet Hair Clips Geometric Teardrop Rectangle BB Pins Retro Alloy Headwear For Women Autumn Winter Style
-5%
$1.04
No MOQ
Free Shipping
Fashion Hair Clips Alloy Faux Artificial Pearl Rhinestone Duckbill Side Pins Bear Feather Flower Heart Shapes Elegant Women Girls
Fashion Hair Clips Alloy Faux Artificial Pearl Rhinestone Duckbill Side Pins Bear Feather Flower Heart Shapes Elegant Women Girls
like
Find Similar
5-piece gold hair clip set featuring bear, bee, black rose, pearls and rhinestones - Bear 5-Piece Set
Golden hair clip set with artificial pearls and rhinestone scissors on a display card - Scissors Feather 6-Piece Set
Golden hair clip set with cream pearls, rhinestone bow, and cute bear charm details - Starry Sea 5-Piece Set
Detail of 6-piece hair clip set with faux pearls, gold alloy, and floral resin charms - Sweet Journey Group A 5-Piece Set
+7
Fashion Hair Clips Alloy Faux Artificial Pearl Rhinestone Duckbill Side Pins Bear Feather Flower Heart Shapes Elegant Women Girls
-5%
$0.99-1.86
No MOQ
 · 
28 sold recently
Vintage Leaf Scissor Metal Hair Clips Gold Alloy Rhinestone Bobby Pins Elegant Hair Accessories For Women
Vintage Leaf Scissor Metal Hair Clips Gold Alloy Rhinestone Bobby Pins Elegant Hair Accessories For Women
like
Find Similar
Vintage golden leaf hair clip with berry detail on a clean minimalist background - 3#-Berry Branch
Close-up of golden metal feather hair clip with vintage texture on white background - 9#-Large Feather
Close-up of golden metal hair clip with rhinestone flower leaf and pearl accents - 12#-Flower Pearl Leaf
Elegant gold metal leaf hair clip in a vintage branch design on a clean white background - 13#-Double Row Slim Leaves
+9
Vintage Leaf Scissor Metal Hair Clips Gold Alloy Rhinestone Bobby Pins Elegant Hair Accessories For Women
$0.26
Mix MOQ : 2
 · 
27 sold recently
French Elegant Acetate Marble Pattern Hair Claw Clips For Women Gold Glitter Non-Slip Large Small Ponytail Holder Hair Clips Accessories
French Elegant Acetate Marble Pattern Hair Claw Clips For Women Gold Glitter Non-Slip Large Small Ponytail Holder Hair Clips Accessories
like
Find Similar
Detail of blue marble acetate hair claw clip with gold flakes in a jewelry tray - Large / Blue Gold
Macro detail of acetate claw clip with tortoise texture and gold glitter accents - Large / Grey Gold
Macro detail of large acetate hair claw clip with orange and blue marble sand texture - Large / Platinum
Close-up of pink marble acetate hair claw clip with golden glitter on beige tray - Large / Pink Gold
+4
French Elegant Acetate Marble Pattern Hair Claw Clips For Women Gold Glitter Non-Slip Large Small Ponytail Holder Hair Clips Accessories
$1.15-1.73
No MOQ
Free Shipping
Butterfly Tassel Hair Clip Alloy Faux Artificial Pearl Hollow Traditional Chinese Style Ethnic Vintage Elegant Hair Accessory
Butterfly Tassel Hair Clip Alloy Faux Artificial Pearl Hollow Traditional Chinese Style Ethnic Vintage Elegant Hair Accessory
like
Find Similar
Silver butterfly hair clip with tassel and pearls on a premium dark wooden background - Silver Butterfly
Butterfly Tassel Hair Clip Alloy Faux Artificial Pearl Hollow Traditional Chinese Style Ethnic Vintage Elegant Hair Accessory
-4%
$1.53
No MOQ
 · 
10 sold recently
French Style Marbled Acetate Hair Claw Clip For Women Elegant Sweet Hair Clips Small Shark Clip Daily Hair Accessories
French Style Marbled Acetate Hair Claw Clip For Women Elegant Sweet Hair Clips Small Shark Clip Daily Hair Accessories
like
Find Similar
Detail of elegant acetate hair claw with blue marble pattern and gold French lettering - Blue Polka Dot
Macro detail of French style acetate hair claw with colorful marbled pattern texture - Iridescent Red
Detail shot of multicolor marble acetate hair claw with gold Barrette La France lettering - Green Pink
Detail of pink marble acetate hair claw clip with golden lettering and metal spring mechanism - Pink
+1
French Style Marbled Acetate Hair Claw Clip For Women Elegant Sweet Hair Clips Small Shark Clip Daily Hair Accessories
$1.73
No MOQ
Free Shipping
Sweet Girls Strawberry Bow Hair Clip Headband Organza Sequin Hair Accessories Pink Blue Purple Preppy Style Hairpins For Children
Sweet Girls Strawberry Bow Hair Clip Headband Organza Sequin Hair Accessories Pink Blue Purple Preppy Style Hairpins For Children
like
Find Similar
Pink organza hair bow clip for girls featuring sequined strawberry design and handmade details - Pink Hair Clip
Light blue mesh bow hair clip with sequin strawberry held on a white display card - Blue Hair Clip
Close-up of sky blue organza bow hair clip with a sequined strawberry charm detail - Blue Headband
Detail of organza bow headband with shimmering aurora finish and sequin strawberry motif - Pink Headband
+2
Sweet Girls Strawberry Bow Hair Clip Headband Organza Sequin Hair Accessories Pink Blue Purple Preppy Style Hairpins For Children
$1.10-1.24
No MOQ
Acetate Hair Claw Clips Green Marble Pattern Elegant Hairpins Simple Hair Accessories For Women
Acetate Hair Claw Clips Green Marble Pattern Elegant Hairpins Simple Hair Accessories For Women
like
Find Similar
Elegant green marbled resin hair stick hairpin with smooth textured finish for women - Green Marble (Horn Clip)
Minimalist green and white marble pattern resin hair claw clip with smooth finish - Green & White Marble (Grab 10)
Minimalist green marble pattern acetate hair claw clip with a glossy finish - Green Marble (Grab 7)
Acetate hair claw clip featuring dark green and cream marble patterns on white background - Dark Green & Cream Marble (Grab 9)
+9
Acetate Hair Claw Clips Green Marble Pattern Elegant Hairpins Simple Hair Accessories For Women
-5%
$1.01-1.59
No MOQ
Girls Hair Clips Alloy Metal Leaf Branch Scissors Shape Vintage Retro Gold Silver Barrette Bobby Pins
Girls Hair Clips Alloy Metal Leaf Branch Scissors Shape Vintage Retro Gold Silver Barrette Bobby Pins
like
Find Similar
Golden leaf branch metal hair clip for women on a textured dark background - Five Leaves Hair Clip / Gold
Elegant gold leaf metal hair clip with three detailed textured leaves for women - Three Leaves Bobby Pin / Gold
Silver leaf-shaped metal hair clip featuring detailed botanical leaf texture on a barrette - Three Leaves Bobby Pin / Silver
Creative gold metal hair clip in scissors shape for women with polished finish - Scissor Bobby Pin / Gold
+1
Girls Hair Clips Alloy Metal Leaf Branch Scissors Shape Vintage Retro Gold Silver Barrette Bobby Pins
-6%
$0.15
No MOQ
 · 
17 views
Women PC Hollow Oval Hair Clip Minimalist Matte Glossy Duckbill Clip Strong Grip Hair Claw Elegant Simple Hair Styling Tool Daily Hair Accessories
Women PC Hollow Oval Hair Clip Minimalist Matte Glossy Duckbill Clip Strong Grip Hair Claw Elegant Simple Hair Styling Tool Daily Hair Accessories
like
Find Similar
Matte black oval PC hair clip for women with strong grip for elegant hairstyles - Individual Bagged / Matte Black
Creamy white flat oval PC hair clip with strong grip and minimalist elegant matte finish - Individual Bagged / Matte Cream White
Navy blue flat oval matte hair clip with hollowed-out slots and strong grip for women - Individual Bagged / Matte Navy Blue
Flat oval hair claw clip in matte dusty pink finish with strong grip for styling - Individual Bagged / Matte Lotus Pink
+16
Women PC Hollow Oval Hair Clip Minimalist Matte Glossy Duckbill Clip Strong Grip Hair Claw Elegant Simple Hair Styling Tool Daily Hair Accessories
$0.74-0.77
No MOQ
Vintage Blue Rhinestone Crystal Faux Artificial Pearl Hair Clips Alloy Barrettes Elegant Spring Clip Hairpin Accessory For Women
Vintage Blue Rhinestone Crystal Faux Artificial Pearl Hair Clips Alloy Barrettes Elegant Spring Clip Hairpin Accessory For Women
like
Find Similar
Leaf-shaped rhinestone hair clip in deep blue and antique silver finish for women - Navy Blue Leaf
Elegant vintage silver hair clip with deep blue crystal floral motif and rhinestones - Navy Blue Bow Small 6.8cm
Vintage silver butterfly hair clip with deep blue rhinestones and heart-shaped crystals - Navy Blue Heart Small 6.8cm
Vintage silver butterfly hair clip with deep blue crystals and hollow rhinestones - Navy Blue Butterfly Small 6.8cm
+10
Vintage Blue Rhinestone Crystal Faux Artificial Pearl Hair Clips Alloy Barrettes Elegant Spring Clip Hairpin Accessory For Women
$0.72-1.04
No MOQ
 · 
16 sold recently
Square Hair Claw Clip Matte Plastic Geometric Hollow Out Shark Clip For Women Elegant Minimalist Hairpins Headwear
Square Hair Claw Clip Matte Plastic Geometric Hollow Out Shark Clip For Women Elegant Minimalist Hairpins Headwear
like
Find Similar
Detail view of pink matte square hair claw clip with smooth frosted texture on a book - Matte Large Square Khaki
Detail of a matte purple rectangular cutout hair claw clip on an open book - Matte Large Square Purple Pink
Elegant minimalist cream-colored frosted large hair claw clip for bun hairstyles decoration - Matte Large Square Yellow
Close-up of a large matte pink hair claw clip resting on a book in a cozy setting - Matte Large Square Light Pink
+24
Square Hair Claw Clip Matte Plastic Geometric Hollow Out Shark Clip For Women Elegant Minimalist Hairpins Headwear
$0.35-0.55
No MOQ
Korean Style Cute Patterned Hair Clips For Girls Women Plastic Alloy Handmade Checkboard Floral Plaid Duckbill Clips Accessory
Korean Style Cute Patterned Hair Clips For Girls Women Plastic Alloy Handmade Checkboard Floral Plaid Duckbill Clips Accessory
like
Find Similar
Detail of three pink patterned hair clips featuring rainbow dots, stripes, and checks - Bobby Pin / Pink
Three-piece set of duckbill hair clips with wood grain, plaid, and floral patterns - Bobby Pin / Yellow
Detailed view of three blue checkered and striped hair clips on accessory card - Bobby Pin / Blue
Close-up of three green patterned duckbill hair clips with accessories display packaging - Bobby Pin / Green
+10
Korean Style Cute Patterned Hair Clips For Girls Women Plastic Alloy Handmade Checkboard Floral Plaid Duckbill Clips Accessory
$0.58-0.72
No MOQ
Natural Crystal Stone Gravel Hair Clips Handmade Gold Alloy Bobby Pins Retro Hair Accessories For Women
Natural Crystal Stone Gravel Hair Clips Handmade Gold Alloy Bobby Pins Retro Hair Accessories For Women
like
Find Similar
Purple natural crystal stone hair clip with gold metal finish on black leather base - Gold & Amethyst
Detailed view of natural green crystal stones set on a golden alloy hair pin - Green Aventurine Gold
Natural crystal stone hair clip with colorful gravel on a golden metal bobby pin - Indian Agate Gold
Golden hairpin with natural green crystal stones secured by fine gold wire wrapping - Moss Agate Gold
+8
Natural Crystal Stone Gravel Hair Clips Handmade Gold Alloy Bobby Pins Retro Hair Accessories For Women
-4%
$1.23
No MOQ
 · 
16 views
Free Shipping
Evil Eye Hair Claw Clips Transparent Acrylic Turkish Blue Eye Banana Hairpins For Women Fashion Hair Accessories
Evil Eye Hair Claw Clips Transparent Acrylic Turkish Blue Eye Banana Hairpins For Women Fashion Hair Accessories
like
Find Similar
Detail view showing blue Evil Eye hair claw clip dimensions 3.2cm wide and 6.5g weight - 3.2cm Cat Ear Eye Claw Clip
Detailed view of evil eye hair claw clip with blue eye pattern and silver metal spring - 2.5cm Cherry Style Eye Claw Clip
Close-up of blue Evil Eye hair claw clip with size measurements 3cm by 2.9cm - 3cm Round Eye Claw Clip
Detail view of small evil eye acrylic hair claw clip with 4.2cm by 4cm dimensions - 4.2cm Cat Ear Eye Claw Clip
+13
Evil Eye Hair Claw Clips Transparent Acrylic Turkish Blue Eye Banana Hairpins For Women Fashion Hair Accessories
$0.52-1.15
Mix MOQ : 10
 · 
14 views
Red Bow Hair Clips Velvet Satin Fabric Alloy Duckbill Hairpins Festive New Year Party Headwear Accessories For Women Girls
Red Bow Hair Clips Velvet Satin Fabric Alloy Duckbill Hairpins Festive New Year Party Headwear Accessories For Women Girls
like
Find Similar
Close-up of three red and white plaid bow hair clips on a soft beige velvet jewelry tray - Red and White Plaid 3-Piece Set
Close-up of a pair of red velvet ribbon bows hair clips in a jewelry display case - Satin Solid Color 3-Piece Set
Close-up of three red velvet bow hair clips displayed in a wooden jewelry box - Velvet Solid Color 3-Piece Set
Detailed close-up of three red velvet bow hair clips with metal duckbill clips - Velvet Silver Wire 3-Piece Set
Red Bow Hair Clips Velvet Satin Fabric Alloy Duckbill Hairpins Festive New Year Party Headwear Accessories For Women Girls
$0.86
No MOQ
 · 
72 sold recently
Large Bow Hair Clip With Long Streamers Satin Lace Faux Artificial Pearl French Elegant Hair Accessory For Women Girls
Large Bow Hair Clip With Long Streamers Satin Lace Faux Artificial Pearl French Elegant Hair Accessory For Women Girls
like
Find Similar
Elegant light blue satin bow hair clip with long ribbons on a decorative stone base - Blue
Close-up of elegant black satin bow hair clip with long ribbon on a ceramic plate - Black
Close-up of elegant cream white satin bow hair clip with long flowing ribbons - White
Elegant pink satin ribbon bow hair clip with long streamers in minimalist style - Pink
+11
Large Bow Hair Clip With Long Streamers Satin Lace Faux Artificial Pearl French Elegant Hair Accessory For Women Girls
-6%
$0.23-1.26
No MOQ
Free Shipping
Kids Hair Clips Set Polyester Ribbon Bow Floral Plaid Polka Dot Duckbill Clips For Girls Toddlers Cute Hair Accessories
Kids Hair Clips Set Polyester Ribbon Bow Floral Plaid Polka Dot Duckbill Clips For Girls Toddlers Cute Hair Accessories
like
Find Similar
Set of 10 adorable plaid and floral bow hair clips for girls on display cards - Pink & Green
20-piece cute fabric bow hair clips for girls in beige and blue plaid floral patterns - Blue White
Set of 10 adorable plaid and polka dot bow hair clips for girls on display cards - Pink Plaid
Cute set of 8 pieces children's hair clips featuring yellow daisy and plaid patterns - Yellow Floral
+13
Kids Hair Clips Set Polyester Ribbon Bow Floral Plaid Polka Dot Duckbill Clips For Girls Toddlers Cute Hair Accessories
-5%
$2.03-4.52
No MOQ
Free Shipping
Cotton Linen Butterfly Hair Clips Set Double Layer Padded Duckbill Clips Floral Bow Barrette Hair Accessories For Kids Girls
Cotton Linen Butterfly Hair Clips Set Double Layer Padded Duckbill Clips Floral Bow Barrette Hair Accessories For Kids Girls
like
Find Similar
Set of 10 3D butterfly hair clips in soft waffle fabric and macaroon colors for girls - Five-color Assorted (10G)
Pink double-layered butterfly hair clips set with heart detail on a display card - Pink (2A-12)
5-piece set of macaron linen butterfly hair clips for girls in pastel colors on card - Five-color Combination (10B)
10-piece set of double-layered linen butterfly hair clips in five pastel colors - Red White Pink Purple Set (10D)
+5
Cotton Linen Butterfly Hair Clips Set Double Layer Padded Duckbill Clips Floral Bow Barrette Hair Accessories For Kids Girls
-12%
$0.30-1.40
Mix MOQ : 5
Plush Faux Fur Hair Claw Clips Acrylic Banana Clip Winter Autumn Elegant Non-Slip Ponytail Holder For Women Girls
Plush Faux Fur Hair Claw Clips Acrylic Banana Clip Winter Autumn Elegant Non-Slip Ponytail Holder For Women Girls
like
Find Similar
Detailed view of beige plush fur hair claw clip on vintage kraft paper background - Twist Clip / Off White
Detail of banana hair clip with light pink faux fur poms on a textured warm background - Twist Clip / Pink
Detail view of a premium brown plush hair clip with acrylic teeth and soft faux fur texture - Twist Clip / Coffee
Plush Faux Fur Hair Claw Clips Acrylic Banana Clip Winter Autumn Elegant Non-Slip Ponytail Holder For Women Girls
$1.70
No MOQ
Sunglasses Shape Hair Clip Acetate Rhinestone Alloy Duckbill Clip Creative Vintage Side Hairpin Women Headwear
Sunglasses Shape Hair Clip Acetate Rhinestone Alloy Duckbill Clip Creative Vintage Side Hairpin Women Headwear
like
Find Similar
Detailed close-up of cream-colored acetate sunglasses-shaped hair clip with Like text - Off White
Detailed macro view of red miniature sunglasses with Like print and rhinestone accents - Red
Detail of tortoise shell sunglasses with oval frames on a rustic paper pulp tray - Coffee
Detail of tortoise shell acetate hair clip in retro oval sunglass design with Like text - Tortoise
Sunglasses Shape Hair Clip Acetate Rhinestone Alloy Duckbill Clip Creative Vintage Side Hairpin Women Headwear
$2.10
No MOQ
Free Shipping
Elegant Alloy Rhinestone Artificial Pearl Hair Clips Flower Butterfly Star Shape Fashion Shiny Side Bangs Barrettes For Women Girls
Elegant Alloy Rhinestone Artificial Pearl Hair Clips Flower Butterfly Star Shape Fashion Shiny Side Bangs Barrettes For Women Girls
like
Find Similar
Golden pipa musical instrument hair clip with sparkling rhinestones on pink display base - Style 01-Lute Shape
Close-up of golden bow-shaped hair clip with shimmering rhinestones and pearl details - Style 04-Bowknot Shape
Golden flower hair clip with sparkling rhinestones and white pearl on a pink display stand - Style 02-Pearl Flower
Close-up of golden star-shaped hair clip with inlaid rhinestones on a pink display - Style 07-Stars Shape
+4
Elegant Alloy Rhinestone Artificial Pearl Hair Clips Flower Butterfly Star Shape Fashion Shiny Side Bangs Barrettes For Women Girls
$0.21
Mix MOQ : 10
 · 
14 views
Large Hair Claw Clip Resin Glossy Simple Elegant Shark Hair Clip Accessories For Women Thick Hair Styling
Large Hair Claw Clip Resin Glossy Simple Elegant Shark Hair Clip Accessories For Women Thick Hair Styling
like
Find Similar
Elegant large cream hair claw clip with floral design and smooth finish for thick hair styling - Keel Style Claw / Approx 11cm / Jelly White
Minimalist large pink flower hair claw clip in translucent resin for thick hair styling - Keel Style Claw / Approx 11cm / Jelly Pink
Detailed view of glossy beige resin flower hair claw clip on a minimalist white surface - Keel Style Claw / Approx 11cm / Light Nude Pink
Close-up of cream-colored floral claw clip on book with soft natural lighting decor - Keel Style Claw / Approx 11cm / Grey/White
+13
Large Hair Claw Clip Resin Glossy Simple Elegant Shark Hair Clip Accessories For Women Thick Hair Styling
$1.50
No MOQ
 · 
38 sold recently
Small Hair Claw Clips Plastic Matte Glossy Square Hair Clamps Strong Hold Ponytail Fixed Hairpins For Women Girls Simple Fashion
Small Hair Claw Clips Plastic Matte Glossy Square Hair Clamps Strong Hold Ponytail Fixed Hairpins For Women Girls Simple Fashion
like
Find Similar
Detail showing a 3.5cm black square hair claw clip next to a ruler for size reference - 3cm / Glossy Black
Detail view of a 2cm amber tortoiseshell hair claw clip for elegant half-up hairstyles - 2cm / Tortoise
Macro view of 2cm amber tortoiseshell hair claw clip with size ruler measurement - 2.2cm / Tortoise
Detailed macro view of small 3.5cm matte black claw clip with ruler measuring size - 2.2cm / Matte Black
+13
Small Hair Claw Clips Plastic Matte Glossy Square Hair Clamps Strong Hold Ponytail Fixed Hairpins For Women Girls Simple Fashion
$0.08-0.17
Mix MOQ : 2
 · 
11 sold recently
Elegant Butterfly Hair Clip Alloy Rhinestone Sparkly Side Barrette For Women Fashion Headwear
Elegant Butterfly Hair Clip Alloy Rhinestone Sparkly Side Barrette For Women Fashion Headwear
like
Find Similar
Silver hair clip with butterfly design and clear rhinestones on a white background - 5 Butterflies (M2304) / Silver
Elegant gold butterfly hair clip with sparkling rhinestones in a connected design - 4 Butterflies (E1230) / Gold
Elegant silver hair clip featuring three sparkling rhinestone butterflies on a metal base - 7.5cm-3 Butterflies (E1231) / Silver
Elegant gold butterfly hair clip with sparkling rhinestones in a minimalist design - 7.5cm-Butterfly Style (E1230) / Gold
Elegant Butterfly Hair Clip Alloy Rhinestone Sparkly Side Barrette For Women Fashion Headwear
-4%
$0.47
Mix MOQ : 2
 · 
48 sold recently
Vintage Velvet Bow Hair Clip French Style Black Elegant Ribbon Streamer Spring Barrette For Women Artificial Pearl Decor
Vintage Velvet Bow Hair Clip French Style Black Elegant Ribbon Streamer Spring Barrette For Women Artificial Pearl Decor
like
Find Similar
Detail of vintage black velvet bow hair clip with gold camellia on wavy brown hair - Small Camellia
Velvet bow hair clip with pearl detail shown on model's light blonde wavy hair - Pearl Small Bow
Vintage black velvet bow hair clip with a gold rose embossed center worn on model - Small Bow Rose Black
Detail of a large black velvet bow hair clip featuring a gold rose metal fastener - Streamer Camellia
+2
Vintage Velvet Bow Hair Clip French Style Black Elegant Ribbon Streamer Spring Barrette For Women Artificial Pearl Decor
$0.63
No MOQ
 · 
29 sold recently
Butterfly Hair Claw Clips Metal Alloy Mini Small Hollow Out Hair Accessories For Women Girls
Butterfly Hair Claw Clips Metal Alloy Mini Small Hollow Out Hair Accessories For Women Girls
like
Find Similar
Detailed set of 10 golden metal butterfly hair clips in a neat flat lay arrangement - Gold 10Pcs Set
Detailed top view of 10 mini silver metal butterfly hair clips arranged on beige background - Silver 10Pcs Set
Set of 20 mini metal butterfly hair clips in gold and silver finishes on white background - Mixed 20Pcs Set
Mini butterfly metal hair clips set in gold and silver finish for women hair styling - Mixed 40Pcs Set
+2
Butterfly Hair Claw Clips Metal Alloy Mini Small Hollow Out Hair Accessories For Women Girls
$0.05-2.31
Mix MOQ : 2
Acetate Wave Shaped Hair Clips For Women Girls Elegant Marble Texture Alloy Duckbill Hairpins Hair Accessories For Daily Party Use
Acetate Wave Shaped Hair Clips For Women Girls Elegant Marble Texture Alloy Duckbill Hairpins Hair Accessories For Daily Party Use
like
Find Similar
Set of five wavy acetate hair clips in assorted marble and pearl patterns with gold metal - 5 Pieces
Set of 7 wavy acetate hair clips in colorful marble patterns on a white background - 7-Pack Set
Detailed close-up of wavy acetate hair clip showing blue and white marble texture - Blue And White Stripes (M6410)
Detail of wavy acetate hair clip with green pink marble texture and gold metal base - Deep Pink (M6411)
+5
Acetate Wave Shaped Hair Clips For Women Girls Elegant Marble Texture Alloy Duckbill Hairpins Hair Accessories For Daily Party Use
-4%
$0.41-4.12
Mix MOQ : 2
Free Shipping
Go to

More in accessories

Explore more in clips

clawsharkartificialshapehandmadedesigncolorswirepearl hairshark clips
stylealloyhairpinheartsolidlongtasselbangspartyplastic hair claw

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access