Everful

Wholesale clips

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Clips

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in clips

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Oval Resin Hair Clips With Gold Foil Transparent Colorful Dopamine Style Side Duckbill Clips For Women Girls
Oval Resin Hair Clips With Gold Foil Transparent Colorful Dopamine Style Side Duckbill Clips For Women Girls
like
Find Similar
Close-up of an oval resin hair clip with gold foil flakes on a white porcelain dish - Cream
Detailed close-up of light blue resin hair clip with gold leaf foil on a white plate - Blue
Oval Resin Hair Clips With Gold Foil Transparent Colorful Dopamine Style Side Duckbill Clips For Women Girls
$0.35
No MOQ
 · 
25 sold recently
Girls Hair Clips Flower Bow Heart Shape Korean Style Alloy Plastic Resin Matte Finish Duckbill Side Clips Hairpins Sweet
Girls Hair Clips Flower Bow Heart Shape Korean Style Alloy Plastic Resin Matte Finish Duckbill Side Clips Hairpins Sweet
like
Find Similar
Detail of two matte pink bow hair clips on white card holder for women and kids - D-059 Girl Pink Bow Pair
Close-up of pink flower hair clips with yellow centers on a white display card - D-059 Girl Pink Flower Pair
Close-up of three matte pink duckbill hair clips in various shades for styling - D-001 Girl Pink 3-Piece Set
Set of two matte pink heart-shaped hair clips for girls on a white display card - D-059 Oval Heart (Pair)
+7
Girls Hair Clips Flower Bow Heart Shape Korean Style Alloy Plastic Resin Matte Finish Duckbill Side Clips Hairpins Sweet
$0.29-0.52
No MOQ
Colorful Rhinestone Hair Clips Heart Shaped Alloy Bobby Pins Barrettes For Women Fashion Accessory
Colorful Rhinestone Hair Clips Heart Shaped Alloy Bobby Pins Barrettes For Women Fashion Accessory
like
Find Similar
Sparkling 3-piece heart and rhinestone hair clip set with colored glass gemstones - Three-Piece Set / Colorful
Colorful Rhinestone Hair Clips Heart Shaped Alloy Bobby Pins Barrettes For Women Fashion Accessory
$3.11
No MOQ
 · 
11 views
Free Shipping
Alloy Metal Butterfly Square Hair Claw Clips With Long Tassel Beads Pendant Hollow Out Shark Clips For Women Elegant
Alloy Metal Butterfly Square Hair Claw Clips With Long Tassel Beads Pendant Hollow Out Shark Clips For Women Elegant
like
Find Similar
Gold rectangular metal hair claw clip with long tassels and champagne beads - Square - Beads / Gold
Detail of golden metal butterfly hair claw clip with long tassels and small butterfly charms - Butterfly - Tassel Butterfly / Gold
Golden butterfly hair claw clip with gradient butterfly tassels held by hand - Hollow Butterfly - Tassel Butterfly / Gold
Detail of golden butterfly hair claw clip with long fringe tassels and crystal beads - Butterfly - Beads / Gold
Alloy Metal Butterfly Square Hair Claw Clips With Long Tassel Beads Pendant Hollow Out Shark Clips For Women Elegant
$1.30
No MOQ
 · 
84 sold recently
Geometric Alloy Hair Clips Hollow Eye Palm Pineapple Cactus Shape Retro Minimalist Metal Hairpins Headwear For Women
Geometric Alloy Hair Clips Hollow Eye Palm Pineapple Cactus Shape Retro Minimalist Metal Hairpins Headwear For Women
like
Find Similar
Macro shot of a golden metal eye-shaped hair clip featuring detailed eyelash accents - Gold Evil Eye
Close-up of a silver metal eye-shaped hair clip with minimalist detail on white background - Silver Evil Eye
Golden hollow pineapple-shaped alloy hair clip hair accessory on white background - Gold Pineapple
Modern minimalist silver hollow pineapple hair clip on a clean white background - Silver Pineapple
+8
Geometric Alloy Hair Clips Hollow Eye Palm Pineapple Cactus Shape Retro Minimalist Metal Hairpins Headwear For Women
-6%
$0.31
No MOQ
 · 
16 views
Large Butterfly Bow Hair Claw Clip Elegant Irregular Resin Plastic Hairclip Strong Hold For Women Fashion Accessories
Large Butterfly Bow Hair Claw Clip Elegant Irregular Resin Plastic Hairclip Strong Hold For Women Fashion Accessories
like
Find Similar
Large irregular butterfly hair claw clip in transparent grey with a sturdy gold metal spring - 10.5cm / Transparent Black
Close-up of a large glossy burgundy bow hair claw clip with golden metal accents - 10.5cm / Ancorra Red
Detail of a large amber tortoiseshell hair claw clip with a glossy bow design in hand - 10.5cm / Tortoise
Large butterfly bow hair claw clip in translucent dusty pink acrylic for thick hair - 10.5cm / Transparent Brown
+4
Large Butterfly Bow Hair Claw Clip Elegant Irregular Resin Plastic Hairclip Strong Hold For Women Fashion Accessories
$1.47
No MOQ
 · 
29 sold recently
Handmade Grosgrain Ribbon Bow Hair Clips Colorful Solid Barrettes Toddler Infant Girls Styling Accessories Alligator Grips
Handmade Grosgrain Ribbon Bow Hair Clips Colorful Solid Barrettes Toddler Infant Girls Styling Accessories Alligator Grips
like
Find Similar
Handmade navy blue grosgrain ribbon bow hair clip for children with ribbed texture - Dark Blue
Handmade dark brown grosgrain ribbon bow hair clip for children and girls - Brown
Handmade black grosgrain ribbon hair bow clip with secure metal fastener for girls - Black
Handmade red polyester ribbon hair bow clip for girls featuring a classic ribbed texture - Red
+16
Handmade Grosgrain Ribbon Bow Hair Clips Colorful Solid Barrettes Toddler Infant Girls Styling Accessories Alligator Grips
$0.10
Mix MOQ : 2
 · 
18 sold recently
Handmade Satin Rose Camellia Brooch Hair Clip Dual Use 3D Fabric Flower Corsage Elegant Clothing Accessory For Women
Handmade Satin Rose Camellia Brooch Hair Clip Dual Use 3D Fabric Flower Corsage Elegant Clothing Accessory For Women
like
Find Similar
Detailed close-up of a burgundy fabric rose pin with a black satin bow accessory - Ribbon Style / Burgundy
Macro view of handmade beige satin rose brooch with layered petals and silk texture - Small 4.5CM / Off White
Detailed macro of red satin rose petal layers held in hand to show size and fabric texture - Small 4.5CM / Red
Detailed view of handmade black satin rose brooch with multi-layered 3D floral petals - Small 4.5CM / Black
+4
Handmade Satin Rose Camellia Brooch Hair Clip Dual Use 3D Fabric Flower Corsage Elegant Clothing Accessory For Women
-9%
$0.46-0.62
No MOQ
Artificial Pearl Hair Clips Golden Alloy Wavy Bobby Pins Elegant Vintage Style Jewelry Accessories For Women
Artificial Pearl Hair Clips Golden Alloy Wavy Bobby Pins Elegant Vintage Style Jewelry Accessories For Women
like
Find Similar
Three-piece gold hair clip set featuring different sized pearls on wavy metal pins - Pearl Bobby Pin 3-Piece Set
Artificial Pearl Hair Clips Golden Alloy Wavy Bobby Pins Elegant Vintage Style Jewelry Accessories For Women
$0.69
Mix MOQ : 12
 · 
14 sold recently
Luxury Zircon Rhinestone Hair Clips Women Vintage Bow Tassel Alloy Faux Artificial Pearl Side Duckbill BB Clips Elegant Sparkly Headwear
Luxury Zircon Rhinestone Hair Clips Women Vintage Bow Tassel Alloy Faux Artificial Pearl Side Duckbill BB Clips Elegant Sparkly Headwear
like
Find Similar
Elegant gold large hair clip with irregular oval design on a low ponytail style - Gold Ponytail Clip Real Gold Plated
Silver punk heart-shaped metal hair clip with zircon inlay on model's black hair - Silver Punk Heart Clip
Silver bow hair clip with luxury zircons shown on model for side hair styling - Silver Full Rhinestone Bow Clip
Beige heart-shaped hair clip with inlaid colorful rhinestones and pearls on grid pattern - Heart Plaid Rhinestone Pearl Clip
+23
Luxury Zircon Rhinestone Hair Clips Women Vintage Bow Tassel Alloy Faux Artificial Pearl Side Duckbill BB Clips Elegant Sparkly Headwear
-5%
$0.96-4.09
No MOQ
Free Shipping
Handmade Knitted Wool Hair Clips Sweet Fruit Cherry Strawberry Cake Cute Decorative Hairpins For Kids Girls Women
Handmade Knitted Wool Hair Clips Sweet Fruit Cherry Strawberry Cake Cute Decorative Hairpins For Kids Girls Women
like
Find Similar
Detail of handmade crochet cherry cake hair clip on a decorative white porcelain plate - Pink Lace Cherry
Detailed view of hand-knitted hair clip featuring a cute strawberry pattern on paper card - Coffee Strawberry Cake
Detail of handmade crochet hair clip with a cute 3D strawberry on a soft pink base - Pink Strawberry Cake
Macro view of handmade knitted hair clip featuring cute embroidered red cherries and lace trim - Coffee Cherry Cake
Handmade Knitted Wool Hair Clips Sweet Fruit Cherry Strawberry Cake Cute Decorative Hairpins For Kids Girls Women
$1.01-1.15
Mix MOQ : 2
 · 
32 sold recently
Handmade Lace Bow Flower Hair Clips For Girls Toddler Pastoral Floral Mesh Hairpin Kids Daily Hair Decor Jewelry
Handmade Lace Bow Flower Hair Clips For Girls Toddler Pastoral Floral Mesh Hairpin Kids Daily Hair Decor Jewelry
like
Find Similar
Detail of baby hair clip featuring layered pink ribbon bow with white lace and mini rose - Pink Striped Bow With Handmade Rose (1)
Detailed view of handmade cream tulle rose hair clip with elegant fabric petals - Cream Spiral Mesh Rose (2)
Detail of handmade fabric cherry hair clip with green leaves and pink fruit textures - Pink Cloth Cherry With Green Leaves (3)
Close-up of beige linen bow hair clip featuring delicate flower embroidery and fabric texture - Khaki Linen Bow With Embroidered Floral (4)
+8
Handmade Lace Bow Flower Hair Clips For Girls Toddler Pastoral Floral Mesh Hairpin Kids Daily Hair Decor Jewelry
$0.32-0.52
Mix MOQ : 2
Free Shipping
Large Hair Claw Clip PC Plastic Matte Glossy Octopus Design Hollow Minimalist Elegant For Women
Large Hair Claw Clip PC Plastic Matte Glossy Octopus Design Hollow Minimalist Elegant For Women
like
Find Similar
Pink matte plastic hair claw clip with cutout design displayed with natural decor - Glossy Pink
Minimalist black glossy hair claw clip in a unique three-prong creative design - Glossy Black
Glossy amber tortoiseshell hair claw clip with multi-tooth design on a white background - Coffee Stripes
Glossy nude pink hollow claw clip with multi-teeth design for secure hair styling - Glossy Nude Pink
+19
Large Hair Claw Clip PC Plastic Matte Glossy Octopus Design Hollow Minimalist Elegant For Women
$1.01
No MOQ
 · 
22 sold recently
Matte Plastic Square Flower Hair Claw Clips 4cm Minimalist Geometric Hair Accessories For Women Daily Hair Styling
Matte Plastic Square Flower Hair Claw Clips 4cm Minimalist Geometric Hair Accessories For Women Daily Hair Styling
like
Find Similar
Minimalist 4cm square matte hair claw clip in apricot with hollow design - Individual Packaging / 4cm Square-Khaki
Minimalist rectangular matte hair claw clip in a creamy beige finish for women - Individual Packaging / 4cm Square-Apricot
Matte beige geometric square hair claw clip for women's half-up hairstyles - Individual Packaging / 4cm Square-Milky White
Matte dark brown 4cm square hair claw clip with minimalist cutout design for women - Individual Packaging / 4cm Square-Deep Coffee
+66
Matte Plastic Square Flower Hair Claw Clips 4cm Minimalist Geometric Hair Accessories For Women Daily Hair Styling
$0.30-0.33
No MOQ
Starfish Hair Claw Clip Alloy Faux Artificial Pearl Rhinestone Large Shark Clip French Elegant Ocean Style Headpiece For Women
Starfish Hair Claw Clip Alloy Faux Artificial Pearl Rhinestone Large Shark Clip French Elegant Ocean Style Headpiece For Women
like
Find Similar
Elegant starfish hair claw clip with blue pearls and crystals on a book background - Gun Black Starfish with Blue Pearl / Gun Black
Silver starfish hair claw clip with rhinestones and pearls on a white plate - Silver Starfish with White Pearl / Silver
Starfish Hair Claw Clip Alloy Faux Artificial Pearl Rhinestone Large Shark Clip French Elegant Ocean Style Headpiece For Women
-5%
$1.64
No MOQ
 · 
15 views
Minimalist Metal Hair Clips Zinc Alloy Geometric Barrette Elegant Bow Heart Star Spring Hairpins For Women Daily
Minimalist Metal Hair Clips Zinc Alloy Geometric Barrette Elegant Bow Heart Star Spring Hairpins For Women Daily
like
Find Similar
Minimalist circular zinc alloy spring hair clip with a polished golden finish - Gold Round Tube
Minimalist gold dual-tube spring hair clip with a polished finish for women - Gold Double Bar
Polished silver zinc alloy spring hair clip with double parallel arc design for women - Silver Double Bar
Elegant gold-tone twisted knot spring hair clip made of polished zinc alloy for women - Gold Twist Knot
+24
Minimalist Metal Hair Clips Zinc Alloy Geometric Barrette Elegant Bow Heart Star Spring Hairpins For Women Daily
$0.72-1.10
No MOQ
 · 
24 sold recently
Geometric Hair Clip Acrylic Resin Macaron Duckbill Side Pin Alloy Metal Faux Artificial Pearl Glitter Fashion For Women
Geometric Hair Clip Acrylic Resin Macaron Duckbill Side Pin Alloy Metal Faux Artificial Pearl Glitter Fashion For Women
like
Find Similar
Long geometric hair clip with pink matte finish and silver glitter on gold base - Pink Transparent Round
Close-up of golden hair clip featuring five elegant white pearls in textured settings - 5 White Pearls
Detail view of vertical white pearls on a minimalist golden metal hair clip base - 4 White Pearls
Pink cat eye stone hair clip with rhinestone border on a minimalist white card - Beige Matte Geometric
+24
Geometric Hair Clip Acrylic Resin Macaron Duckbill Side Pin Alloy Metal Faux Artificial Pearl Glitter Fashion For Women
$0.16-0.27
Mix MOQ : 5
 · 
17 sold recently
Elegant Wine Red Large Hair Claw Clip Plastic Resin With Metal Spring For Women Styling Accessory
Elegant Wine Red Large Hair Claw Clip Plastic Resin With Metal Spring For Women Styling Accessory
like
Find Similar
Elegant large dark red glossy hair claw clip with sturdy golden metal spring - Wine Red - Straight Claw (11.5cm)
Macro detail of dark red large hair claw clip with golden spring on textured background - Wine Red - Geometric Claw (12.8cm)
Macro view of burgundy large hair claw clip with glossy finish and golden metal spring - Wine Red - O-Shape Straight Claw (13.8cm)
Close-up of deep red resin hair claw clip with golden metal spring on a beige tray - Wine Red - Large Hanger Claw (15cm)
+15
Elegant Wine Red Large Hair Claw Clip Plastic Resin With Metal Spring For Women Styling Accessory
$0.81-1.67
No MOQ
Sweet Blue White Satin Bow Hair Clips With Artificial Fur Pom-poms Cute Handmade Webbing Hair Barrette Accessories For Women Girls
Sweet Blue White Satin Bow Hair Clips With Artificial Fur Pom-poms Cute Handmade Webbing Hair Barrette Accessories For Women Girls
like
Find Similar
Detailed view of light blue satin ribbon hair clip featuring a soft white fur ball accent - Light Blue Single Bow with Pom-pom (1#)
Detailed view of light blue satin bow hair clip with a white fluffy pom pom accent - Light Blue Mini Double Layer Bow with Pom-pom (2#)
Close-up of blue and white satin bow hair clip featuring a fluffy white pom-pom detail - Blue and White Layered Bow with Pom-pom (3#)
Detail of blue and white bow hair clip featuring a soft plush pompom and ribbon layers - Light Blue Swallowtail Bow with Pom-pom (4#)
+1
Sweet Blue White Satin Bow Hair Clips With Artificial Fur Pom-poms Cute Handmade Webbing Hair Barrette Accessories For Women Girls
$0.58-0.86
Mix MOQ : 2
 · 
12 sold recently
Korean Minimalist Metal Matte Hair Clip Set For Women Girls Morandi Color Duckbill Clips Geometric Hollow Hairpins Accessories
Korean Minimalist Metal Matte Hair Clip Set For Women Girls Morandi Color Duckbill Clips Geometric Hollow Hairpins Accessories
like
Find Similar
Detailed view of matte milk coffee color metal hair clip set on a white brand card - Water Drop Duckbill Clip Set
Detail view of 3pcs matte finish hair clips in cream and mauve tones on a white display card - Rectangular BB Clip Set
Detailed close-up of matte duckbill hair clips in coffee tones on a white display card - Coffee No-Trace Clip Set
Three-piece set of matte milk-coffee hair clips in beige, purple, and brown on white card - Water Drop BB Clip Set
+23
Korean Minimalist Metal Matte Hair Clip Set For Women Girls Morandi Color Duckbill Clips Geometric Hollow Hairpins Accessories
$0.57-1.20
No MOQ
Plush Hair Claw Clip With Faux Artificial Pearl Decorative Faux Fur Shark Clip Retro Winter Hair Accessories For Women
Plush Hair Claw Clip With Faux Artificial Pearl Decorative Faux Fur Shark Clip Retro Winter Hair Accessories For Women
like
Find Similar
Pink plush hair claw clip with inlaid pearls on a decorative tray lifestyle shot - Dusty Pink High-low Plush Pearl Claw Clip
Detail shot of a brown plush hair claw with pearl accents on a white decorative plate - Dark Coffee High-low Plush Pearl Claw Clip
Macro detail of large beige plush hair claw clip with elegant pearl embellishments - Milk Tea High-low Plush Pearl Claw Clip
White plush hair claw clip with faux fur and pearl accents for women, winter style - Off-white High-low Plush Pearl Claw Clip
+15
Plush Hair Claw Clip With Faux Artificial Pearl Decorative Faux Fur Shark Clip Retro Winter Hair Accessories For Women
-4%
$0.41-1.02
No MOQ
Geometric Metal Hair Clips Alloy Rectangular Brushed Hammered Spring Barrettes Minimalist Fashion Hair Accessories Women
Geometric Metal Hair Clips Alloy Rectangular Brushed Hammered Spring Barrettes Minimalist Fashion Hair Accessories Women
like
Find Similar
Elegant gunmetal alloy hair clip featuring a double layered feather design and metallic texture - 18# Black (Feather Shape)
Elegant gold-plated alloy feather barrette with detailed metallic texture finish - 18# Champagne Gold (Feather Shape)
Sleek geometric rectangular spring hair clip in matte brushed gold finish for women - 19 Brushed (Arched)
Minimalist gold wavy alloy spring hair clip with a brushed metallic texture and modern design - 12# Gold (Polished Wave)
+52
Geometric Metal Hair Clips Alloy Rectangular Brushed Hammered Spring Barrettes Minimalist Fashion Hair Accessories Women
$0.81-5.71
No MOQ
 · 
22 sold recently
Free Shipping
Grosgrain Ribbon Bow Hair Clips Solid Color Swallowtail Handmade Hairpin For Baby Girls Children Toddlers
Grosgrain Ribbon Bow Hair Clips Solid Color Swallowtail Handmade Hairpin For Baby Girls Children Toddlers
like
Find Similar
Set of 10 solid pink swallowtail bow hair clips for babies made of grosgrain ribbon - Set / Lotus Pink
Set of 10 coral pink grosgrain ribbon bow hair clips for girls with handmade knots - Set / Watermelon red
Set of 10 fluorescent green grosgrain ribbon bow hair clips for girls and babies - Set / Grass Green
Set of 10 mint green grosgrain ribbon bow hair clips for girls and babies - Set / Light Green
+54
Grosgrain Ribbon Bow Hair Clips Solid Color Swallowtail Handmade Hairpin For Baby Girls Children Toddlers
$0.09
Mix MOQ : 2
Spiral Hair Clips Alloy Natural Stone Pendants Dreadlock Rings Bohemian Ethnic Braiding Accessories For Women
Spiral Hair Clips Alloy Natural Stone Pendants Dreadlock Rings Bohemian Ethnic Braiding Accessories For Women
like
Find Similar
Macro detail of natural orange stone pendant hair ring with silver metal spiral clip - Orange Short
Detail of bohemian gold earring clip with long chain and natural grey stone pendants - Grey Short
Detail of golden snake hair charm with black natural stones for bohemian braids - Black Short
Detail of a golden snake ear clip with pink and green natural stone pendant droplets - Brown Short Style
+55
Spiral Hair Clips Alloy Natural Stone Pendants Dreadlock Rings Bohemian Ethnic Braiding Accessories For Women
$0.63-8.21
No MOQ
Free Shipping
Elegant Matte Acrylic Large Hair Claw Clip For Women Non Slip Minimalist Geometric Square Shark Hair Clip Styling Tool
Elegant Matte Acrylic Large Hair Claw Clip For Women Non Slip Minimalist Geometric Square Shark Hair Clip Styling Tool
like
Find Similar
Elegant large matte khaki acrylic hair claw clip with a minimalist square shark jaw design - 4912186657214 / Cross Coffee
Elegant large matte light blue rectangular hollow hair claw clip for women - 6081451949041 / Square Clip Blue Grey
Large matte beige acrylic hair claw clip with geometric zigzag design for women - 6094964461781 / Khaki W-Shape 13cm Style
Detail of large cream twisted claw clip with matte acrylic finish and metal spring - 4912186657209 / Twisted Style White
+180
Elegant Matte Acrylic Large Hair Claw Clip For Women Non Slip Minimalist Geometric Square Shark Hair Clip Styling Tool
$0.12-2.16
No MOQ
Free Shipping
Large Hair Claw Clip Elegant Camellia Flower Alloy Metal Shark Clip Vintage Rhinestone Hairpin Headwear For Women
Large Hair Claw Clip Elegant Camellia Flower Alloy Metal Shark Clip Vintage Rhinestone Hairpin Headwear For Women
like
Find Similar
Exquisite camellia flower metal hair claw with white petals and sparkling rhinestones - Exquisite French Camellia Claw Clip
Large Hair Claw Clip Elegant Camellia Flower Alloy Metal Shark Clip Vintage Rhinestone Hairpin Headwear For Women
$1.15
No MOQ
Halloween Hair Clips With Colorful Wig Extensions Pumpkin Bat Ghost Glitter Polyester Festival Party Props For Children
Halloween Hair Clips With Colorful Wig Extensions Pumpkin Bat Ghost Glitter Polyester Festival Party Props For Children
like
Find Similar
Ghost hair clip with glitter bow and purple-orange extensions for Halloween party - Ghost Bow Long Bangs Clip
Halloween pumpkin hair clip featuring purple, black and orange synthetic hair extensions - Pumpkin Smiley Face Long Bangs Clip
Detail of Halloween Mickey bat hair clip with orange and black synthetic hair piece - Bow-tie Mouse Long Bangs Clip
Detail of Halloween hair clip with purple glitter bat and bicolor hair extensions - Purple Bat-shaped Long Bangs Clip
+1
Halloween Hair Clips With Colorful Wig Extensions Pumpkin Bat Ghost Glitter Polyester Festival Party Props For Children
$0.60
Mix MOQ : 2
 · 
169 sold recently
Floral Hair Claw Clip Matte Plastic Strong Grip Minimalist Shark Jaw Clip Hair Accessory For Women Girls
Floral Hair Claw Clip Matte Plastic Strong Grip Minimalist Shark Jaw Clip Hair Accessory For Women Girls
like
Find Similar
Detailed top view of a matte black flower hair claw clip on a clean white surface - Matte Black
Detailed top view of a beige flower hair claw clip with a matte finish on white surface - Matte Beige Coffee
Detail view of a matte nude flower hair claw clip with a minimalist 3D petal design - Matte Light Coffee
Detailed shot of a matte brown flower-shaped hair claw clip on a minimalist white background - Matte Dark Coffee
+3
Floral Hair Claw Clip Matte Plastic Strong Grip Minimalist Shark Jaw Clip Hair Accessory For Women Girls
-5%
$0.38
No MOQ
 · 
10 sold recently
Metal Hair Claw Clip Large Hollow Geometric Zinc Alloy Elegant Rectangular Moon Shape Grip For Women Minimalist Accessory
Metal Hair Claw Clip Large Hollow Geometric Zinc Alloy Elegant Rectangular Moon Shape Grip For Women Minimalist Accessory
like
Find Similar
Macro shot of large golden rectangular hollow metal hair claw clip with glossy finish - Rectangle / Gold
Large golden geometric hollow metal hair claw clip with minimalist crescent design - Crescent / Gold
Detail of rose gold hollow rectangular hair claw clip with a glossy metal finish - Rectangle / Rose Gold
Macro view of silver geometric hollow metal hair claw clip with spring detail - Rectangle / Gunmetal
+3
Metal Hair Claw Clip Large Hollow Geometric Zinc Alloy Elegant Rectangular Moon Shape Grip For Women Minimalist Accessory
$0.78
No MOQ
 · 
309 sold recently
Valentine Day Heart Pattern Hair Claw Clips Acrylic Large Shark Clip Non-Slip Checkerboard Sweet Accessories For Women
Valentine Day Heart Pattern Hair Claw Clips Acrylic Large Shark Clip Non-Slip Checkerboard Sweet Accessories For Women
like
Find Similar
Pink heart shark hair claw clip for women featuring red hearts, 8.7cm width size - Heart Polka Dot
Pink and red checkered pattern hair claw clip for women, size 8.7cm length - Red & Pink Checkerboard
Pink and red heart pattern shark hair claw clip for women, size 8.7cm length - Radial Heart Pattern
Pink checkered Valentine's Day hair claw clip with Happy Valentine's Day text and stars - Pink Plaid Letter Print
Valentine Day Heart Pattern Hair Claw Clips Acrylic Large Shark Clip Non-Slip Checkerboard Sweet Accessories For Women
$0.84
Mix MOQ : 2
 · 
42 sold recently
Handmade Rose Flower Satin Ribbon Hair Clips And Scrunchies Retro French Style Lace Bow Floral Headwear For Women
Handmade Rose Flower Satin Ribbon Hair Clips And Scrunchies Retro French Style Lace Bow Floral Headwear For Women
like
Find Similar
Elegant white organza rose banana hair clip with satin leaf on transparent acrylic base - French Large Barrette / Camellia Pink
Elegant purple rose hair clip with pearl detail on model's braided hairstyle - Purple Rose Pearl Hair Clip / Purple
Exquisite handmade white fabric flower hair pin and pearl earrings jewelry set - Beige Flower Pearl Hair Clip / Beige
Handmade wine red satin rose hair tie with elastic black band for women - Satin Rose Hair Tie / Burgundy
+21
Handmade Rose Flower Satin Ribbon Hair Clips And Scrunchies Retro French Style Lace Bow Floral Headwear For Women
-6%
$0.27-1.62
No MOQ
 · 
10 views
Free Shipping
Rhinestone Hair Clips For Women Elegant Sparkling Water Drop Barrette Minimalist Alloy Hairpins Side Hair Accessories
Rhinestone Hair Clips For Women Elegant Sparkling Water Drop Barrette Minimalist Alloy Hairpins Side Hair Accessories
like
Find Similar
Set of 2 golden hair clips with shimmering black crystals on a white display card - Black Silver
Rhinestone Hair Clips For Women Elegant Sparkling Water Drop Barrette Minimalist Alloy Hairpins Side Hair Accessories
-5%
$1.33
No MOQ
 · 
44 sold recently
Free Shipping
Vintage Checkerboard Mini Hair Claw Clip Colorful Acrylic Grid Pattern Small Hair Clamp For Women Girls Daily Accessory
Vintage Checkerboard Mini Hair Claw Clip Colorful Acrylic Grid Pattern Small Hair Clamp For Women Girls Daily Accessory
like
Find Similar
9 options
Vintage Checkerboard Mini Hair Claw Clip Colorful Acrylic Grid Pattern Small Hair Clamp For Women Girls Daily Accessory
$0.83
Mix MOQ : 10
 · 
10 sold recently
Free Shipping
Large Wave Hair Claw Clip Acetate Tortoiseshell Iridescent Shell Design Hair Accessories For Women
Large Wave Hair Claw Clip Acetate Tortoiseshell Iridescent Shell Design Hair Accessories For Women
like
Find Similar
Detail of tortoiseshell acetate hair claw clip with brown and blue wavy pattern on a tray - 4.0mm Thick Lake Blue Brown
Detail of a large pearlescent white wavy hair claw clip on a minimalist tray - 3.0mm Thick Mermaid Pink
Detailed macro view of pink marble acetate hair claw clip with elegant wavy design - 3.0mm Thick Cherry Blossom Pink
Blue and gold acetate flower hair claw clip on a stylish decorative tray setup - 3.0mm Thick Colorful Blue
+2
Large Wave Hair Claw Clip Acetate Tortoiseshell Iridescent Shell Design Hair Accessories For Women
$1.50-1.59
No MOQ
 · 
51 sold recently
Elegant Large Hair Claw Clip Acetate Hollow Geometric Marble Tortoiseshell Strong Hold Shark Clip For Women Thick Hair
Elegant Large Hair Claw Clip Acetate Hollow Geometric Marble Tortoiseshell Strong Hold Shark Clip For Women Thick Hair
like
Find Similar
Hollow acetate shark hair claw with iridescent pastel colorful marble texture finish - 13cm / Light Multicolor 13CM
Oversized pink marble acetate hair claw clip with a hollow geometric design for women - 13cm / Peach Pink 13CM
Pink and white marbled acetate hair claw clip with large cutout design for women - 13cm / Iridescent Pink 13CM
Pink marble pattern acetate hair claw clip with large hollow shark clip design for women - 13cm / Sakura Pink 13CM
+18
Elegant Large Hair Claw Clip Acetate Hollow Geometric Marble Tortoiseshell Strong Hold Shark Clip For Women Thick Hair
-4%
$4.38
No MOQ
 · 
12 sold recently
Free Shipping
Kids Hair Clips Matte Painted Metal Side Hairpins Girls Sweet Candy Color Hollow Waterdrop Wave Hair Clips Hair Accessories
Kids Hair Clips Matte Painted Metal Side Hairpins Girls Sweet Candy Color Hollow Waterdrop Wave Hair Clips Hair Accessories
like
Find Similar
Macro detail of red and pink matte metal hair clips for kids on an accessories card - Red Group
Set of 4 mint green metal hair clips including drop and wave shapes on display card - Green Set
Detail of four yellow and orange gradient metal hair clips on a white display card - Yellow Set
Set of four matte pink hair clips in teardrop and wave shapes on a display card - Pink Set
+1
Kids Hair Clips Matte Painted Metal Side Hairpins Girls Sweet Candy Color Hollow Waterdrop Wave Hair Clips Hair Accessories
$0.52
Mix MOQ : 2
Cute Cartoon Dog Acetate Hair Claw Clip Creative Dog Head With Glasses Handmade Hair Accessories Women Girls
Cute Cartoon Dog Acetate Hair Claw Clip Creative Dog Head With Glasses Handmade Hair Accessories Women Girls
like
Find Similar
Detail of cute puppy hair claw clip made of tortoiseshell acetate with glasses motif - Eyeglasses Gray Puppy / Approx 4.5cm
Three cute acetate puppy hair claws in pink, brown and black colors held in hand - Eyeglasses Coffee Dog Large Claw / approx 12CM
Cute pink acetate hair claw with cartoon puppy and glasses, held in a natural indoor setting - Eyeglasses Brown Puppy Duckbill Clip / Approx 4.8cm
Three cute acetate poodle hair claws in pink, brown and black colors, detail view - Heart Eyeglasses Coffee Dog Large Claw / approx 12CM
+5
Cute Cartoon Dog Acetate Hair Claw Clip Creative Dog Head With Glasses Handmade Hair Accessories Women Girls
$1.30-4.18
No MOQ
 · 
11 views
Free Shipping
Halloween Hair Claw Clips Acrylic Pumpkin Bat Ghost Cat Spider Pattern Holiday Hair Accessories For Women Girls Cute
Halloween Hair Claw Clips Acrylic Pumpkin Bat Ghost Cat Spider Pattern Holiday Hair Accessories For Women Girls Cute
like
Find Similar
Halloween pumpkin hair claw clip in orange resin with white details and green leaves - Pumpkin Head
Detail of spider-shaped acrylic hair claws with black and yellow patterns in a set of two - Small Spider (Single)
Macro shot of a black acrylic bat hair claw clip with glitter finish and white eyes - Small Bat (Single)
Detail view of two translucent white ghost hair clips with black eye and mouth details - Small Ghost (Single)
+4
Halloween Hair Claw Clips Acrylic Pumpkin Bat Ghost Cat Spider Pattern Holiday Hair Accessories For Women Girls Cute
$0.63-1.38
No MOQ
 · 
58 sold recently
Free Shipping
Elegant Leaf Shape Hair Claw Clip Matte Frosted Plastic Strong Hold Versatile Anti Slip Headwear Styling Tool For Women
Elegant Leaf Shape Hair Claw Clip Matte Frosted Plastic Strong Hold Versatile Anti Slip Headwear Styling Tool For Women
like
Find Similar
Matte warm orange leaf hair claw clip for elegant buns and hair styling accessories - Matte Orange
Light blue leaf-shaped matte hair claw clip for elegant updo hairstyles on a beige card - Matte Sky Blue
Matte ginger yellow leaf-shaped hair claw clip for elegant hairstyles and bun styling - Matte Ginger
Matte burgundy leaf shaped hair claw clip for women elegant ponytail hair accessory - Matte Wine Red
+10
Elegant Leaf Shape Hair Claw Clip Matte Frosted Plastic Strong Hold Versatile Anti Slip Headwear Styling Tool For Women
-4%
$0.69
No MOQ
 · 
36 sold recently
Kids Girls Hair Clips PU Leather Fabric Velvet Glitter Bow Flower Animal Stars Hearts Sweet Toddler Hair Accessories
Kids Girls Hair Clips PU Leather Fabric Velvet Glitter Bow Flower Animal Stars Hearts Sweet Toddler Hair Accessories
like
Find Similar
Pink polka dot flower hair clip with yellow plaid button for girls and toddlers - Brick Red Flower
Yellow velvet bow hair clip for girls with soft plush texture on white background - Yellow Velvet
Kids hair clip with black and white houndstooth bow and gold trim detail - Classic Black and White
Classic black grosgrain ribbon hair clip with elegant gold edge stitching detail - Black Gold Edged Bow
+15
Kids Girls Hair Clips PU Leather Fabric Velvet Glitter Bow Flower Animal Stars Hearts Sweet Toddler Hair Accessories
$0.29-0.43
No MOQ
 · 
28 sold recently
French Style Hair Claw Clip Rhinestone Shark Clip Plastic Resin Cherry Floral Star Pattern Hair Accessories For Women
French Style Hair Claw Clip Rhinestone Shark Clip Plastic Resin Cherry Floral Star Pattern Hair Accessories For Women
like
Find Similar
French style beige hair claw clip with red cherry pattern and rhinestone star details - 10*4*4cm / Red Cherry
Close-up of black glossy hair claw with sparkling rhinestones on textured background - 6.5*4*4.5cm / Black Small
Detail of white iridescent hair claw clip with metallic stud accents on textured surface - 6.5*4*4.5cm / White Small
Detail of turquoise hair claw clip with sparkling crystal studs on a white surface - 6.5*4*4.5cm / Blue Small
+5
French Style Hair Claw Clip Rhinestone Shark Clip Plastic Resin Cherry Floral Star Pattern Hair Accessories For Women
$1.67-2.45
No MOQ
 · 
32 views
Spider Web Hair Claw Clip Zinc Alloy Metal Halloween Gothic Party Accessory Punk Dark Aesthetic Novelty For Women
Spider Web Hair Claw Clip Zinc Alloy Metal Halloween Gothic Party Accessory Punk Dark Aesthetic Novelty For Women
like
Find Similar
Silver spider web metal hair claw clip with a glossy finish for hair styling - Large / Silver-10.5cm
Spider web metal hair claw clip in golden finish with minimalist geometric design - Large / Gold-10.5cm
Silver spider web metal hair claw clip with spider motif on silk background - Small / Silver-3cm
Mini golden spider metal hair claw clip with spider web design for Halloween styling - Small / Gold-3cm
+2
Spider Web Hair Claw Clip Zinc Alloy Metal Halloween Gothic Party Accessory Punk Dark Aesthetic Novelty For Women
$0.29-0.66
No MOQ
 · 
11 views
Small Daisy Flower Hair Claw Clip Plastic Matte Candy Color Sunflower Hairpin Sweet Cute Hair Accessory For Women
Small Daisy Flower Hair Claw Clip Plastic Matte Candy Color Sunflower Hairpin Sweet Cute Hair Accessory For Women
like
Find Similar
Matte pink daisy flower hair claw clip with a double-sided resin petal design - 4cm Matte Light Pink
Chic Morandi pink flower hair claw clip with a matte finish for a sweet, elegant style - 4cm Matte Chocolate
Matte beige daisy flower hair claw clip with frosted resin texture for women - 4cm Matte Light Grey
Small daisy hair claw clip in dark brown with a matte finish and vintage floral design - 4cm Matte Deep Coffee
+8
Small Daisy Flower Hair Claw Clip Plastic Matte Candy Color Sunflower Hairpin Sweet Cute Hair Accessory For Women
$0.22
No MOQ
 · 
16 sold recently
Ruffled Satin Bow Hair Clip Elegant Long Streamer Duckbill Clip Vintage Hair Accessories For Women Girls
Ruffled Satin Bow Hair Clip Elegant Long Streamer Duckbill Clip Vintage Hair Accessories For Women Girls
like
Find Similar
Elegant black grosgrain ribbon bow hair clip with long streamers on a white background - Black
Detailed view of cream bow hair clip featuring delicate ruffled edges and long satin ribbons - Beige
Close-up of long pink satin bow hair clip with ruffled edges and elegant ribbons - Pink
Macro shot of light blue satin ribbon hair clip with delicate ruffle edges and bow detail - Blue
+15
Ruffled Satin Bow Hair Clip Elegant Long Streamer Duckbill Clip Vintage Hair Accessories For Women Girls
-4%
$0.72
Mix MOQ : 2
 · 
60 sold recently
Large Plush Hair Claw Clip Soft Faux Fur Shark Clip Korean Style Autumn Winter Hair Accessory For Women Thick Hair Styling
Large Plush Hair Claw Clip Soft Faux Fur Shark Clip Korean Style Autumn Winter Hair Accessory For Women Thick Hair Styling
like
Find Similar
Close-up of black plush shark hair claw clip with soft faux fur texture on beige base - Large Plush Claw Clip / Black
Detail of soft white faux fur plush hair claw clip with cozy winter texture and elegant look - Large Plush Claw Clip / Off-white
Close-up of soft brown plush hair claw clip with a fluffy texture for winter styling - Large Plush Claw Clip / Dark Coffee
Close-up of a plush large hair claw clip in taupe grey on a magazine lifestyle background - Large Plush Claw Clip / Light Brown
+21
Large Plush Hair Claw Clip Soft Faux Fur Shark Clip Korean Style Autumn Winter Hair Accessory For Women Thick Hair Styling
$0.19-0.37
No MOQ
Metal Hair Clips And Hair Ties Titanium Steel Spring Clip Hammered Texture Knotted Ponytail Holder Elegant Minimalist
Metal Hair Clips And Hair Ties Titanium Steel Spring Clip Hammered Texture Knotted Ponytail Holder Elegant Minimalist
like
Find Similar
Close-up of geometric silver metal detail on black elastic hair tie with smooth finish - Double Bar Smooth Hair Tie / Silver
Elegant gold metal twisted knot hair clip accessory on textured paper background - Knot Spring Clip / Gold
Detailed view of golden spring hair clip with irregular texture on white paper background - Liquid Hammered Spring Clip / Gold
Macro shot of silver knotted metal hair clip on a white textured paper background - Knot Spring Clip / Silver
+2
Metal Hair Clips And Hair Ties Titanium Steel Spring Clip Hammered Texture Knotted Ponytail Holder Elegant Minimalist
$0.81
No MOQ
 · 
63 sold recently
Sweet Resin Heart Ball Hair Clips Amber Marble Texture Duckbill Side Clips Korean Style Fashion Headwear For Women Daily Styling
Sweet Resin Heart Ball Hair Clips Amber Marble Texture Duckbill Side Clips Korean Style Fashion Headwear For Women Daily Styling
like
Find Similar
Elegant amber-toned heart and bead hair clips set in pink resin with golden metal base - Pink
Detail of green marble resin hair clips with heart and bead shapes on a white book - Green
Detail of two lavender marble resin hair clips with round beads and heart shapes - Grey Purple
Elegant amber resin hair clips in heart and bead shapes with marble texture design - Coffee
Sweet Resin Heart Ball Hair Clips Amber Marble Texture Duckbill Side Clips Korean Style Fashion Headwear For Women Daily Styling
$1.30
No MOQ
Free Shipping
Minimalist Metal Ponytail Hair Clips Alloy Hammered Texture Geometric Hairpins Elegant Hair Accessories For Women
Minimalist Metal Ponytail Hair Clips Alloy Hammered Texture Geometric Hairpins Elegant Hair Accessories For Women
like
Find Similar
Minimalist silver alloy ponytail clip set with wavy and spiral geometric metal designs - 31# Silver 3-Piece Set
Two-piece gold alloy hair clip set with white faux pearls and sleek curved design - 8# Gold 2-Piece Set
Minimalist silver metal hair clip set with wave and triple layer hollow design on card - 2# Silver 2-Piece Set
Minimalist silver alloy ponytail clip set with smooth and twisted metal hair pins - 3# Silver 2-Piece Set
+33
Minimalist Metal Ponytail Hair Clips Alloy Hammered Texture Geometric Hairpins Elegant Hair Accessories For Women
$1.82-2.65
Mix MOQ : 2
 · 
13 views
Free Shipping
French Style Large Acrylic Hair Claw Clip Floral Marble Pattern Shark Clip For Women Elegant Vintage Hair Accessories
French Style Large Acrylic Hair Claw Clip Floral Marble Pattern Shark Clip For Women Elegant Vintage Hair Accessories
like
Find Similar
Acrylic hair claw clip with burgundy and gold foil pattern for elegant updos - Purple Red Gold Foil / Red
Acrylic purple floral hair claw clip with golden teeth on a minimalist background - Purple Amber Pattern / Purple
Semicircle resin hair claw clip with purple and green floral marble pattern - Blue Green Marble / Blue
French Style Large Acrylic Hair Claw Clip Floral Marble Pattern Shark Clip For Women Elegant Vintage Hair Accessories
-4%
$0.69
Mix MOQ : 2
 · 
11 views
Ocean Theme Tropical Fish Dolphin Cellulose Acetate Hair Claw Clip Cute Cartoon Marine Animal Mini Hairpin For Girls Children Daily Hair Accessories
Ocean Theme Tropical Fish Dolphin Cellulose Acetate Hair Claw Clip Cute Cartoon Marine Animal Mini Hairpin For Girls Children Daily Hair Accessories
like
Find Similar
Handcrafted ocean style goldfish hair claw clip made of colorful premium acetate material - Goldfish
Macro detail of tropical fish hair claw clip with colorful iridescent gradient finish - Yellow Green Clownfish
Detail of a tropical clownfish hair claw clip made of pearlescent pink acetate material - Rose Red Clownfish
Detail view of mini whale shark hair claw clip in black and white acetic acid pattern - Black Lined Whale Shark
+2
Ocean Theme Tropical Fish Dolphin Cellulose Acetate Hair Claw Clip Cute Cartoon Marine Animal Mini Hairpin For Girls Children Daily Hair Accessories
$0.60
No MOQ
Velvet Bow Hair Clips For Kids Girls Cute Ribbon Hairpins Soft Velveteen Side Clips Solid Candy Color Headwear
Velvet Bow Hair Clips For Kids Girls Cute Ribbon Hairpins Soft Velveteen Side Clips Solid Candy Color Headwear
like
Find Similar
Detail of a champagne velvet bow hair clip showing luxurious texture and craftsmanship - Champagne Gold (2)
Classic velvet bow hair clip for girls in warm caramel brown finish on white background - Caramel Brown (3)
Classic black velvet bow hair clip with textured finish and soft fabric for girls - Black (4)
Cute purple velvet bow hair clip with a soft texture and elegant handmade finish - Purple (5)
+16
Velvet Bow Hair Clips For Kids Girls Cute Ribbon Hairpins Soft Velveteen Side Clips Solid Candy Color Headwear
$0.20
Mix MOQ : 2
 · 
176 sold recently
Hair Claw Satin Flower Feather Rhinestone Acrylic Shark Clip Vintage Elegant For Women Party Accessory
Hair Claw Satin Flower Feather Rhinestone Acrylic Shark Clip Vintage Elegant For Women Party Accessory
like
Find Similar
Detail view of a black camellia hair claw clip with satin petals, rhinestones and feathers - Black Hair Claw
Hair Claw Satin Flower Feather Rhinestone Acrylic Shark Clip Vintage Elegant For Women Party Accessory
$4.50
No MOQ
 · 
11 views
Free Shipping
Handmade Fabric Bow Hair Clips Cute Solid Color Side Hairpins Duckbill Clips For Girls Kids Accessories
Handmade Fabric Bow Hair Clips Cute Solid Color Side Hairpins Duckbill Clips For Girls Kids Accessories
like
Find Similar
Close-up of navy blue fabric bow hair clips set on handmade paper display card - 2 Pcs/Set / Navy Blue
Close-up of two handmade purple fabric bow hair clips on a white display card - 2 Pcs/Set / Purple
Detailed view of handmade pink fabric bow hair clips on a decorative display card - 2 Pcs/Set / Pink
Detail view of handmade yellow bow hair clips on premium display packaging cards - 2 Pcs/Set / Yellow
+1
Handmade Fabric Bow Hair Clips Cute Solid Color Side Hairpins Duckbill Clips For Girls Kids Accessories
$0.35
Mix MOQ : 2
 · 
63 sold recently
Kids Girls Crown Hair Clips Mesh Tulle Lace Faux Artificial Pearl Rhinestone Princess Party Hairpins Sparkling Cute Accessories
Kids Girls Crown Hair Clips Mesh Tulle Lace Faux Artificial Pearl Rhinestone Princess Party Hairpins Sparkling Cute Accessories
like
Find Similar
Mint green crown hair clip with white lace and pearl accents for girls - Mint Green
Sparkling silver crown hair clip with pearls and grey tulle for girls party wear - Grey
Red sequin princess crown hair clip with tulle layers and sparkling star decoration - Red Marble
Pink glitter princess crown hair clip with tulle ruffles and silver star for girls - 4# Pink
+20
Kids Girls Crown Hair Clips Mesh Tulle Lace Faux Artificial Pearl Rhinestone Princess Party Hairpins Sparkling Cute Accessories
$1.08-1.89
No MOQ
 · 
22 views
Free Shipping
Gothic Lolita Bow Hair Clip With Heart Rhinestone Lace Satin Ribbon Cross Chain Dark Style Hairpin For Women Girls Jewelry
Gothic Lolita Bow Hair Clip With Heart Rhinestone Lace Satin Ribbon Cross Chain Dark Style Hairpin For Women Girls Jewelry
like
Find Similar
Gothic black lace bow hair clip featuring a heart rhinestone and silver cross pendant detail - Black
Gothic Lolita hair bow with red satin, black lace, metal chains, and heart pendant - Burgundy
White lace bow hair clip with heart rhinestone and silver gothic cross charms - White
Gothic Lolita Bow Hair Clip With Heart Rhinestone Lace Satin Ribbon Cross Chain Dark Style Hairpin For Women Girls Jewelry
$1.30
Mix MOQ : 2
Leopard Print Hair Claw Clip Rectangular Hollow Resin Korean Retro Elegant Updo Headwear Hair Accessory For Women Girls
Leopard Print Hair Claw Clip Rectangular Hollow Resin Korean Retro Elegant Updo Headwear Hair Accessory For Women Girls
like
Find Similar
Grey leopard print acetate hair claw clip with rectangular hollow design for hair styling - Grey Black White Leopard (D6-2-15)
Elegant medium resin hair claw clip with classic leopard print pattern for women - Dark Brown Beige Leopard (D6-2-20)
Elegant rectangular leopard print hair claw clip with purple and brown spots - Cream Purple Spotted (D6-2-16)
Elegant vintage leopard print hair claw clip in rectangular hollow design - Vintage Tortoiseshell Leopard (D6-2-21)
+3
Leopard Print Hair Claw Clip Rectangular Hollow Resin Korean Retro Elegant Updo Headwear Hair Accessory For Women Girls
$0.84
Mix MOQ : 2
 · 
11 views
Metal Hair Claw Clips Zinc Alloy Hollow Geometric Dolphin Star Crown For Women Elegant Hairstyling Modern Accessory
Metal Hair Claw Clips Zinc Alloy Hollow Geometric Dolphin Star Crown For Women Elegant Hairstyling Modern Accessory
like
Find Similar
Elegant gold crown-shaped metal hair claw clip with smooth pearl-style finish - Flower Gold H6203
Golden hollow star-shaped metal hair claw clip displayed on a marble surface - Five-Pointed Star Gold H6411
Elegant gold metal hair claw clip with wing leaf design on white marble surface - Linear Wing Shape Gold B3323
Silver wing-shaped metal hair claw clip with pearl accents on marble surface - Linear Wing Shape Silver B3323
+9
Metal Hair Claw Clips Zinc Alloy Hollow Geometric Dolphin Star Crown For Women Elegant Hairstyling Modern Accessory
-4%
$0.82
Mix MOQ : 2
 · 
24 sold recently
Fashion Leopard Print Satin Scrunchies Set Bow Hair Ties Banana Clips Claw Clips Retro Commuter Style Women Hair Accessories
Fashion Leopard Print Satin Scrunchies Set Bow Hair Ties Banana Clips Claw Clips Retro Commuter Style Women Hair Accessories
like
Find Similar
Close-up of leopard print satin scrunchie with soft fabric texture and elegant folds - Leopard Scrunchie
Elegant black satin scrunchie with brown leopard print lace edge on a clean background - Leopard Ruffle Hair Tie
Detail view of stylish leopard print banana hair clip with elegant black satin bow accents - Leopard Ribbon Banana Clip
Elegant leopard print bow hair claw clip with black satin ribbon and gold metal detail - Leopard Ribbon Claw Clip
+2
Fashion Leopard Print Satin Scrunchies Set Bow Hair Ties Banana Clips Claw Clips Retro Commuter Style Women Hair Accessories
-13%
$0.62-1.25
No MOQ
Masonic Compass Square Letter G Cufflinks Tie Clip Lapel Pin Set Gold Blue Enamel Rhinestone Men Business Accessories
Masonic Compass Square Letter G Cufflinks Tie Clip Lapel Pin Set Gold Blue Enamel Rhinestone Men Business Accessories
like
Find Similar
Detail of Freemasonry cufflinks with blue enamel, gold plating and zircon stone - Pair of Cufflinks (B1611)
Detailed view of Freemasonry lapel pin with blue enamel and crystal on black background - Lapel Pin Brooch (C3045)
Detailed close-up of a golden Freemasonry tie clip with blue enamel and crystal accent - Tie Clip (T1128)
Masonic Compass Square Letter G Cufflinks Tie Clip Lapel Pin Set Gold Blue Enamel Rhinestone Men Business Accessories
-9%
$0.34-0.94
No MOQ
Free Shipping
Bat Hair Claw Clips Acrylic Marble Wing Shape Gothic Y2K Halloween Hair Accessories For Women Girls Non-Slip Grip
Bat Hair Claw Clips Acrylic Marble Wing Shape Gothic Y2K Halloween Hair Accessories For Women Girls Non-Slip Grip
like
Find Similar
Macro detail of gothic black bat wing hair claw clip made of polished acrylic material - Solid Black
Detail of bat-shaped hair claw with amber tortoise shell texture and gold metal spring - Red and Coffee Lines
Detail of green bat hair claw clip with marble texture for gothic Halloween hairstyles - Green Lines Pattern
Detailed view of bat wing hair claw clip in dark green and gold glitter marble acetate - Yellow and Green Pattern
+3
Bat Hair Claw Clips Acrylic Marble Wing Shape Gothic Y2K Halloween Hair Accessories For Women Girls Non-Slip Grip
$0.61-0.86
No MOQ
 · 
13 views
Go to

More in accessories

Explore more in clips

clawsharkartificialshapehandmadedesigncolorswirepearl hairshark clips
stylealloyhairpinheartsolidlongtasselbangspartyplastic hair claw

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access