Everful

Wholesale clips

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Clips

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in clips

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Creative Acetate Fruit Vegetable Shape Hair Claw Clip Handmade Glossy Fruit Series Shark Clip Ponytail Hair Accessories For Women
Creative Acetate Fruit Vegetable Shape Hair Claw Clip Handmade Glossy Fruit Series Shark Clip Ponytail Hair Accessories For Women
like
Find Similar
Chic acetate eggplant hair claw clip with purple marble pattern and green leaf design - Purple Eggplant
Detail view of a vibrant orange fruit-shaped hair claw clip on a dark wood tray - Orange
Creative dragon fruit hair claw in vibrant pink acetate with tropical leaf design - Dragon Fruit
Vibrant carrot shaped hair claw clip in orange acrylic on a rustic wooden tray - Carrot
+4
Creative Acetate Fruit Vegetable Shape Hair Claw Clip Handmade Glossy Fruit Series Shark Clip Ponytail Hair Accessories For Women
$2.74-3.31
No MOQ
Free Shipping
Cute Kitten Hair Claw Clip Acetate Acrylic Gold Outlined Cat Face Marble Shell Texture Korean Style Hair Accessories
Cute Kitten Hair Claw Clip Acetate Acrylic Gold Outlined Cat Face Marble Shell Texture Korean Style Hair Accessories
like
Find Similar
Pink marble acrylic cat hair claw clip with gold outlines and acetate finish - Cat Shape(D3-1-22) / Pink White
Cute cream cat acrylic claw clip with gold-detailed kitty face pattern for hair - Cat Shape(D3-1-21) / Beige
Pink floral cat-shaped acrylic hair claw clip with golden marble texture accents - Cat Shape(D3-1-25) / Lavender
Cute white marble acrylic hair claw clip featuring a golden cat face design for girls - Cat Shape(D3-1-23) / Water White
+1
Cute Kitten Hair Claw Clip Acetate Acrylic Gold Outlined Cat Face Marble Shell Texture Korean Style Hair Accessories
-4%
$0.80
Mix MOQ : 2
 · 
50 sold recently
Handmade Bow Hair Clips Cotton Linen Floral Embroidery Fabric Covered Alligator Clips For Toddler Girls Kids Accessories
Handmade Bow Hair Clips Cotton Linen Floral Embroidery Fabric Covered Alligator Clips For Toddler Girls Kids Accessories
like
Find Similar
Close-up of cream cotton linen hair clip with delicate floral embroidery and textured fabric - Off White
Handmade beige cotton hair clip with elegant white floral embroidery for girls - Beige
Detailed close-up of pink fabric hair clip with white embroidered floral patterns - Soft Pink
Pale pink linen bow hair clip for children with delicate white daisy embroidery - Hot Pink
+6
Handmade Bow Hair Clips Cotton Linen Floral Embroidery Fabric Covered Alligator Clips For Toddler Girls Kids Accessories
$0.29
Mix MOQ : 2
 · 
306 sold recently
Free Shipping
Elegant Hair Clips Alloy Rhinestone Faux Artificial Pearl Spring Clip For Women Korean Style Bow Floral Hair Accessories
Elegant Hair Clips Alloy Rhinestone Faux Artificial Pearl Spring Clip For Women Korean Style Bow Floral Hair Accessories
like
Find Similar
Elegant gold leaf hair clip with white faux pearls shown on model and close-up view - Pearl Leaf Spring Clip
Elegant gold bow hair clip with pearls and rhinestones shown on model and close-up - Pearl Flower Bow Spring Clip
Elegant silver leaf hair clip with rhinestones shown on model and silk background - Rhinestone Leaf Spring Clip
Sparkling silver rhinestone bow hair clip shown on model and still life view - Silver Luxury Bow Spring Clip
+28
Elegant Hair Clips Alloy Rhinestone Faux Artificial Pearl Spring Clip For Women Korean Style Bow Floral Hair Accessories
$1.01-1.67
No MOQ
Korean Style Cellulose Acetate Hair Claw Clips Geometric Checkered Leopard Print Mini Hairpins For Women French Vintage Hair Accessories
Korean Style Cellulose Acetate Hair Claw Clips Geometric Checkered Leopard Print Mini Hairpins For Women French Vintage Hair Accessories
like
Find Similar
Close-up of black hair claw clip with golden Barrette La France text and metal spring - 4.2cm Black
Detail of a brown resin hair claw clip featuring golden Barrette La France text engraving - 4.2cm Light Brown
Detailed close-up of checkerboard acetate hair claw with gold Barrette La France text - 4.2cm Checkered Black White
Close-up of tortoise shell pattern hair claw clip with golden text and metal spring - 4.2cm Amber
+5
Korean Style Cellulose Acetate Hair Claw Clips Geometric Checkered Leopard Print Mini Hairpins For Women French Vintage Hair Accessories
$1.00
No MOQ
Free Shipping
Butterfly Hair Claw Clip Acetate Rhinestone Elegant Large Shark Clip Handmade Hair Accessories For Women
Butterfly Hair Claw Clip Acetate Rhinestone Elegant Large Shark Clip Handmade Hair Accessories For Women
like
Find Similar
Pink purple butterfly acetate hair claw clip with rhinestones for elegant hairstyles - Approx 6cm / Pink Purple Gradient
Elegant butterfly hair claw clip with green acetate finish and sparkling rhinestones - Approx 6cm / Cyan and Green Gradient
Butterfly Hair Claw Clip Acetate Rhinestone Elegant Large Shark Clip Handmade Hair Accessories For Women
$3.60
No MOQ
Free Shipping
Big Bow Hair Clip Long Ribbon Streamer Artificial Pearl Luster Gauze Lolita Elegant Fairy Headpiece For Women
Big Bow Hair Clip Long Ribbon Streamer Artificial Pearl Luster Gauze Lolita Elegant Fairy Headpiece For Women
like
Find Similar
Deep blue pearlescent organza hair bow with long ribbons and shimmering metallic texture - Duckbill Hair Clips / Ice Blue
Big Bow Hair Clip Long Ribbon Streamer Artificial Pearl Luster Gauze Lolita Elegant Fairy Headpiece For Women
$0.26
No MOQ
 · 
31 sold recently
Cute Mushroom Acetate Hair Claw Clips Polka Dot Pattern Sweet Small Hairpins For Women Daily Fashion Hair Accessories
Cute Mushroom Acetate Hair Claw Clips Polka Dot Pattern Sweet Small Hairpins For Women Daily Fashion Hair Accessories
like
Find Similar
Detailed view of mushroom hair claw clip made of acetate with black and white polka dots - Black
Pink acetate mushroom hair claw clip displayed in a wooden tray with linen liner - Pink
Detailed macro shot of an orange acetate mushroom hair claw with white polka dots - Yellow
Chic mushroom-shaped acetate hair claw clip with brown marble pattern and white dots - Brown
Cute Mushroom Acetate Hair Claw Clips Polka Dot Pattern Sweet Small Hairpins For Women Daily Fashion Hair Accessories
$1.59
No MOQ
Free Shipping
Cute Fabric Floral Bow Hair Clip For Girls Sweet Gingham Polka Dot Hairpin Kids Handmade Patterned Headwear Fashion Hair Accessories
Cute Fabric Floral Bow Hair Clip For Girls Sweet Gingham Polka Dot Hairpin Kids Handmade Patterned Headwear Fashion Hair Accessories
like
Find Similar
Detail view of a blue and white checkered fabric bow hair clip on a white decorative plate - Hair Bow / Blue Plaid (1#)
Detail view of red and white checkered bow hair clip on a white decorative plate - Hair Bow / Red Plaid (2#)
Detail of cute orange gingham bow hair clip placed on a white ceramic plate - Hair Bow / Orange Plaid (3#)
Detail of vibrant orange polka dot bow hair clip placed on a white ceramic plate - #4 Fabric - Orange Polka Dot
+58
Cute Fabric Floral Bow Hair Clip For Girls Sweet Gingham Polka Dot Hairpin Kids Handmade Patterned Headwear Fashion Hair Accessories
-5%
$0.33-0.90
Mix MOQ : 2
Floral Hair Claw Clip Alloy Painted Enamel Flower Butterfly Large Non Slip Elegant Grip Headpiece For Women Girls
Floral Hair Claw Clip Alloy Painted Enamel Flower Butterfly Large Non Slip Elegant Grip Headpiece For Women Girls
like
Find Similar
Golden alloy shark hair clip with blue flowers and pearls for thick hair styling - 3D Small Flower Pearl / HS02265 Blue
Golden alloy shark hair clip with blue Haha characters and smiley face, 11.5cm size - Haha Smile Face / HS02591 Blue
Pink gradient HaHaHa metal claw clip with gold finish and smiling face design - Haha Smile Face / HS02591 Pink
Golden alloy shark hair clip featuring purple enamel characters and a smiley design - Haha Smile Face / HS02591 Purple
+29
Floral Hair Claw Clip Alloy Painted Enamel Flower Butterfly Large Non Slip Elegant Grip Headpiece For Women Girls
$1.70
Mix MOQ : 2
 · 
16 views
Plush Hair Claw Clip Faux Fur Large Shark Hairpins Fluffy Soft Autumn Winter Headwear For Women Girls Strong Hold
Plush Hair Claw Clip Faux Fur Large Shark Hairpins Fluffy Soft Autumn Winter Headwear For Women Girls Strong Hold
like
Find Similar
Plush black faux fur shark hair claw clip for thick hair in minimalist autumn style - Bulk Packaging / Black
Plush faux fur claw clip in warm brown for thick hair, soft autumn winter accessory - Bulk Packaging / Dark Coffee
Fuzzy plush shark hair claw clip in beige soft faux fur for thick hair winter styling - Bulk Packaging / Khaki
Plush pink hair claw clip with soft faux fur texture for autumn and winter hairstyles - Bulk Packaging / Light Pink
+28
Plush Hair Claw Clip Faux Fur Large Shark Hairpins Fluffy Soft Autumn Winter Headwear For Women Girls Strong Hold
$0.28-0.31
No MOQ
 · 
55 sold recently
3D Realistic Butterfly Hair Clips With Metal Spring Moving Wings Decorative Animal Hair Barrettes For Women Girls Party
3D Realistic Butterfly Hair Clips With Metal Spring Moving Wings Decorative Animal Hair Barrettes For Women Girls Party
like
Find Similar
Set of 4 vibrant artificial butterfly hair clips with colorful gradient patterns - 4.5CM / Yellow
Set of four colorful realistic butterfly hair clips on a yellow display card - 4.5CM / Red
Set of 8 realistic green butterfly hair clips with bionic texture on a white card - 4.5CM / Green
Set of 8 blue butterfly hair clips featuring lifelike patterns and semi-transparent wings - 4.5CM / Blue
+10
3D Realistic Butterfly Hair Clips With Metal Spring Moving Wings Decorative Animal Hair Barrettes For Women Girls Party
-7%
$0.12-0.14
No MOQ
 · 
12 sold recently
Team Bride Rhinestone Letter Hair Clip For Wedding Bridal Party Accessories Alloy Electroplated Metal Hair Accessory For Women
Team Bride Rhinestone Letter Hair Clip For Wedding Bridal Party Accessories Alloy Electroplated Metal Hair Accessory For Women
like
Find Similar
Golden Team Bride rhinestone letter hair clip for wedding parties and bridesmaids - Gold
Silver alloy Team Bride hair clip with clear rhinestones for wedding parties - Silver
Rose gold Team Bride rhinestone hair clip for wedding bridal party accessories - Rose Gold
Silver Team Bride hair clip with white rhinestones for wedding bachelorette parties - Gun Black
Team Bride Rhinestone Letter Hair Clip For Wedding Bridal Party Accessories Alloy Electroplated Metal Hair Accessory For Women
-5%
$1.31
No MOQ
 · 
10 sold recently
Free Shipping
Rhinestone Flower Hair Clips Ribbon Fabric BB Snap Pins Sweet Cute Princess Side Barrette Kids Girls Hair Accessories
Rhinestone Flower Hair Clips Ribbon Fabric BB Snap Pins Sweet Cute Princess Side Barrette Kids Girls Hair Accessories
like
Find Similar
Pair of purple ribbon flower hair clips with central rhinestone on metal BB base - Light Purple
Pair of red fabric flower hair clips for girls with sparkling rhinestone center - Red
Pair of rose red fabric flower BB clips with rhinestones for girls hair styling - Rose Red
Pair of red satin flower hair clips for girls with sparkling rhinestone centers - Burgundy
+16
Rhinestone Flower Hair Clips Ribbon Fabric BB Snap Pins Sweet Cute Princess Side Barrette Kids Girls Hair Accessories
$0.16
Mix MOQ : 20
 · 
12 sold recently
Marble Pattern Hair Claw Clip Butterfly Shell Square Acetate Resin Nonslip Elegant Hair Accessory For Women
Marble Pattern Hair Claw Clip Butterfly Shell Square Acetate Resin Nonslip Elegant Hair Accessory For Women
like
Find Similar
Pink marble butterfly hair claw clip with acetate finish and glossy resin texture - Individual Packaging / Pink Butterfly 6.5cm
Butterfly hair claw clip with cream and grey marble pattern for elegant updos - Individual Packaging / Brown Coffee Butterfly 6.5cm
Butterfly hair claw clip in light green marble finish with durable metal spring - Individual Packaging / Green Butterfly 6.5cm
Butterfly hair claw clip with grey marble pattern and golden spring for styling - Individual Packaging / Grey Butterfly 6.5cm
+40
Marble Pattern Hair Claw Clip Butterfly Shell Square Acetate Resin Nonslip Elegant Hair Accessory For Women
$0.76-1.18
No MOQ
Acetate Hair Claw Clip Cute Cartoon Food Fruit Animal Shapes Handmade Fashion Hair Styling Accessories For Women Girls
Acetate Hair Claw Clip Cute Cartoon Food Fruit Animal Shapes Handmade Fashion Hair Styling Accessories For Women Girls
like
Find Similar
Cute yellow juice cup shaped acetate hair claw clip with lemon detail and straw - Orange Juice / 9.7cm*5.5cm
Creative translucent purple goldfish bag hair claw clip with unique 3D design - Transparent Bag Goldfish / 9.6cm*5.6cm
Close-up of light blue candy bag hair claw with a pink bow on a textured background - Blue Candy Bag/Wishing Bottle / 9.6cm*5.6cm
Cute translucent orange hair claw clip with vibrant tropical fish patterns for summer - Orange Flatfish / 8.3cm*4.5cm
Acetate Hair Claw Clip Cute Cartoon Food Fruit Animal Shapes Handmade Fashion Hair Styling Accessories For Women Girls
-4%
$2.96-3.81
No MOQ
 · 
26 views
Funny Simulation Food Hair Clips Realistic Resin Pizza Hot Dog Croissant Bread Duckbill Side Hairpins For Women Girls Cute
Funny Simulation Food Hair Clips Realistic Resin Pizza Hot Dog Croissant Bread Duckbill Side Hairpins For Women Girls Cute
like
Find Similar
Cute resin croissant hair clip with realistic bread texture on display card - Croissant
Creative baguette hair clip in caramel finish fixed on branded white card - Baguette
Cute strawberry tart duckbill hair clip with resin dessert design on white card - Strawberry Cake
Pair of cute cartoon pizza hair clips with funny faces on a white display card - Pizza
+1
Funny Simulation Food Hair Clips Realistic Resin Pizza Hot Dog Croissant Bread Duckbill Side Hairpins For Women Girls Cute
$0.40
No MOQ
 · 
13 views
Starfish Shape Acrylic Hair Claw Clip Fashion Marble Texture Sea Star Hair Clip Non-Slip Hair Accessories For Women
Starfish Shape Acrylic Hair Claw Clip Fashion Marble Texture Sea Star Hair Clip Non-Slip Hair Accessories For Women
like
Find Similar
Starfish acetate hair claw clip with pink and turquoise marble pattern and small dots - Pink and Green
Starfish shape acetic acid hair claw clip with pink and orange floral marble texture - Pink Yellow
Starfish shaped hair claw clip in blue and white marble acetate with pearl accents - Beige and Green
Starfish shaped acetate hair claw clip with blue marble texture and yellow dot details - Blue-Yellow
Starfish Shape Acrylic Hair Claw Clip Fashion Marble Texture Sea Star Hair Clip Non-Slip Hair Accessories For Women
$1.35
No MOQ
Hanfu Ethnic Flower Rabbit Tassel Hair Clips For Girls Kids Alloy Resin Imitation Artificial Pearl Decorative Accessories
Hanfu Ethnic Flower Rabbit Tassel Hair Clips For Girls Kids Alloy Resin Imitation Artificial Pearl Decorative Accessories
like
Find Similar
Detailed view of handmade goldfish and flower hair clips with elegant long tassels - 1# Red Goldfish Pearl Pair Clips
Detail of rabbit hair clips with tassels and pearl moon design for girls' Hanfu costume - 2# Yellow Moon Rabbit Pearl Pair Clips
Handmade Chinese style butterfly and floral hair clips with tassels for girls - 3# Three-petal Flower Butterfly Pearl Pair Clips
Detailed view of red butterfly hair clips with golden tassels and colorful beads - 4# Pearl Butterfly Pearl Pair Clips
+8
Hanfu Ethnic Flower Rabbit Tassel Hair Clips For Girls Kids Alloy Resin Imitation Artificial Pearl Decorative Accessories
$1.56-1.67
No MOQ
 · 
19 views
Elegant Rhinestone Hair Clips And Faux Artificial Pearl Hairpins Alloy Gold Plated Retro Vintage Style Korean For Women
Elegant Rhinestone Hair Clips And Faux Artificial Pearl Hairpins Alloy Gold Plated Retro Vintage Style Korean For Women
like
Find Similar
Five-piece set of vintage emerald green rhinestone hair clips with gold alloy base - Dark Green Gold 5-Piece Set
Vintage emerald green rhinestone hair clip set with pearls on a gold metal base - Emerald Green 2-Piece Set
Three-piece vintage emerald rhinestone and pearl hair clips set with gold finish - Dark Green 3-Piece Set
Elegant 4-piece set of vintage black rhinestone and pearl hair clips for women - Grey 4-Piece Set
+20
Elegant Rhinestone Hair Clips And Faux Artificial Pearl Hairpins Alloy Gold Plated Retro Vintage Style Korean For Women
-5%
$0.44-2.16
No MOQ
 · 
51 sold recently
French Minimalist Cellulose Acetate Rectangle Hair Clip Alloy Barrette Solid Color Bangs Clip Elegant Hair Jewelry For Women
French Minimalist Cellulose Acetate Rectangle Hair Clip Alloy Barrette Solid Color Bangs Clip Elegant Hair Jewelry For Women
like
Find Similar
Macro detail of dark brown acetate hair clip featuring gold Barrette La France text - Dark Coffee
Detail showing mint green acetate barrette with Barrette La France text on linen - Cream
Detail of glossy deep red acetate barrette featuring elegant Barrette la France script lettering - Red
Close-up of tortoise shell pattern barrette on linen pouch with golden engraving - Blue Brown
+5
French Minimalist Cellulose Acetate Rectangle Hair Clip Alloy Barrette Solid Color Bangs Clip Elegant Hair Jewelry For Women
$0.72
No MOQ
Butterfly Hair Claw Clips Acetate Marble Tortoise Pattern Large Hair Clamp Strong Hold Elegant Hair Accessories For Women
Butterfly Hair Claw Clips Acetate Marble Tortoise Pattern Large Hair Clamp Strong Hold Elegant Hair Accessories For Women
like
Find Similar
Minimalist gradient pink butterfly hair claw clip with acetate finish on white tray - 5.5cm / Phantom Purple
Elegant blue marble butterfly hair claw clip with acetate finish for stylish updos - 5.5cm / Water Ripple Blue
Elegant butterfly hair claw clip with blue and white gradient finish in acetate resin - 5.5cm / Metallic Blue
Pink butterfly hair claw clip with transparent finish and durable metal spring - 5.5cm / Transparent Pink
+24
Butterfly Hair Claw Clips Acetate Marble Tortoise Pattern Large Hair Clamp Strong Hold Elegant Hair Accessories For Women
-5%
$1.48
No MOQ
 · 
12 views
Free Shipping
Handmade Acetate Dragonfly Hair Claw Clip For Women High Quality Cartoon Insect Shape Shark Clip Fashion Hair Accessories
Handmade Acetate Dragonfly Hair Claw Clip For Women High Quality Cartoon Insect Shape Shark Clip Fashion Hair Accessories
like
Find Similar
Chic purple and green dragonfly claw clip made of acetic acid hair accessory for women - Purple/Green Patchwork (Black Dragonfly) / Black
Detailed macro view of the dragonfly acetate hair claw clip with unique amber wings - Amber/Transparent Yellow (Brown Dragonfly) / Brown
Stereoscopic dragonfly hair claw clip made of colorful acetate in a creative 3D design - Pink/Green Combination (Pink Dragonfly) / Pink
Handmade Acetate Dragonfly Hair Claw Clip For Women High Quality Cartoon Insect Shape Shark Clip Fashion Hair Accessories
$5.42
No MOQ
Free Shipping
Handmade Children Grosgrain Ribbon Swallowtail Bow Hair Clips Set Cute Western Style Girls Daily All-match Hairpins Accessories
Handmade Children Grosgrain Ribbon Swallowtail Bow Hair Clips Set Cute Western Style Girls Daily All-match Hairpins Accessories
like
Find Similar
10-piece set of mini grosgrain ribbon hair bows in navy white pink and ginger colors - Grosgrain Assorted Mix (10AQ)
Five-pack of colorful grosgrain ribbon swallowtail hair bows for girls on a white card display - Bright Five Tone Mix (10M)
Detailed set of 10 ribbon bow hair clips for girls displayed on a white product card - Pink Sweet Mix (10H)
20-piece colorful grosgrain ribbon swallowtail hair bow clips set for young girls - Large Assorted Mix (20H)
+8
Handmade Children Grosgrain Ribbon Swallowtail Bow Hair Clips Set Cute Western Style Girls Daily All-match Hairpins Accessories
$0.42-1.35
Mix MOQ : 2
Acetate Resin Alloy Metal Seamless Hair Clips No Crease Duckbill Barrettes Colorful Marble Pattern Makeup For Women
Acetate Resin Alloy Metal Seamless Hair Clips No Crease Duckbill Barrettes Colorful Marble Pattern Makeup For Women
like
Find Similar
Detail shot of vintage style duckbill hair clip with textured pearl finish on wooden tray - Milky White Grid
Detail view of yellow marble acetate hair clip on a wooden tray with elegant aesthetics - Milky Yellow Colorful
Detail view of the metal duckbill clip back and marble-patterned resin on the hairpin - Coffee Plaid
Detail of amber tortoiseshell cellulose acetate hair clip with gold metal base on white background - Coffee Yellow Colorful
Acetate Resin Alloy Metal Seamless Hair Clips No Crease Duckbill Barrettes Colorful Marble Pattern Makeup For Women
$0.43
No MOQ
 · 
72 sold recently
Free Shipping
Evil Eye Acetate Hair Claw Clip Large Nazar Eye Shark Clip For Women Chic Bohemian Hair Accessories Headwear
Evil Eye Acetate Hair Claw Clip Large Nazar Eye Shark Clip For Women Chic Bohemian Hair Accessories Headwear
like
Find Similar
Detail shot of a black Evil Eye hair claw clip featuring blue eye and golden details - 2# Small Eye
Black eye-shaped hair claw with blue heart-shaped Nazar evil eye charm design - 6# Heart Eye
Evil Eye Acetate Hair Claw Clip Large Nazar Eye Shark Clip For Women Chic Bohemian Hair Accessories Headwear
$1.48
No MOQ
 · 
12 sold recently
Girls Starfish Shell Sequin Hair Clips Cute Princess Shimmering Mesh Bow Side Clips Children Sweet Ocean Style Headwear Accessories
Girls Starfish Shell Sequin Hair Clips Cute Princess Shimmering Mesh Bow Side Clips Children Sweet Ocean Style Headwear Accessories
like
Find Similar
Children's purple sequined shell hair clip with a pink mesh bow and small beads - Blue Shell
Glittery pink starfish hair clip for girls with a sheer ribbon bow on a display card - Pink Starfish
Pink starfish girl hair clip with glitter finish and mesh bow on display card - Rose Red Starfish
Red starfish hair clip with pink mesh bow accessory for girls on display card - Red Starfish
+8
Girls Starfish Shell Sequin Hair Clips Cute Princess Shimmering Mesh Bow Side Clips Children Sweet Ocean Style Headwear Accessories
$0.24
Mix MOQ : 2
 · 
18 sold recently
Oversized Satin Bow Banana Hair Clip Elegant Multi Layer Ponytail Holder French Style Fabric Hair Accessories For Women
Oversized Satin Bow Banana Hair Clip Elegant Multi Layer Ponytail Holder French Style Fabric Hair Accessories For Women
like
Find Similar
Elegant oversized brown silk bow banana hair clip for stylish ponytail and bun styling - Banana Clip / Khaki Brown
Large black satin bow banana clip with vertical hairpin design for elegant ponytails - Banana Clip / Black
Oversized Satin Bow Banana Hair Clip Elegant Multi Layer Ponytail Holder French Style Fabric Hair Accessories For Women
$2.59
No MOQ
Macaron Color Wave Border BB Hair Clips Rectangular Plastic Alloy Seamless Hairpins For DIY Handmade Jewelry Accessories
Macaron Color Wave Border BB Hair Clips Rectangular Plastic Alloy Seamless Hairpins For DIY Handmade Jewelry Accessories
like
Find Similar
Detail view of two yellow rectangle hair clips with wavy edges on a white ceramic plate - 2x5.4cm / Yellow
Macaron pink wavy rectangular hair clips displayed on a stylish white ceramic plate - 2x5.4cm / Pink
Close-up of pink macaron wavy rectangle hair clips on a decorative white ceramic plate - 2x5.4cm / Peach Pink
Close-up of two baby blue rectangular wavy hair clips on a decorative ceramic dish - 2x5.4cm / Blue
+3
Macaron Color Wave Border BB Hair Clips Rectangular Plastic Alloy Seamless Hairpins For DIY Handmade Jewelry Accessories
$0.08
No MOQ
 · 
13 views
Kids Rainbow Spiral Telephone Wire Hair Ties Cartoon Flower Heart Bow Plastic Resin Elastic Hair Clips For Girls
Kids Rainbow Spiral Telephone Wire Hair Ties Cartoon Flower Heart Bow Plastic Resin Elastic Hair Clips For Girls
like
Find Similar
Pastel macaron bead hair claw clip with colorful pearls on a white porcelain plate - Clear/Mixed Color Beads
Cute colorful spiral hair ties with blue pink and beige beads for young girls - White/Mixed Pastel Beads
Rainbow spiral telephone wire hair tie with a cute smiling sunflower decoration - Sunflower Smile/Rainbow Spiral
Cute heart-shaped hair claw with brown spiral telephone wire band for kids - Beige Heart/Amber Spiral
+17
Kids Rainbow Spiral Telephone Wire Hair Ties Cartoon Flower Heart Bow Plastic Resin Elastic Hair Clips For Girls
-17%
$0.25-0.33
No MOQ
 · 
10 views
Mini Hair Claw Clips Acetate Marble Tortoise Shell Pattern Elegant Small Hairpin Accessories For Women Girls
Mini Hair Claw Clips Acetate Marble Tortoise Shell Pattern Elegant Small Hairpin Accessories For Women Girls
like
Find Similar
Mini acetate hair claw clip featuring a sweet pink marble texture and elegant design - Floral Purple
Mini acetate hair claw clip with brown marble pattern and high-gloss pearlescent finish - Rainbow
Mini acetate hair claw clip featuring a brown tortoiseshell pattern and glossy finish - Coffee Tortoise Shell
Mini marble pattern acetate hair claw clip with sweet blue and purple artistic swirls - Sapphire Blue
+21
Mini Hair Claw Clips Acetate Marble Tortoise Shell Pattern Elegant Small Hairpin Accessories For Women Girls
-4%
$0.82
No MOQ
 · 
41 sold recently
Minimalist Geometric Hair Clip Zinc Alloy Hollow Out Gold Silver Metal Barrette For Women Elegant Headwear Accessories
Minimalist Geometric Hair Clip Zinc Alloy Hollow Out Gold Silver Metal Barrette For Women Elegant Headwear Accessories
like
Find Similar
Minimalist golden hollow heart-shaped metal hair clip with a sleek geometric alloy design - Gold Large Heart
Minimalist geometric triangle hair clip in golden alloy finish for women styling - Gold Triangle
Elegant gold hollow star hair clip with minimalist geometric metal design for women - Golden Starfish
Minimalist geometric hollow flower hair clip in polished gold finish for women - Gold Hollow Flower
+13
Minimalist Geometric Hair Clip Zinc Alloy Hollow Out Gold Silver Metal Barrette For Women Elegant Headwear Accessories
$0.29
No MOQ
 · 
20 sold recently
Star Hair Clips Flocked Velvet Gold Glitter Snap Hairpin Sweet Simple Korean Style Kids Girls Hair Accessories Autumn Winter
Star Hair Clips Flocked Velvet Gold Glitter Snap Hairpin Sweet Simple Korean Style Kids Girls Hair Accessories Autumn Winter
like
Find Similar
Set of two red velvet star hair clips with gold glitter accents for kids and women - Red
Navy blue velvet waterdrop hair clips with gold glitter star set for kids - Gray
Star-shaped velvet hair clips in dark green with golden glitter, set of two for girls - Green
Set of two pink velvet star hair clips with gold glitter finish on a display card - Pink
+1
Star Hair Clips Flocked Velvet Gold Glitter Snap Hairpin Sweet Simple Korean Style Kids Girls Hair Accessories Autumn Winter
$0.78
No MOQ
 · 
67 sold recently
3D Butterfly Hair Clips Elegant Fabric Embroidery Metal Rhinestone Tassel Artificial Pearl Hairpins Fairy Style Women Girls Headwear
3D Butterfly Hair Clips Elegant Fabric Embroidery Metal Rhinestone Tassel Artificial Pearl Hairpins Fairy Style Women Girls Headwear
like
Find Similar
Detail of ethereal butterfly hair clip with mesh wings, gold metal and long tassel chains - Tulle Layered Butterfly (Left) / Gold
Elegant silver butterfly hair clip with metallic texture for Hanfu on black fabric - Butterfly Duckbill Clip / Silver
Silver butterfly hair clip with long tassel and pearl accents, approx. 20.3*5.5cm size - Butterfly Tassel Style / Silver
Traditional butterfly hair clip with purple wings and elegant pearl pendant detail - Resin Pearl Butterfly / Purple
+42
3D Butterfly Hair Clips Elegant Fabric Embroidery Metal Rhinestone Tassel Artificial Pearl Hairpins Fairy Style Women Girls Headwear
-5%
$0.58-4.73
No MOQ
Free Shipping
Acetate Hair Clips Slim Rectangle Marble Pattern Tortoise Shell Metal Bobby Pins Side Clips For Women Girls Accessory
Acetate Hair Clips Slim Rectangle Marble Pattern Tortoise Shell Metal Bobby Pins Side Clips For Women Girls Accessory
like
Find Similar
Pink marble pattern acetate hair clip with golden metal fastener for women - Shell Pink
Pink and red marbled acetate hair clip with golden metal base for elegant styling - Burgundy
Minimalist dark brown and beige acetate hair clip with golden metal fastener - Chocolate
White acetate hair clip with gold metal base and minimalist bar design for women - Pearl White
+12
Acetate Hair Clips Slim Rectangle Marble Pattern Tortoise Shell Metal Bobby Pins Side Clips For Women Girls Accessory
$0.58
Mix MOQ : 2
 · 
66 sold recently
Free Shipping
Kids Hair Bow Clips Grosgrain Ribbon American Football Baseball Patterns Sporty Cheerleading Accessories For Girls
Kids Hair Bow Clips Grosgrain Ribbon American Football Baseball Patterns Sporty Cheerleading Accessories For Girls
like
Find Similar
Macro detail of white ribbon hair bow with red baseball stitching and central red band - 5#-White Baseball Stitch
Close-up of white grosgrain bow hair clip with brown football and orange maple leaf patterns - 1#-Brown Football and Maple Leaf
Detail of white grosgrain ribbon hair bow with printed red American football pattern - 2#-Red Football Stitch
Detail of white grosgrain bow with rugby and helmet print on a sturdy metal clip - 3#-White Football and Helmet
+2
Kids Hair Bow Clips Grosgrain Ribbon American Football Baseball Patterns Sporty Cheerleading Accessories For Girls
-6%
$0.30
No MOQ
 · 
42 sold recently
Flower Hair Claw Clips Plumeria Frangipani Resin Gradient Style Decorative Accessories For Women Girls Summer Beach Wear
Flower Hair Claw Clips Plumeria Frangipani Resin Gradient Style Decorative Accessories For Women Girls Summer Beach Wear
like
Find Similar
Detailed view of a 4cm translucent smoky grey plumeria hair claw clip with fine glitter - Black Glitter
Close-up of 4cm glitter plumeria hair claw with pink orange gradient resin finish - Yellow Glitter
Detailed macro view of 4cm transparent glitter plumeria hair claw in blue gradient - Blue Glitter
Detail view of 4cm transparent glitter purple gradient flower hair claw clip with sparkles - Purple Glitter
+76
Flower Hair Claw Clips Plumeria Frangipani Resin Gradient Style Decorative Accessories For Women Girls Summer Beach Wear
$0.29
No MOQ
 · 
24 sold recently
Large Metal Alloy Floral Wheat Hair Claw Clips For Women Elegant Rhinestone Artificial Pearl Shark Clip Hair Accessory Styling Tool
Large Metal Alloy Floral Wheat Hair Claw Clips For Women Elegant Rhinestone Artificial Pearl Shark Clip Hair Accessory Styling Tool
like
Find Similar
Elegant large wheat ear shark hair claw clip in shiny gunmetal black with rhinestones - Wheat Ear Style Gunmetal (11CM) / Bulk Packaging
Elegant gold metal shark hair claw clip with crystal wheat ears and pearl detail - Wheat Ear Style Gold (11CM) / Bulk Packaging
Detail of elegant gold tulip hair claw clip with pink enamel petals and green leaf accents - Enamel Dusty Pink Tulip / Bulk Packaging
Detail of elegant gold wheat-shaped hair claw with yellow and green enamel finish - Large Wheat Claw-Enamel Style / Bulk Packaging
+46
Large Metal Alloy Floral Wheat Hair Claw Clips For Women Elegant Rhinestone Artificial Pearl Shark Clip Hair Accessory Styling Tool
$1.03-2.02
No MOQ
Acrylic Iridescent Fruit Print Large Hair Claw Clip Sweet Colorful Strawberry Pineapple Watermelon Shark Clip For Women Hair Styling Accessories
Acrylic Iridescent Fruit Print Large Hair Claw Clip Sweet Colorful Strawberry Pineapple Watermelon Shark Clip For Women Hair Styling Accessories
like
Find Similar
Detail of pink translucent hair claw clip with strawberry print and gloss finish - Strawberry (10.3cm)
Detail of white acetate hair claw clip featuring yellow pineapple print and text - Pineapple (10.3cm)
Detail of light blue semi-transparent claw clip with yellow orange prints on a laptop - Orange (10.3cm)
Pink rectangle hair claw clip with watermelon pattern on a silver laptop surface - Watermelon (10.3cm)
Acrylic Iridescent Fruit Print Large Hair Claw Clip Sweet Colorful Strawberry Pineapple Watermelon Shark Clip For Women Hair Styling Accessories
$2.16
No MOQ
Luxury Gold Plated Copper Men's Tie Clip Modern Business Alphabet Initial Tie Bar Formal Suit Accessory For Men
Luxury Gold Plated Copper Men's Tie Clip Modern Business Alphabet Initial Tie Bar Formal Suit Accessory For Men
like
Find Similar
Gold stainless steel tie clip featuring a round black enamel detail with letter A - Letter A(A)
Polished golden metal tie clip featuring a black round charm with capital letter B - Letter B(B)
Elegant gold stainless steel tie clip set featuring a black round letter C initial charm - Letter C(C)
Golden tie clip set featuring black enamel round charm with letter D on mirror base - Letter D(D)
+22
Luxury Gold Plated Copper Men's Tie Clip Modern Business Alphabet Initial Tie Bar Formal Suit Accessory For Men
-8%
$1.05
Mix MOQ : 2
Rhinestone Flower Hair Clip Multi Tooth Duckbill Hair Claw Elegant Korean Style Sparkling Floral Headpiece For Women
Rhinestone Flower Hair Clip Multi Tooth Duckbill Hair Claw Elegant Korean Style Sparkling Floral Headpiece For Women
like
Find Similar
Elegant Korean style gold and blue rhinestone floral hair clip for women stylish updo - Ink Blue Grey Peach Blossom
Elegant purple rhinestone double flower hair clip with black resin base for women - Violet Peach Blossom
Elegant black hair claw clip with amber rhinestone flowers and model back view - Champagne Peach Blossom
Elegant purple rhinestone flower hair clip with a model showing the back hairstyle view - Elegant Purple Peach Blossom
+1
Rhinestone Flower Hair Clip Multi Tooth Duckbill Hair Claw Elegant Korean Style Sparkling Floral Headpiece For Women
$1.27
No MOQ
 · 
31 sold recently
Sports Theme Hair Claw Clip Basketball Football Baseball Tennis Bowling Acetate Acrylic Hair Shark Clip For Women Girls
Sports Theme Hair Claw Clip Basketball Football Baseball Tennis Bowling Acetate Acrylic Hair Shark Clip For Women Girls
like
Find Similar
Gray marble bowling pin hair claw clip with red stripes and white teeth on a desk - 6cm / Bowling Style
Creative basketball shaped hair claw clip with orange marble texture and black lines - 6cm / Basketball
Baseball style hair claw clip featuring white pearlescent finish and red stitch design - 6cm / Baseball
Soccer pattern hair claw clip with black and white pearlescent acetate finish - 6cm / Football
+1
Sports Theme Hair Claw Clip Basketball Football Baseball Tennis Bowling Acetate Acrylic Hair Shark Clip For Women Girls
-4%
$1.15
No MOQ
 · 
101 sold recently
Kids Cartoon Unicorn Hair Clips With Long Colorful Gradient Synthetic Hair Extensions Glitter Sequin Hairpins For Girls
Kids Cartoon Unicorn Hair Clips With Long Colorful Gradient Synthetic Hair Extensions Glitter Sequin Hairpins For Girls
like
Find Similar
Cute children's glitter chick hair clip with white to pink gradient synthetic hair extension - 1# Yellow Rooster
Cute white bunny hair clip with long pink gradient hair extensions for young girls - 2# White Rabbit
Glitter unicorn hair clip with long pink and blue gradient hair piece for girls - 3# Running Horse
Glitter unicorn hair clip with pink and blue gradient long hair extension for girls - 4# Unicorn Head
+4
Kids Cartoon Unicorn Hair Clips With Long Colorful Gradient Synthetic Hair Extensions Glitter Sequin Hairpins For Girls
$0.58
No MOQ
 · 
27 views
Large Hair Claw Clips Pumpkin Shape Plastic Resin Strong Hold Elegant Shark Clip For Thick Hair Women Minimalist Style
Large Hair Claw Clips Pumpkin Shape Plastic Resin Strong Hold Elegant Shark Clip For Thick Hair Women Minimalist Style
like
Find Similar
Detail of a large purple pumpkin hair claw with a durable golden spring on a white desk - Purple
Detailed close-up of a large pumpkin hair claw clip on a white table with floral decor - Dark Gray
Detail view of large dark green pumpkin hair claw clip with golden metal spring mechanism - Dark Green
Detail view of large dark purple hair claw clip with strong golden alloy spring mechanism - Cherry Red
+30
Large Hair Claw Clips Pumpkin Shape Plastic Resin Strong Hold Elegant Shark Clip For Thick Hair Women Minimalist Style
-5%
$1.45
No MOQ
Matte Plastic Twisted Banana Hair Clip Non-Slip Large Hairpin For Women French Vintage Style Bun Fixing Tool
Matte Plastic Twisted Banana Hair Clip Non-Slip Large Hairpin For Women French Vintage Style Bun Fixing Tool
like
Find Similar
Macro shot of a matte black 8-shaped banana hair clip on a clean white surface - Matte Black
Detailed close-up of brown matte banana hair clip with minimalist twisted design - Matte Coffee
Detail of matte purple banana hair clip with a stylish twist design on a clean white surface - Matte Purple
Detail of a brown twisted banana hair clip for ponytails on a clean white desk surface - Matte Yellow
+2
Matte Plastic Twisted Banana Hair Clip Non-Slip Large Hairpin For Women French Vintage Style Bun Fixing Tool
$0.29
No MOQ
 · 
49 sold recently
Elegant Flower Metal Hair Claw Clip Alloy Vintage Style Hair Accessory For Women Gold Silver Tones
Elegant Flower Metal Hair Claw Clip Alloy Vintage Style Hair Accessory For Women Gold Silver Tones
like
Find Similar
Detailed top view of a silver floral metal hair claw clip on white textured paper - Silver
Elegant Flower Metal Hair Claw Clip Alloy Vintage Style Hair Accessory For Women Gold Silver Tones
$1.87
No MOQ
Natural Crystal Stone Chips Hair Clip Handmade Metal Bobby Pin For Women Girls Boho Style Hair Accessories
Natural Crystal Stone Chips Hair Clip Handmade Metal Bobby Pin For Women Girls Boho Style Hair Accessories
like
Find Similar
Close-up of a gold hair clip with natural raw pink crystal stones on a dark tray - Rose Quartz Gold
Golden hair clip featuring purple natural crystal stone chips on a wooden tray - Amethyst Gold
Gold hair clip with natural green crystal stone chips and minimalist bar design - Green Aventurine Gold
Detail view of gold bobby pin featuring natural colorful crystal stones and polished metal - Indian Agate Gold
+36
Natural Crystal Stone Chips Hair Clip Handmade Metal Bobby Pin For Women Girls Boho Style Hair Accessories
-5%
$1.21
No MOQ
 · 
14 views
Free Shipping
Halloween Kids Bow Hair Clip Pumpkin Ghost Spider Pattern Grosgrain Ribbon Barrettes For Toddler Girls Festival Accessories
Halloween Kids Bow Hair Clip Pumpkin Ghost Spider Pattern Grosgrain Ribbon Barrettes For Toddler Girls Festival Accessories
like
Find Similar
Halloween triple bow hair clip with white spider web pattern and green hat spider - 3# Spider Web Cartoon Spider
Halloween triple-layered bow hair clip with cute spook ghost print and candy bag charm - 9# Black Boo Candy Bag
Halloween orange hair bow with black spiders and haunted house decor for kids - 18# Orange Haunted House
Halloween purple triple-layer ribbon bow clip with spooky bats and spider web patterns - 1# Purple Bat
+16
Halloween Kids Bow Hair Clip Pumpkin Ghost Spider Pattern Grosgrain Ribbon Barrettes For Toddler Girls Festival Accessories
-5%
$0.38
No MOQ
 · 
35 sold recently
Cartoon Dog Hair Claw Clip Acetate Acrylic Dalmatian Pattern Rhinestone Accents Cute Hair Accessory For Women
Cartoon Dog Hair Claw Clip Acetate Acrylic Dalmatian Pattern Rhinestone Accents Cute Hair Accessory For Women
like
Find Similar
Detail of dalmatian puppy hair claw clip with colorful rhinestones on a book page - Colorful Rhinestone Puppy / Approx. 10.3cm
Chic Dalmatian dog acrylic hair claw clip displayed on a modern magazine background - Black Spotted Dog / Approx. 10.3cm
Cartoon Dog Hair Claw Clip Acetate Acrylic Dalmatian Pattern Rhinestone Accents Cute Hair Accessory For Women
$1.96-2.74
No MOQ
 · 
1 reviews
Elegant Hair Claw Clip Alloy With Rhinestone And Faux Artificial Pearl Geometric Moon Heart Shape Non-Slip Accessory For Women
Elegant Hair Claw Clip Alloy With Rhinestone And Faux Artificial Pearl Geometric Moon Heart Shape Non-Slip Accessory For Women
like
Find Similar
Macro detail of 7.7cm gold hair claw clip with multi-row rhinestone and mirror reflection - Full Rhinestone Large Crescent 7.7CM Claw Clip
Detailed view of 4cm gold heart hair claw clip with inlaid white rhinestones - Full Rhinestone Heart 4CM Claw Clip
Detail of 4cm gold heart hair claw with pearls and rhinestones on black background - Half Rhinestone Half Pearl Heart 4CM Claw Clip
Silver geometric hair claw clip with rhinestones, sized 7.7cm by 4.5cm, weights 35g - Full Rhinestone Silver Large Crescent 7.7CM Claw Clip
+21
Elegant Hair Claw Clip Alloy With Rhinestone And Faux Artificial Pearl Geometric Moon Heart Shape Non-Slip Accessory For Women
-5%
$0.49-0.76
No MOQ
 · 
13 sold recently
Acrylic Resin Hair Clips Candy Color Cartoon Heart Star Flower Smiley Barrettes For Toddler Baby Girls Korean Style
Acrylic Resin Hair Clips Candy Color Cartoon Heart Star Flower Smiley Barrettes For Toddler Baby Girls Korean Style
like
Find Similar
Set of two candy-colored heart hair clips in magenta finish for girls and toddlers - [1] Heart Style - Magenta
Set of two mint green heart hair clips for girls in candy color Korean style - [2] Heart Style - Green
Neon green heart-shaped jelly hair clips for girls set of two on display card - [3] Heart Style - Grass Green
Set of two bright blue heart-shaped hair clips for girls on a black display card - [4] Heart Style - Blue
+22
Acrylic Resin Hair Clips Candy Color Cartoon Heart Star Flower Smiley Barrettes For Toddler Baby Girls Korean Style
$0.86
No MOQ
 · 
16 views
Free Shipping
Large Leopard Print Acetate Hair Claw Clip For Women High Quality Cheetah Pattern Hair Catch Shark Jaw Clip Hair Accessories
Large Leopard Print Acetate Hair Claw Clip For Women High Quality Cheetah Pattern Hair Catch Shark Jaw Clip Hair Accessories
like
Find Similar
Macro shot of large leopard hair claw clip in deep mahogany on a ceramic plate - Red
Detailed view of leopard print hair claw clip featuring a cheetah motif on a ceramic plate - Yellow Leopard
Detailed view of a green leopard print hair claw clip on a decorative white porcelain plate - Green
Detailed view of a large purple hair claw with leopard print on a porcelain plate - Fuschia
+5
Large Leopard Print Acetate Hair Claw Clip For Women High Quality Cheetah Pattern Hair Catch Shark Jaw Clip Hair Accessories
$0.23-1.96
No MOQ
Western Style Hair Claw Clip Faux Leather Cactus Lightning Bolt Letters Rectangle Shark Hairpin For Women
Western Style Hair Claw Clip Faux Leather Cactus Lightning Bolt Letters Rectangle Shark Hairpin For Women
like
Find Similar
Yellow rectangular hair claw with pink LETS GO GIRLS text and white star patterns - Girls Lets Go Letter
Western style leather hair claw clip with pink lightning pattern on beige finish - Pink Lightning Pattern
Beige cowboy hair claw clip featuring blue COOL IT COWBOY text in rectangular design - Cool Cowboy Blue Letter
Rectangle hair claw clip with beige base and colorful cactus pattern on leather - Green Cactus Pattern
Western Style Hair Claw Clip Faux Leather Cactus Lightning Bolt Letters Rectangle Shark Hairpin For Women
$1.21
No MOQ
 · 
14 sold recently
Cute Plush Rabbit Hair Clips And Hair Ties With Bow Ornament For Girls Handmade Sweet Cartoon Hair Accessories For Kids
Cute Plush Rabbit Hair Clips And Hair Ties With Bow Ornament For Girls Handmade Sweet Cartoon Hair Accessories For Kids
like
Find Similar
Close-up of pink plush bunny hair clip with bow on card, high-quality handmade hair accessory - Pink Rabbit Hair Clip
Cute white plush rabbit hair clip with brown checkered bow for girls ponytail style - Off-white Rabbit Hair Clip
Cute light brown plush bunny hair clip with plaid bow displayed on a pink card - Light Coffee Rabbit Hair Clip
Detail of plush beige rabbit hair tie with brown plaid bow on pink star card - Light Coffee Rabbit Hair Tie
+5
Cute Plush Rabbit Hair Clips And Hair Ties With Bow Ornament For Girls Handmade Sweet Cartoon Hair Accessories For Kids
$0.92
No MOQ
 · 
11 views
Free Shipping
Minimalist PU Leather Rectangular BB Hair Clips Handmade Stitching Edge Bangs Side Hairpins Geometric Headwear For Women Girls
Minimalist PU Leather Rectangular BB Hair Clips Handmade Stitching Edge Bangs Side Hairpins Geometric Headwear For Women Girls
like
Find Similar
Detail view of black leather hair clip with fine stitching and rectangular rounded corners - Black
Brown rectangular faux leather BB hair clip with stitch detail on minimalist wood tray - Dark Coffee
Detail of square brown leather hair clip with fine stitching on a wooden tray - Light Coffee
Detail of a square leather hair clip with ginger yellow fabric on a wooden tray - Khaki
+4
Minimalist PU Leather Rectangular BB Hair Clips Handmade Stitching Edge Bangs Side Hairpins Geometric Headwear For Women Girls
$0.23
No MOQ
Mini Hair Comb Clips Acrylic Floral Print Bangs Barrette Colorful Side Clips Hair Accessories For Girls
Mini Hair Comb Clips Acrylic Floral Print Bangs Barrette Colorful Side Clips Hair Accessories For Girls
like
Find Similar
Detail shot of a green floral hair comb on a white plate with aesthetic lifestyle props - Green
Detail of cute orange translucent wide-tooth comb with daisy pattern on a ceramic plate - Orange
Close-up of light blue wave-shaped floral hair comb with red flower patterns on ceramic tray - Blue
Pink acrylic flower hair comb hair clip detail on a decorative tray with aesthetic background - Pink
Mini Hair Comb Clips Acrylic Floral Print Bangs Barrette Colorful Side Clips Hair Accessories For Girls
$0.23
No MOQ
 · 
20 views
Elegant Korean Style Bow Flower Hair Clip With Alloy Rhinestone Synthetic Cat Eye Stone And Faux Artificial Pearl For Women
Elegant Korean Style Bow Flower Hair Clip With Alloy Rhinestone Synthetic Cat Eye Stone And Faux Artificial Pearl For Women
like
Find Similar
Detail of golden bow hair clip with opal stones and sparkling crystal rhinestones - Style 6 Small Bow Tie
Detailed close-up of a gold floral hair clip with opal stones and sparkling crystals - Style 7 Small Butterfly
Detailed macro of crystal flower hair clip with opal heart petals and white pearls - Style 8 Small Four Flowers
Macro detail of a golden flower hair clip with white petals and sparkling rhinestones - Style 1 Large Two Flowers
+5
Elegant Korean Style Bow Flower Hair Clip With Alloy Rhinestone Synthetic Cat Eye Stone And Faux Artificial Pearl For Women
-5%
$1.23-1.37
No MOQ
 · 
10 sold recently
Large Satin Bow Hair Clip French Vintage Elegant Pearlescent Barrette Ribbon Streamers Hairpin For Women
Large Satin Bow Hair Clip French Vintage Elegant Pearlescent Barrette Ribbon Streamers Hairpin For Women
like
Find Similar
Close-up of elegant black satin bow hair clip with long ribbons on a white surface - Black Long Ribbon Bow Clip
Set of two red pearlescent satin bow hair clips on a handmade textured card - Wine Red Bow Hair Clips Pair for Kids
Detailed view of iridescent mermaid satin bow hair clip with luxury metallic sheen - Plum Purple Pearl Luster Bow Spring Clip
Macro detail of red satin mermaid pearl bow hair clip on a clean white background - Red Pearl Luster Bow Spring Clip
+22
Large Satin Bow Hair Clip French Vintage Elegant Pearlescent Barrette Ribbon Streamers Hairpin For Women
-5%
$0.33-0.77
No MOQ
 · 
27 sold recently
Rhinestone Moon And Star Hair Clips Alloy Crystal Retro Vintage Wedding Party Fashion Accessory For Women Girls
Rhinestone Moon And Star Hair Clips Alloy Crystal Retro Vintage Wedding Party Fashion Accessory For Women Girls
like
Find Similar
Golden 3-piece set hair clips with moon and star shapes featuring sparkling rhinestones - Bright Gold Set
Detailed view of silver star and moon hair clip set with sparkling rhinestones - Bright Silver Set
Rose gold hair clip set with star and moon designs featuring sparkling rhinestones - Rose Gold Set
Retro gold crescent moon and star hair clip set with sparkling crystals for women - Vintage Gold Set
+16
Rhinestone Moon And Star Hair Clips Alloy Crystal Retro Vintage Wedding Party Fashion Accessory For Women Girls
$0.29-1.61
No MOQ
 · 
41 sold recently
French Vintage Acetate Camellia Flower Hair Claw Clip Elegant Medium Floral Shark Clip Hair Accessories For Women
French Vintage Acetate Camellia Flower Hair Claw Clip Elegant Medium Floral Shark Clip Hair Accessories For Women
like
Find Similar
Macro view of French vintage camellia hair claw with marble texture on ceramic plate - Pink Yellow Pattern (27168A)
Macro detail of camellia hair claw clip with cream marble texture and pearl luster - Mixed White Pattern (27168B)
Close-up of tortoise shell flower hair claw clip with rose detail on a ceramic plate - Mocha Blue Pattern (27168C)
French Vintage Acetate Camellia Flower Hair Claw Clip Elegant Medium Floral Shark Clip Hair Accessories For Women
$3.11
No MOQ
 · 
1 reviews
Free Shipping
Go to

More in accessories

Explore more in clips

clawsharkartificialshapehandmadedesigncolorswirepearl hairshark clips
stylealloyhairpinheartsolidlongtasselbangspartyplastic hair claw

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access