Everful

Wholesale clips

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Clips

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in clips

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Mini Hair Claws For Women Girls Alloy Rhinestone Crystal Butterfly Flower Heart Small Hair Clips Hair Accessory
Mini Hair Claws For Women Girls Alloy Rhinestone Crystal Butterfly Flower Heart Small Hair Clips Hair Accessory
like
Find Similar
Delicate gold butterfly hair claw clip with pink crystals and small white diamonds - Pink Small Claw
Cute golden bear hair claw with large pink crystal and white zircon accents - Purple Pink Crystal Bear
Handmade bow hair clip featuring sparkling clear crystals and gold plating finish - Crystal Bowknot
Golden five-petal flower hair claw with clear marquise crystals and blue center stone - Crystal Flower
+10
Mini Hair Claws For Women Girls Alloy Rhinestone Crystal Butterfly Flower Heart Small Hair Clips Hair Accessory
$0.86-1.30
Mix MOQ : 2
 · 
18 sold recently
Free Shipping
Rhinestone Hair Clip Minimalist Alloy Bobby Pin Sparkly Crystal Side Barrette For Women Girls Elegant Hair Styling
Rhinestone Hair Clip Minimalist Alloy Bobby Pin Sparkly Crystal Side Barrette For Women Girls Elegant Hair Styling
like
Find Similar
Minimalist gold hair clip set with rectangle blue and purple rhinestones on grey background - Gold Blue Purple
Minimalist gold hair clip with alternating round and rectangular green rhinestones - Gold Green
Elegant gold metal hair clip featuring pink oval and amber round rhinestones in a row - Gold Grey Pink
Minimalist silver hair clip with alternating blue and purple rectangular rhinestones - Silver Blue Purple
+2
Rhinestone Hair Clip Minimalist Alloy Bobby Pin Sparkly Crystal Side Barrette For Women Girls Elegant Hair Styling
$0.66
Mix MOQ : 2
Phalaenopsis Orchid Flower Hair Clip Fabric Faux Artificial Pearl Shark Claw Handmade Sweet Hair Accessories For Women Elegant
Phalaenopsis Orchid Flower Hair Clip Fabric Faux Artificial Pearl Shark Claw Handmade Sweet Hair Accessories For Women Elegant
like
Find Similar
Pink orchid flower hair claw clip with dark spots and pearl center for women hairstyle - No.4 Duckbill Clip-Pink-Large Orchid Flower
Elegant black lace orchid hair claw clip with pearl and rhinestone floral details - No.8 Claw Clip-Black Bowknot
Pink mesh bow hair claw clip with pearls and rhinestones on a black acrylic base - No.9 Claw Clip-Pink Bowknot
Green and blue checkered scrunchie with white lace trim detail held in hand - No.12 Scrunchie-Blue Checkered-Green Edge
+23
Phalaenopsis Orchid Flower Hair Clip Fabric Faux Artificial Pearl Shark Claw Handmade Sweet Hair Accessories For Women Elegant
$0.39-4.29
No MOQ
 · 
11 views
Free Shipping
Cowboy Hat And Boot Shaped Acetate Hair Claw Clip With Rhinestone Star Decor Western Style Hair Accessory
Cowboy Hat And Boot Shaped Acetate Hair Claw Clip With Rhinestone Star Decor Western Style Hair Accessory
like
Find Similar
Brown cowboy hat hair claw clip with crystal accents and white Cowboy lettering - Cowboy Hat / White
Cowboy Hat And Boot Shaped Acetate Hair Claw Clip With Rhinestone Star Decor Western Style Hair Accessory
$3.98
No MOQ
 · 
20 sold recently
Free Shipping
Retro PU Leather Hair Clips Geometric Heart Star Cloud Shape Colorful Polka Dots Hairpins For Women Girls
Retro PU Leather Hair Clips Geometric Heart Star Cloud Shape Colorful Polka Dots Hairpins For Women Girls
like
Find Similar
Chic dark green PU leather BB hair clip with textured fabric finish and black metal base - Rectangle / Green
Minimalist black rectangle leather hair clip with hollow-out design on a white card - Rectangle / Black
Lavender purple BB hair clip with quilted faux leather texture and black metal base - Oval / Oval Purple
Light green quilted faux leather BB hair clip with elegant diamond stitching detail - Oval / Oval Green
+40
Retro PU Leather Hair Clips Geometric Heart Star Cloud Shape Colorful Polka Dots Hairpins For Women Girls
$0.13-0.22
Mix MOQ : 2
 · 
39 sold recently
Mist Blue Red Polka Dot Hair Claw French Elegant Chic Plastic Resin Shark Clip Sweet Hair Accessories For Women Styling
Mist Blue Red Polka Dot Hair Claw French Elegant Chic Plastic Resin Shark Clip Sweet Hair Accessories For Women Styling
like
Find Similar
Detail of blue hair claw clip with red polka dots on shell plate showing the metal spring - Mist Blue Red Dot (Large Cross)
Close-up of matte blue claw clip with red dots on a white shell decorative tray - Mist Blue Red Dot (Small Cross)
Detailed close-up of a blue hollow rectangle hair claw with delicate red dot accents - Mist Blue Red Dot (Large Square)
Detail of rectangular blue hair claw with red polka dots in a white shell dish - Mist Blue Red Dot (Small Square)
+2
Mist Blue Red Polka Dot Hair Claw French Elegant Chic Plastic Resin Shark Clip Sweet Hair Accessories For Women Styling
$0.86-1.30
No MOQ
Minimalist Alloy Matte Geometric Hair Clip Women Simple Frosted Duckbill Clip Gold Silver Solid Hollow Hair Accessory
Minimalist Alloy Matte Geometric Hair Clip Women Simple Frosted Duckbill Clip Gold Silver Solid Hollow Hair Accessory
like
Find Similar
Detail shot of the matte gold minimalist long metal hair clip on a clean white surface - Simple Solid Style / Gold
Detail view of the sleek matte silver alloy hair clip with a spring-loaded metal fastener - Simple Solid Style / Silver
Detail shot of a matte gold alloy hair clip with a minimalist hollow oval cutout design - Hollow Oval Style / Gold
Detail of matte silver alloy hair clip with smooth finish and minimalist duckbill design - Hollow Oval Style / Silver
Minimalist Alloy Matte Geometric Hair Clip Women Simple Frosted Duckbill Clip Gold Silver Solid Hollow Hair Accessory
$0.82
No MOQ
 · 
21 sold recently
Free Shipping
Korean Fashion Matte Large Acetate Hair Claw Clip For Women Hollow Geometric Shark Clip Elegant Daily Hair Accessories
Korean Fashion Matte Large Acetate Hair Claw Clip For Women Hollow Geometric Shark Clip Elegant Daily Hair Accessories
like
Find Similar
Matte black oversized hair claw clip with a hollow minimalist twisted design for women - Cross Black 11cm
Minimalist creamy white large hair claw clip in twisted design for elegant styling - Cross White 11cm
Deep brown matte hair claw clip with cross twist design on a minimalist ceramic plate - Wave Coffee 13CM
Elegant milky white hollowed hair claw clip with woven design on wooden background - Twist White 12cm
+51
Korean Fashion Matte Large Acetate Hair Claw Clip For Women Hollow Geometric Shark Clip Elegant Daily Hair Accessories
-6%
$0.42-1.10
No MOQ
Women Cute Acetate Fruit Vegetable Hair Claw Clips Sweet Shark Clips Fruit Shape Hairpins Fashion Hair Accessories Jewelry
Women Cute Acetate Fruit Vegetable Hair Claw Clips Sweet Shark Clips Fruit Shape Hairpins Fashion Hair Accessories Jewelry
like
Find Similar
Creative red chili pepper hair claw clip made of textured acetate for styling - Red Chili Hair Claw
Cute yellow banana shaped acetate hair claw clip with amber texture for women - Banana Claw Clip
Cute eggplant shaped acetate hair claw clip with purple marble pattern and green stem - Eggplant Hair Claw
Cute pear-shaped acetate hair claw clip with yellow marble texture and leaf detail - Pear Hair Claw
+21
Women Cute Acetate Fruit Vegetable Hair Claw Clips Sweet Shark Clips Fruit Shape Hairpins Fashion Hair Accessories Jewelry
$0.58-2.31
No MOQ
Free Shipping
Gummy Bear Hair Clips Cute Colorful Resin Candy Color Hairpin Cartoon Duckbill Clips Hair Accessories For Women Girls
Gummy Bear Hair Clips Cute Colorful Resin Candy Color Hairpin Cartoon Duckbill Clips Hair Accessories For Women Girls
like
Find Similar
Detail of five translucent yellow resin bears on a silver metal alligator hair clip - Yellow
Translucent purple gummy bear hair clip with five bears on a silver metal duckbill clip - Purple
Detailed close-up of five translucent yellow-green jelly bear hair clips on a metal base - Green
Detailed macro shot of five hot pink resin jelly bears on a silver metal hair clip - Plum Pink
+6
Gummy Bear Hair Clips Cute Colorful Resin Candy Color Hairpin Cartoon Duckbill Clips Hair Accessories For Women Girls
$0.66
No MOQ
 · 
16 views
Rhinestone Faux Artificial Pearl Hair Clips Alloy Snowflake Mermaid Tail Bow Barrette Elegant Sparkling Fashion Accessories For Women
Rhinestone Faux Artificial Pearl Hair Clips Alloy Snowflake Mermaid Tail Bow Barrette Elegant Sparkling Fashion Accessories For Women
like
Find Similar
Close-up of a silver mermaid tail hair clip with sparkling rhinestones on a card - Silver Mermaid Tail
Sparkling gold fishtail hair clip with inlaid rhinestones on a white card display - Gold Fishtail
Close-up of golden fishtail hair clip with pavé rhinestones and gradient white pearls - White Rhinestone Mermaid Tail
Detail of a gold snake-shaped hair clip with diamond accents and textured metal surface - Gold Snake
+10
Rhinestone Faux Artificial Pearl Hair Clips Alloy Snowflake Mermaid Tail Bow Barrette Elegant Sparkling Fashion Accessories For Women
$0.30-0.65
No MOQ
 · 
57 sold recently
Alloy Metal Hair Claw Clip Large Shark Clip Geometric Twist Elegant Strong Hold Hair Styling Accessories For Women
Alloy Metal Hair Claw Clip Large Shark Clip Geometric Twist Elegant Strong Hold Hair Styling Accessories For Women
like
Find Similar
Detailed shot of a hollow rectangular gold metal hair claw clip held in hand - Medium Gold Rectangle
Detailed view of a silver twisted metal hair claw clip on soft white fabric background - Silver-Cross
Close-up of large gold metal hair claw clip resting on elegant white silk fabric - KC Gold-Cross
Detailed view of silver alloy hair claw clip with hammer texture on soft fabric - Matte Silver-Hammered Cross
+51
Alloy Metal Hair Claw Clip Large Shark Clip Geometric Twist Elegant Strong Hold Hair Styling Accessories For Women
-6%
$0.26-1.04
No MOQ
Kids Crochet Knitted Flower Hair Clips Handmade Fruit Sunflower Smiley Face Hairpins For Girls Sweet Accessories
Kids Crochet Knitted Flower Hair Clips Handmade Fruit Sunflower Smiley Face Hairpins For Girls Sweet Accessories
like
Find Similar
Handmade knitted 6cm green sunflower hair clip with pineapple embroidery detail - Dark Green Pineapple
Pink knitted flower hair clip with red cherry embroidery pattern for girls - Pink Flower With Cherry
Handmade knitted blue sunflower hair clip featuring a cute orange carrot embroidery - Grey Blue Carrot Flower
Handmade crochet flower hair clip in navy blue with a carrot-embroidered center - Blue Flower With Carrot
+7
Kids Crochet Knitted Flower Hair Clips Handmade Fruit Sunflower Smiley Face Hairpins For Girls Sweet Accessories
-4%
$0.23
Mix MOQ : 2
 · 
76 sold recently
Elegant Lace Flower Bow Hair Clip For Women Handmade Satin Rose Hair Accessories Vintage Sweet Back Head Duckbill Clip
Elegant Lace Flower Bow Hair Clip For Women Handmade Satin Rose Hair Accessories Vintage Sweet Back Head Duckbill Clip
like
Find Similar
Elegant black lace bow hair clip with a satin 3D rose flower on a soft pink background - Black
Detailed macro shot of vintage floral lace and wine red satin ribbon hair clip - Burgundy
Close-up of cream lace bow hair clip with central satin handmade rose flower - Beige
Detailed view of white lace bow hairpin with a purple satin rose on pink background - Purple
Elegant Lace Flower Bow Hair Clip For Women Handmade Satin Rose Hair Accessories Vintage Sweet Back Head Duckbill Clip
$0.84
Mix MOQ : 2
Iridescent Hair Claw Clip Large Laser Plated PC Plastic Jelly Mermaid Style Shark Hairpin Elegant Headwear For Women
Iridescent Hair Claw Clip Large Laser Plated PC Plastic Jelly Mermaid Style Shark Hairpin Elegant Headwear For Women
like
Find Similar
Iridescent purple mermaid hair claw clip in durable PC material with metallic finish - Jelly Gray-TCB-969
Iridescent mermaid pink hair claw clip in Aurora PC material with five-circle design - Dazzling Gradient Set-TCB-888
Iridescent purple jelly hair claw clip made of PC material in 80mm size - Jelly Green-TCB-957
Iridescent purple mermaid hair claw clip made of durable PC material, size 110x50mm - Iridescent Purple Set-TCB-984
+10
Iridescent Hair Claw Clip Large Laser Plated PC Plastic Jelly Mermaid Style Shark Hairpin Elegant Headwear For Women
$1.10-1.21
Mix MOQ : 2
 · 
52 sold recently
Snap Hair Clips Painted Metal Cartoon Fruit Animal Patterns Colorful Hairpins For Kids Girls
Snap Hair Clips Painted Metal Cartoon Fruit Animal Patterns Colorful Hairpins For Kids Girls
like
Find Similar
Set of 6 cute hair clips featuring unicorn, rainbow and candy designs on white card - D001 Rainbow Candy
Set of 6 cute animal-shaped children's hair clips featuring leopard, panda and lion - D003 Leopard Panda Tiger
6-piece set of cute cartoon animal hair clips with colorful fruit and bunny patterns - D006 Pink Rabbit Yellow Dog
6-piece set of cute cartoon ocean themed mermaid and jellyfish BB hair clips for kids - D007 Green Mermaid
+9
Snap Hair Clips Painted Metal Cartoon Fruit Animal Patterns Colorful Hairpins For Kids Girls
$0.75
Mix MOQ : 2
 · 
66 sold recently
Large Flat Oval Hair Clip Minimalist Lacquered Plastic Duckbill Clip Matte Glossy Tortoiseshell Hair Accessories For Women
Large Flat Oval Hair Clip Minimalist Lacquered Plastic Duckbill Clip Matte Glossy Tortoiseshell Hair Accessories For Women
like
Find Similar
Flat oval hair claw clip in matte light blue finish with strong grip design - Oval Clip (Bulk) / Matte Light Grey
Flat oval matte blue hair claw clip with strong grip and minimalist hollow design - Oval Clip (Bulk) / Matte Grey Blue
Navy blue matte oval hair claw clip with strong grip and hollow design for hair styling - Oval Clip (Bulk) / Matte Navy Blue
Minimalist white oval soap dish with a three-slot drainage design for dry storage - Oval Clip (Bulk) / Matte Cream White
+136
Large Flat Oval Hair Clip Minimalist Lacquered Plastic Duckbill Clip Matte Glossy Tortoiseshell Hair Accessories For Women
$0.36-0.49
No MOQ
Plush Bunny Hair Clips 3D Faux Fur Cartoon Animal Barrettes For Girls Kids Sweet Autumn Winter Hair Accessories
Plush Bunny Hair Clips 3D Faux Fur Cartoon Animal Barrettes For Girls Kids Sweet Autumn Winter Hair Accessories
like
Find Similar
Cute plush yellow rabbit hair clip for children with pink metal alligator base - Yellow
Cute red plush rabbit hair clip for girls with soft fur texture and metal duckbill clip - Red
Cute sky blue plush rabbit hair clip with soft pom poms for girls and children - Blue
Cute dark green plush rabbit hair clip with silver metal alligator grip for kids - Green
+1
Plush Bunny Hair Clips 3D Faux Fur Cartoon Animal Barrettes For Girls Kids Sweet Autumn Winter Hair Accessories
$0.20
No MOQ
 · 
148 sold recently
Acetate No-Bend Hair Clips Seamless Bangs Clip For Women Makeup Hairstyling Minimalist Korean Style Alloy Resin Accessories
Acetate No-Bend Hair Clips Seamless Bangs Clip For Women Makeup Hairstyling Minimalist Korean Style Alloy Resin Accessories
like
Find Similar
Detailed close-up of a minimalist black acetate hair clip with a polished gold metal clasp - No-Crease Hair Clips / Black
Detail of red acetate hair clip with gold metal alligator grip on minimalist background - No-Crease Hair Clips / Red
Close-up of brown marble acetic acid hair clip with golden metal clip on magazine - No-Crease Hair Clips / Green & Coffee
Detail of amber tortoiseshell acetate hair clip with polished gold metal fastener - No-Crease Hair Clips / Milk Coffee
+5
Acetate No-Bend Hair Clips Seamless Bangs Clip For Women Makeup Hairstyling Minimalist Korean Style Alloy Resin Accessories
-5%
$0.49
No MOQ
 · 
12 sold recently
Tulip Flower Hair Claw Clips Acrylic Elegant Bowknot Geometric Contrast Color Stylish Shark Hairpin Accessories For Women
Tulip Flower Hair Claw Clips Acrylic Elegant Bowknot Geometric Contrast Color Stylish Shark Hairpin Accessories For Women
like
Find Similar
Vibrant 11cm bow hair claw clip in acrylic with bold multi-color block finish - Bowknot Style / 11cm / Pale Blue
Colorful 11cm abstract bow hair claw clip in acrylic with vibrant multi-color finish - Bowknot Style / 11cm / Green Pink
Elegant black glossy hair claw clip with a red and orange gradient decorative stripe - Crossed / 13cm / Beige Coffee
Elegant large tulip hair claw clip in black with red and blue accents for high-end styling - Crossed / 13cm / Blue Brown
+2
Tulip Flower Hair Claw Clips Acrylic Elegant Bowknot Geometric Contrast Color Stylish Shark Hairpin Accessories For Women
$0.72
No MOQ
 · 
12 sold recently
Cute Simulation Biscuit Hair Clips Resin Cookie Hairpins With Gingham Bow Knot Heart Star Shape For Women Girls Sweet
Cute Simulation Biscuit Hair Clips Resin Cookie Hairpins With Gingham Bow Knot Heart Star Shape For Women Girls Sweet
like
Find Similar
Detail of star-shaped cookie hair clips with blue gingham bow on cream tray - Bowknot Biscuit-Star
Detail of creative star-shaped cookie hair clip on a minimalist white ceramic tray - BB Clip Biscuit-Star
Detailed view of heart-shaped biscuit hair clip with a smooth brown metal snap pin - BB Clip Biscuit-Heart
Detailed view of a cute biscuit hair clip with realistic cookie texture on a metal BB clip - BB Clip Biscuit-Round
+8
Cute Simulation Biscuit Hair Clips Resin Cookie Hairpins With Gingham Bow Knot Heart Star Shape For Women Girls Sweet
$0.23-0.43
No MOQ
 · 
21 views
Large Satin Bow Hair Clip Oversized Solid Color Long Ribbon Streamer Handmade Princess Headpiece Girls Kids Daily Wear
Large Satin Bow Hair Clip Oversized Solid Color Long Ribbon Streamer Handmade Princess Headpiece Girls Kids Daily Wear
like
Find Similar
Handmade black satin bow hair clip with flowing ribbon for elegant daily hair styling - Black
Handmade light blue satin ribbon bow hair clip with a smooth and glossy silk finish - Light Blue
Handmade dark green satin hair bow clip with long ribbons in a minimalist style - Dark Green
Elegant solid green matte fabric satin double-layered bow hair clip for daily styling - Green
+14
Large Satin Bow Hair Clip Oversized Solid Color Long Ribbon Streamer Handmade Princess Headpiece Girls Kids Daily Wear
$0.69
No MOQ
 · 
18 sold recently
Vintage Round Ball Acetate Hair Clip For Women Korean Style Handmade Resin Duckbill Clip Geometric Hair Accessory For Daily Use
Vintage Round Ball Acetate Hair Clip For Women Korean Style Handmade Resin Duckbill Clip Geometric Hair Accessory For Daily Use
like
Find Similar
Macro view of handmade beige acrylic hair clip with France Handmade engraving on fabric - Beige
Detail of handmade brown acrylic hair clip showing the France Handmade text on linen - Light Coffee
Detail showing high-quality yellow acrylic hair clip with France Handmade lettering text - Yellow
Close-up of pink acrylic hair clip with round beads and golden Handmade text detail - Pink
+5
Vintage Round Ball Acetate Hair Clip For Women Korean Style Handmade Resin Duckbill Clip Geometric Hair Accessory For Daily Use
$0.43
No MOQ
 · 
12 sold recently
Flower Hair Claw Clip Matte Plastic Daisy Shaped Large Non Slip Jaw Clip Korean Style Hair Accessory For Women
Flower Hair Claw Clip Matte Plastic Daisy Shaped Large Non Slip Jaw Clip Korean Style Hair Accessory For Women
like
Find Similar
Matte yellow daisy flower hair claw clip in Korean INS style on white background - Yellow
Matte light purple flower hair claw clip with a daisy design and frosted finish - Purple
Matte green daisy flower hair claw clip for women on a white background - Green
Matte mint green flower claw clip hair accessory with 5-petal daisy design - Peacock Blue
+14
Flower Hair Claw Clip Matte Plastic Daisy Shaped Large Non Slip Jaw Clip Korean Style Hair Accessory For Women
$0.43
Mix MOQ : 2
 · 
76 sold recently
Natural Crystal Crushed Stone Hair Clip Metal Bobby Pin Handmade Gravel Hairpin Boho Vintage Hair Accessory For Women
Natural Crystal Crushed Stone Hair Clip Metal Bobby Pin Handmade Gravel Hairpin Boho Vintage Hair Accessory For Women
like
Find Similar
Detailed view of natural crystal stones on a silver metal hairpin against a dark wood background - Citrine with Silver Clip
Close-up of a silver metal hair clip adorned with natural grey crystal stones and moonstone - Grey Labradorite with Silver Clip
Macro shot of natural aquamarine crystal chips on a silver metal hair clip with a dark background - Aquamarine with Silver Clip
Macro view of natural strawberry quartz stones on a silver metal hair clip detail - Strawberry Quartz with Silver Clip
+37
Natural Crystal Crushed Stone Hair Clip Metal Bobby Pin Handmade Gravel Hairpin Boho Vintage Hair Accessory For Women
-4%
$1.23
No MOQ
 · 
20 sold recently
Vintage Alloy Celtic Knot Hair Clip Retro Metal Witch Knot Spring Hairpin Antique Hair Jewelry For Women Banquet Party Accessories
Vintage Alloy Celtic Knot Hair Clip Retro Metal Witch Knot Spring Hairpin Antique Hair Jewelry For Women Banquet Party Accessories
like
Find Similar
Vintage silver Celtic knot alloy hair clip with intricate engraved geometric patterns - Antique Silver
Macro view of vintage Celtic knot hair clip detailing measurements 86mm and weight 21g - Antique Gold
Vintage Alloy Celtic Knot Hair Clip Retro Metal Witch Knot Spring Hairpin Antique Hair Jewelry For Women Banquet Party Accessories
-4%
$1.46
No MOQ
 · 
15 sold recently
Elegant Large Satin Bow Hair Clip With Long Streamers Korean Style Spring Barrette Fashion Hair Accessories For Women
Elegant Large Satin Bow Hair Clip With Long Streamers Korean Style Spring Barrette Fashion Hair Accessories For Women
like
Find Similar
Oversized black satin bow hair clip with long ribbons worn on the back of long hair - Black
Large red satin bow hair clip with long ribbons on wavy brown hair - Burgundy
Elegant emerald green satin bow hair clip with long ribbons on light brown hair - Dark Green
Pink satin oversized bow hair clip with long ribbons worn on back of head - Pink
+4
Elegant Large Satin Bow Hair Clip With Long Streamers Korean Style Spring Barrette Fashion Hair Accessories For Women
$0.46
No MOQ
 · 
11 sold recently
Matte Hair Claw Clips Small Acrylic Frosted Hairpin High Ponytail Holder Elegant Daily Headwear For Women
Matte Hair Claw Clips Small Acrylic Frosted Hairpin High Ponytail Holder Elegant Daily Headwear For Women
like
Find Similar
Mini white pumpkin hair claw clip in matte resin held by hand for scale display - 3.5cm / White
Mini pumpkin hair claw clip in matte black finish for elegant ponytail styling - 3.5cm / Black
Brown matte pumpkin claw clip for secure high ponytail and bun hairstyles - 3.5cm / Brown
Matte black sphere pumpkin hair claw clip for high ponytail styling and buns - 5cm / Black
+4
Matte Hair Claw Clips Small Acrylic Frosted Hairpin High Ponytail Holder Elegant Daily Headwear For Women
$0.07-0.10
No MOQ
 · 
465 sold recently
Grosgrain Ribbon Bow Hair Clips Handmade Solid Color Barrettes Sweet Accessories For Kids Toddler Infants
Grosgrain Ribbon Bow Hair Clips Handmade Solid Color Barrettes Sweet Accessories For Kids Toddler Infants
like
Find Similar
Set of 10 multicolor ribbed grosgrain ribbon bow hair clips for baby girls and kids - Style 33
Set of colorful fabric bow hair clips for girls in pink, yellow, and brown tones - Style 2
Set of colorful grosgrain ribbon swallowtail bow hair clips for girls on white card - Style 30
Set of 10 colorful grosgrain ribbon bow hair clips for girls in 5 vibrant color pairs - Style 15
+30
Grosgrain Ribbon Bow Hair Clips Handmade Solid Color Barrettes Sweet Accessories For Kids Toddler Infants
$0.68
Mix MOQ : 2
 · 
10 views
Acetate Animal Hair Claw Clips Cute Hedgehog Fox Snail Duck Cat Shaped Hair Clamps For Women Girls Accessories
Acetate Animal Hair Claw Clips Cute Hedgehog Fox Snail Duck Cat Shaped Hair Clamps For Women Girls Accessories
like
Find Similar
Hedgehog acetate hair claw clip with tortoise shell pattern and apple detail - Hedgehog with Apple
Creative acetate hair claw clip featuring fox and autumn leaf design in warm tones - Sleeping Fox
Handheld yellow duck hair claw clip with pink floral pattern on a sunny wooden surface - Flower Little Yellow Duck
Detail of snail-shaped acetate hair claw clip with pink marble texture and orange shell - Pink Snail
Acetate Animal Hair Claw Clips Cute Hedgehog Fox Snail Duck Cat Shaped Hair Clamps For Women Girls Accessories
$3.69
No MOQ
 · 
52 views
Free Shipping
Matte Heart Shaped Hair Claw Clip Hollow Plastic Shark Grip Sweet Hair Styling Accessories For Women Girls
Matte Heart Shaped Hair Claw Clip Hollow Plastic Shark Grip Sweet Hair Styling Accessories For Women Girls
like
Find Similar
Matte black heart-shaped hair claw clip with cutout design on a grey textured surface - Approx 6.5cm / Black Heart
Matte mocha heart-shaped hair claw clip TCB-1044 with textured frosted finish - Approx 6.5cm / Coffee Heart
Brown heart-shaped matte shark clip with hollow design and fine comb teeth for women - Approx 6.5cm / Khaki Heart
Matte beige heart-shaped hair claw clip for women in durable plastic finish - Approx 6.5cm / Cream Heart
+4
Matte Heart Shaped Hair Claw Clip Hollow Plastic Shark Grip Sweet Hair Styling Accessories For Women Girls
$0.29
Mix MOQ : 2
 · 
42 sold recently
Butterfly Hair Clips For Girls Chiffon Thin Veil Rhinestone Gradient Color Handmade Princess Hair Accessories
Butterfly Hair Clips For Girls Chiffon Thin Veil Rhinestone Gradient Color Handmade Princess Hair Accessories
like
Find Similar
Detail of a purple butterfly hair clip with rhinestones on a pink duckbill clip - Purple
Detail of pink fabric butterfly hair clip with rhinestones on a white display card - Rose Red
Detailed close-up of double-layered orange tulle butterfly hair clip with rhinestones - Orange
Close-up of handmade tulle butterfly hair clip with blue gradient and rhinestones - Blue and Purple
+7
Butterfly Hair Clips For Girls Chiffon Thin Veil Rhinestone Gradient Color Handmade Princess Hair Accessories
$0.40
No MOQ
 · 
17 views
Free Shipping
Matte Metal Hair Clips Candy Color X Shape Geometric Duckbill Barrettes Minimalist Hair Accessories For Women
Matte Metal Hair Clips Candy Color X Shape Geometric Duckbill Barrettes Minimalist Hair Accessories For Women
like
Find Similar
Three-piece set of green gradient rectangle hair clips on display card - Green Square Set
Set of three purple candy color rectangular hair clips for women on display card - Purple Square Set
Three rectangular matte clips in beige, dusty pink, and brown on white card - Coffee Square Set
Set of 3 matte purple gradient crossover hair clips displayed on a card - Purple Gradient Cross Set
+19
Matte Metal Hair Clips Candy Color X Shape Geometric Duckbill Barrettes Minimalist Hair Accessories For Women
-3%
$0.26
Mix MOQ : 2
Mini Acrylic Hair Claw Clip Cute Back To School Stationery Series Apple Palette Pencil Book Accessory For Women Girls
Mini Acrylic Hair Claw Clip Cute Back To School Stationery Series Apple Palette Pencil Book Accessory For Women Girls
like
Find Similar
Mini red apple hair claw clip with sparkly glitter filling and green leaf detail - Glitter Red Apple Style
Mini painter palette hair clip with colorful rhinestones on a white artistic resin base - Rhinestone Palette Style
Creative miniature yellow crayon box ring with colorful tips on a gold metal band - Crayon Box Style
Mini alphabet block hair claw clip featuring colorful ABC design for girls and kids - ABC Letter Blocks Style
+8
NewMini Acrylic Hair Claw Clip Cute Back To School Stationery Series Apple Palette Pencil Book Accessory For Women Girls
$0.37-0.66
Mix MOQ : 2
 · 
13 views
Free Shipping
Vintage French Style Acetate Heart Hair Clip Elegant Handmade Spring Side Clip Barrette For Women Daily Fashion Accessories
Vintage French Style Acetate Heart Hair Clip Elegant Handmade Spring Side Clip Barrette For Women Daily Fashion Accessories
like
Find Similar
French retro acetate hair clip with olive green and marble blue resin hearts - Green 6.5CM
French vintage heart hair clip in black and tortoiseshell finish on display card - Black 6.5CM
French vintage acetate heart hair clip featuring pink marble textures on a white card - Pink 6.5CM
French vintage heart hair clip in shell pink and tortoiseshell patterned acetate - Multi-color 6.5CM
+3
Vintage French Style Acetate Heart Hair Clip Elegant Handmade Spring Side Clip Barrette For Women Daily Fashion Accessories
-5%
$1.51
No MOQ
Soccer Paper Clips Football Decorative Bookmarks PVC Metal Creative Sport Stationery For Students Office Supplies
Soccer Paper Clips Football Decorative Bookmarks PVC Metal Creative Sport Stationery For Students Office Supplies
like
Find Similar
Creative soccer paperclip with orange flame PVC decor on yellow metal bookmark - Soccer Flame Style (534-11)
Creative soccer paperclip with yellow football design and motivational sports quote - Soccer Slogan Style (534-10)
Soccer goalkeeper glove shaped paper clip bookmark in vibrant orange and yellow finish - Goalkeeper Gloves Style (534-06)
Creative soccer player paper clip with Goal sign and yellow metal wire bookmark - Soccer Man Goal Style (534-05)
+24
Soccer Paper Clips Football Decorative Bookmarks PVC Metal Creative Sport Stationery For Students Office Supplies
$0.12
Mix MOQ : 100
 · 
13 views
Baby Girl Crown Hair Clip Satin Tulle Tiara Headband For Birthday Party Princess Hair Accessories Toddler Newborn
Baby Girl Crown Hair Clip Satin Tulle Tiara Headband For Birthday Party Princess Hair Accessories Toddler Newborn
like
Find Similar
Princess hairband for girls featuring a burgundy ribbon crown with golden sequins - Burgundy Headband With Box
Sparkling red satin crown hair clip with gold bead accents and glittery details for girls - Burgundy Hair Clip With Box
Beige crown headband for baby girls with gold tips and pleated tulle on white elastic band - Champagne Gold Headband With Box
Golden crown hair clip for girls featuring a pleated fabric base and sparkling sequins - Champagne Gold Hair Clip With Box
+4
Baby Girl Crown Hair Clip Satin Tulle Tiara Headband For Birthday Party Princess Hair Accessories Toddler Newborn
-4%
$1.59
No MOQ
 · 
18 views
Free Shipping
Realistic Simulation Food Hair Clips Fried Chicken Fries Resin Plastic Duckbill Clips Funny Hair Accessories For Women
Realistic Simulation Food Hair Clips Fried Chicken Fries Resin Plastic Duckbill Clips Funny Hair Accessories For Women
like
Find Similar
Funny 3D fried chicken nugget hair clip made of resin with a realistic crispy texture - Fried Whole Chicken
Creative fried chicken drumstick hair clip with realistic golden texture and silver metal clip - Fried Chicken Leg
Realistic fried chicken drumstick hair clip made of resin on vintage background - Roasted Chicken Drumstick
Funny realistic fried chicken wing hair clip accessory for creative food play styling - Chicken Nugget
+5
Realistic Simulation Food Hair Clips Fried Chicken Fries Resin Plastic Duckbill Clips Funny Hair Accessories For Women
$0.17
No MOQ
 · 
24 views
Hair Claw Clips Women PVC Plastic Strong Grip Preppy Style Plaid Heart Polka Dot Bow Hair Styling Accessories
Hair Claw Clips Women PVC Plastic Strong Grip Preppy Style Plaid Heart Polka Dot Bow Hair Styling Accessories
like
Find Similar
Pink rectangular hair claw clip with red polka dot pattern in a sweet retro style - Pink Base Red Polka Dots
Plaid hair claw clip with red heart patterns and black bows on white resin surface - White Base Red Stripes Red Hearts
White hair claw clip with black polka dots and red bow pattern in a minimalist style - White Base Black Dots Red Bows
Red gingham hair claw clip with bow prints made of high-gloss synthetic resin - Red White Plaid Bow
Hair Claw Clips Women PVC Plastic Strong Grip Preppy Style Plaid Heart Polka Dot Bow Hair Styling Accessories
$1.04
Mix MOQ : 2
 · 
17 sold recently
Sparkling Crystal Flower Hair Clips Rhinestone Double Layer Braided Hair Styling Duckbill Clips Elegant Hair Accessories Women
Sparkling Crystal Flower Hair Clips Rhinestone Double Layer Braided Hair Styling Duckbill Clips Elegant Hair Accessories Women
like
Find Similar
Elegant black hair clip with three gold and red rhinestone flowers held in hand - Champagne
Handheld black duckbill hair clip with three colorful rhinestone flower small clips - Rainbow
Elegant black hair clip featuring three purple rhinestone flowers for side fringe styling - Purple
Elegant black hair clip with three sparkling champagne rhinestone flowers for women - Grey Blue
+3
Sparkling Crystal Flower Hair Clips Rhinestone Double Layer Braided Hair Styling Duckbill Clips Elegant Hair Accessories Women
$0.29
No MOQ
 · 
74 sold recently
Vintage Tree Of Life Hair Clip Alloy Celtic Knot Embossed Spring Clip Retro Ethnic Ancient Silver Gold Hair Accessories For Women
Vintage Tree Of Life Hair Clip Alloy Celtic Knot Embossed Spring Clip Retro Ethnic Ancient Silver Gold Hair Accessories For Women
like
Find Similar
Vintage silver tree of life hair clip with Celtic patterns weighing 21.14g - Antique Silver
Vintage bronze tree of life alloy hair clip with celtic knot patterns, 83.7x29mm size - Antique Gold
Vintage gold tree of life hair clip with celtic knot engraved metal alloy finish - Antique Gold 1
Vintage silver alloy hair clip featuring Tree of Life and Celtic knot motifs - Antique Silver 1
NewVintage Tree Of Life Hair Clip Alloy Celtic Knot Embossed Spring Clip Retro Ethnic Ancient Silver Gold Hair Accessories For Women
-4%
$1.46
No MOQ
 · 
15 sold recently
Elegant Acetate Butterfly Hair Claw Clip Marble Texture Large Hair Catch Barrette Fashion Styling Accessories For Women
Elegant Acetate Butterfly Hair Claw Clip Marble Texture Large Hair Catch Barrette Fashion Styling Accessories For Women
like
Find Similar
Detailed top view of a pink marble acetate butterfly hair claw with a gold metal spring - Pink
Elegant amber butterfly hair claw clip with acetate marble texture and gold spring - Brown
Elegant butterfly acetate hair claw clip with marble texture on beige linen background - Yellow
Elegant pink marble acetate butterfly hair claw clip with golden metal spring - Red
+2
Elegant Acetate Butterfly Hair Claw Clip Marble Texture Large Hair Catch Barrette Fashion Styling Accessories For Women
$1.15
No MOQ
 · 
12 sold recently
Free Shipping
Resin Paw Print Bow Knot Hair Clip Wave Geometric Hair Claw Ponytail Shark Clip Cute Daily Hair Accessories For Women
Resin Paw Print Bow Knot Hair Clip Wave Geometric Hair Claw Ponytail Shark Clip Cute Daily Hair Accessories For Women
like
Find Similar
Cute pink bow claw clip with fuchsia cat paw prints on a textured wooden background - Pink-Bow
Medium bow-shaped black hair claw clip with pink cat paw prints on a wooden surface - Black-Bow
Medium beige shark hair claw with orange cat paw prints and gold spring detail - Yellow Bow Style
Light purple claw clip with yellow cat paw print for half-up hair styling - Blue-Bow
+8
Resin Paw Print Bow Knot Hair Clip Wave Geometric Hair Claw Ponytail Shark Clip Cute Daily Hair Accessories For Women
$0.52
No MOQ
Acetate Flower Hair Claw Clip 3D Floral Marble Tortoiseshell Elegant French Shark Hair Accessories For Women
Acetate Flower Hair Claw Clip 3D Floral Marble Tortoiseshell Elegant French Shark Hair Accessories For Women
like
Find Similar
Elegant acetate flower hair claw clip with pink purple gradient finish for women - 8.8cm / Floral Purple
Elegant tortoiseshell flower hair claw clip in acetate for women stylish headwear - 8.8cm / Beige Tortoise Shell
Pink purple acetate rose flower hair claw clip with marble texture for women - 8.8cm / Floral Red
Elegant acetate flower hair claw clip with purple and blue marble pattern finish - 8.8cm / Metallic Purple
+38
Acetate Flower Hair Claw Clip 3D Floral Marble Tortoiseshell Elegant French Shark Hair Accessories For Women
-8%
$3.05-4.99
No MOQ
Free Shipping
Natural Stone Crystal Hair Clip Hand-Wrapped Wire Spring Clip Agate Amethyst Artificial Pearl Bohemian Party Headwear For Women
Natural Stone Crystal Hair Clip Hand-Wrapped Wire Spring Clip Agate Amethyst Artificial Pearl Bohemian Party Headwear For Women
like
Find Similar
Bohemian crystal spring hair clip with orange agate stones on rustic wood background - Red Agate Hair Clip
Bohemian crystal hair clip with pink stones and silver wire on a natural wood base - Strawberry Quartz Hair Clip
Detail of pink crystal hair clip with wire-wrapped stones on a rustic wood slice - Rose Quartz Hair Clip
Detailed view of handmade purple crystal hair clip with silver wire wrapping on wood - Lavender Amethyst Hair Clip
+4
Natural Stone Crystal Hair Clip Hand-Wrapped Wire Spring Clip Agate Amethyst Artificial Pearl Bohemian Party Headwear For Women
-4%
$4.11
No MOQ
 · 
115 sold recently
Free Shipping
Elegant Heart Hair Claw Clips Acrylic Glitter Sweet 3D Hearts Shark Clips Non Slip Styling Accessories For Women
Elegant Heart Hair Claw Clips Acrylic Glitter Sweet 3D Hearts Shark Clips Non Slip Styling Accessories For Women
like
Find Similar
Translucent grey heart hair claw clip with mint green glitter hearts in brown hair - #1 Blue - Five Hearts Claw Clip
Smoky grey acrylic hair claw clip with pearlescent pink hearts for women - 2# Light Pink - Five Hearts Claw Clip
Translucent taupe acrylic hair claw clip with white heart pearls and gold spring - #3 Off-white - Five Hearts Claw Clip
Elegant purple acrylic heart hair claw clip with pearlescent finish for women - #5 Purple - Five Hearts Claw Clip
+5
Elegant Heart Hair Claw Clips Acrylic Glitter Sweet 3D Hearts Shark Clips Non Slip Styling Accessories For Women
$0.56-0.78
No MOQ
 · 
16 views
Acetate Floral Hair Claw Clip Rose Tulip Peach Shape Elegant Hair Clamp Hair Accessory For Women
Acetate Floral Hair Claw Clip Rose Tulip Peach Shape Elegant Hair Clamp Hair Accessory For Women
like
Find Similar
Detail of a peach-shaped acetate hair claw clip in pink and cream with green leaves - Creamy White Pink Peach
French style tulip acetate hair claw clip with pink flowers and green leaves design - Pink Tulip Bunch with Pink Bow
French style red rose hair claw clip with green leaves and gold trimmed acetic acid petals - Single Rose
Elegant red rose hair claw clip with green leaves and gold edges for women's hairstyles - Red Rose with Three Leaves
+1
Acetate Floral Hair Claw Clip Rose Tulip Peach Shape Elegant Hair Clamp Hair Accessory For Women
$3.23
No MOQ
Free Shipping
Flower Hair Claw Clips Matte Plastic Resin Floral Hairpin Nonslip Strong Hold Styling Hair Accessory For Women Girls
Flower Hair Claw Clips Matte Plastic Resin Floral Hairpin Nonslip Strong Hold Styling Hair Accessory For Women Girls
like
Find Similar
Minimalist cream flower hair claw with pearl center and elegant gold braided metal trim - 5.8*5.8*4.5 / White
Elegant black flower hair claw clip with white pearl center on a white background - 5.8*5.8*4.5 / Black
Elegant transparent flower hair claw with pearl center and golden metallic twist detail - 5.8*5.8*4.5 / Clear
Floral hair claw clip in transparent resin with central pearl and gold trim detail - 5.8*5.8*4.5 / Champagne
+49
Flower Hair Claw Clips Matte Plastic Resin Floral Hairpin Nonslip Strong Hold Styling Hair Accessory For Women Girls
-9%
$0.20-0.46
No MOQ
 · 
11 views
Alloy Geometric Hair Clips With Faux Artificial Pearl And Rhinestone For Women Elegant Side Bobby Pins Styling Accessories
Alloy Geometric Hair Clips With Faux Artificial Pearl And Rhinestone For Women Elegant Side Bobby Pins Styling Accessories
like
Find Similar
Golden hair clip set with white pearls and gemstones on a white card display - A116-01# Blue Pearl 3-Piece Set
Detailed view of three elegant pearl and rhinestone hair clips on a white display card - A116-02# Red Pearl 3-Piece Set
Set of four gold metal hair clips with white pearls and crystals on card display - A116-03# Light Purple Pearl 3-Piece Set
Three-piece gold metal hair clip set with pearls and rhinestones shown on hand - A116-04# Light Pink Pearl 3-Piece Set
+1
Alloy Geometric Hair Clips With Faux Artificial Pearl And Rhinestone For Women Elegant Side Bobby Pins Styling Accessories
$0.63
No MOQ
 · 
20 sold recently
Handmade Artificial Phalaenopsis Orchid Flower Hair Clip With Artificial Pearl Fabric Floral Side Clip For Beach Vacation Women Hair Accessories
Handmade Artificial Phalaenopsis Orchid Flower Hair Clip With Artificial Pearl Fabric Floral Side Clip For Beach Vacation Women Hair Accessories
like
Find Similar
Elegant white orchid hair clip with yellow center and pearl detail on display card - White (PP230-2)
Blue phalaenopsis orchid hair clip with pearl detail on a white branded display card - Blue (PP230-12)
Realistic pink orchid hair clip with gradient petals and pearl on a display card - Pink Purple (PP230-14)
Pink phalaenopsis orchid hair clip with faux pearl on a white display card - Pink (PP230-15)
+4
Handmade Artificial Phalaenopsis Orchid Flower Hair Clip With Artificial Pearl Fabric Floral Side Clip For Beach Vacation Women Hair Accessories
-5%
$0.36
No MOQ
 · 
40 sold recently
Sweet Bowknot Hair Clips Ribbon Fabric Alligator Hairpins For Women Girls Side Fringe Accessory
Sweet Bowknot Hair Clips Ribbon Fabric Alligator Hairpins For Women Girls Side Fringe Accessory
like
Find Similar
Three navy blue polka dot ribbon hair clips on a premium beige display cushion - 1pc Dark Navy Blue
Three blue denim bow hair clips for women displayed in a beige jewelry tray - 1pc Deep Blue
Three blue fabric bow hair clips displayed on a beige velvet jewelry tray - 1pc Light Blue
Sweet light blue satin ribbon bow hair clips worn by model for elegant princess style - Blue (1 Pack)
+7
Sweet Bowknot Hair Clips Ribbon Fabric Alligator Hairpins For Women Girls Side Fringe Accessory
$0.11-0.23
No MOQ
 · 
167 sold recently
Retro Polka Dot Dog Shape Hair Clip Large Claw Clip For Women Contrast Color Shark Clip Hair Barrette Accessories
Retro Polka Dot Dog Shape Hair Clip Large Claw Clip For Women Contrast Color Shark Clip Hair Barrette Accessories
like
Find Similar
Detail of light blue oval hair claw with brown polka dots on a linen texture background - Blue Oval Hair Clip
Detail of a vintage yellow oval hair claw clip with dark brown polka dots and glossy finish - Yellow Ellipse Hair Clip
Close-up of a pink oval hair clip with brown polka dots on a natural canvas surface - Pink Oval Hair Clip
Close-up of a blue Scottish Terrier hair clip with brown polka dots on linen fabric - Blue Dog Hair Clip
+5
Retro Polka Dot Dog Shape Hair Clip Large Claw Clip For Women Contrast Color Shark Clip Hair Barrette Accessories
-5%
$0.52-1.24
No MOQ
Acetate Hair Claws Rhinestone Cherry Animal Dog Pattern Shark Clips Elegant Hairpins Headwear Accessories For Women Girls
Acetate Hair Claws Rhinestone Cherry Animal Dog Pattern Shark Clips Elegant Hairpins Headwear Accessories For Women Girls
like
Find Similar
Dalmatian dog spotted hair claw clip in cream white and black, 10cm acetate hair grab - Black Spotted Dog
Blue and yellow speckled acetic hair claw clip 10cm size for elegant women hairstyles - Blue Spotted Claw
8cm beige acetate hair claw clip featuring red cherry and green leaf rhinestone decor - Red Cherry Claw
Amber acetate hair claw clip with blue mottling patterns, measuring 9.8cm in length - Tortoiseshell Gradient
+25
Acetate Hair Claws Rhinestone Cherry Animal Dog Pattern Shark Clips Elegant Hairpins Headwear Accessories For Women Girls
$1.15-2.85
No MOQ
 · 
17 views
Free Shipping
Cartoon Bear Rabbit Hair Clips Resin Sweet Korean Style Fringe Duckbill Barrettes For Girls And Women Cute Headwear
Cartoon Bear Rabbit Hair Clips Resin Sweet Korean Style Fringe Duckbill Barrettes For Girls And Women Cute Headwear
like
Find Similar
Detail of four matte 4cm flower-shaped hair clips in brown and cream on a display card - Flower Set
Detail of six resin strawberry bear hair clips in beige and brown on display card - Rabbit Set
Detail of two hair clips featuring three cartoon bears in brown and cream resin colors - Bear Set
Detail view of gold metal hair clip with three 3D resin cartoon strawberry rabbits - Little Rabbit
+4
Cartoon Bear Rabbit Hair Clips Resin Sweet Korean Style Fringe Duckbill Barrettes For Girls And Women Cute Headwear
-5%
$0.14-0.52
No MOQ
 · 
25 views
Cute Cartoon Hair Clips Resin Cheese Poached Egg Shape Duckbill Barrette Sweet Style Headwear For Girls Women Accessory
Cute Cartoon Hair Clips Resin Cheese Poached Egg Shape Duckbill Barrette Sweet Style Headwear For Girls Women Accessory
like
Find Similar
Set of seven sweet yellow cheese shaped hair clips with metal duckbill clips - Yellow Cheese Duckbill Clip / Yellow Cheese
Set of seven pink cheese-shaped hair clips with cute triangular resin design - Pink Cheese Duckbill Clip / Pink Cheese
Close-up of yellow cartoon cheese hair clip with smiley face on a white mirror - Smiley Cheese Hair Clip / Yellow Smiley Cheese
Cute fried egg hair clips in white and yellow on a decorative heart-shaped mirror - Egg Smiley Hair Clip / Poached Egg Smiley
+2
Cute Cartoon Hair Clips Resin Cheese Poached Egg Shape Duckbill Barrette Sweet Style Headwear For Girls Women Accessory
-4%
$0.07-0.58
Mix MOQ : 5
 · 
20 sold recently
Handmade Lace Bowknot Streamer Hair Clip Hair Tie For Women Sweet Mori Style Floral Embroidery Lace Hair Accessories
Handmade Lace Bowknot Streamer Hair Clip Hair Tie For Women Sweet Mori Style Floral Embroidery Lace Hair Accessories
like
Find Similar
Detailed macro shot of elegant lace bow hair clip with floral embroidery and long ribbons - Brown (Hair Clip)
Detailed shot of cream lace bow hair clip with floral embroidery on pink backdrop - Beige (Hair Clip)
Detailed close-up of white lace bow hair clip with elegant floral embroidery textures - Pink (Hair Clip)
Detailed macro view of white lace hair clip with floral embroidery and red scalloped edges - Red (Hair Clip)
+4
Handmade Lace Bowknot Streamer Hair Clip Hair Tie For Women Sweet Mori Style Floral Embroidery Lace Hair Accessories
$0.92
Mix MOQ : 2
 · 
13 sold recently
Acetate Clover Mini Hair Claw Clips Small Flower Hairpin With Rhinestone Elegant Hair Accessories For Women Girls
Acetate Clover Mini Hair Claw Clips Small Flower Hairpin With Rhinestone Elegant Hair Accessories For Women Girls
like
Find Similar
Small acetate clover hair claw clip with black and white pattern and rhinestone accent - White
Small clover acetate hair claw in ginger yellow and black with iridescent rhinestone - Turmeric
Blue clover-shaped acetate hair claw with central rhinestone on white plush background - Blue
Small clover acetate hair claw clip with black and white contrast and rhinestone detail - Off-white
+2
Acetate Clover Mini Hair Claw Clips Small Flower Hairpin With Rhinestone Elegant Hair Accessories For Women Girls
-4%
$1.75
No MOQ
Free Shipping
Colorful Gummy Bear Hair Clip Acrylic Resin Transparent Rainbow Duckbill Clip Cute Sweet Styling For Women Girls
Colorful Gummy Bear Hair Clip Acrylic Resin Transparent Rainbow Duckbill Clip Cute Sweet Styling For Women Girls
like
Find Similar
Detail showing six colorful gummy bear resin hair clips in a rainbow gradient sequence - 6-Bear Style
Detailed view of five colorful resin gummy bear hair clips on a white paper display card - Vivid Colors
Close-up of a colorful resin gummy bear hair clip with five vibrant candy-colored charms - Pastel Colors
Colorful Gummy Bear Hair Clip Acrylic Resin Transparent Rainbow Duckbill Clip Cute Sweet Styling For Women Girls
-6%
$0.27-0.33
No MOQ
 · 
23 sold recently
Small Hair Claw Clips Acetate Resin Marble Leopard Print Gradient Fashion Styling Hair Accessories For Women Girls
Small Hair Claw Clips Acetate Resin Marble Leopard Print Gradient Fashion Styling Hair Accessories For Women Girls
like
Find Similar
Top view of a small glossy black resin hair claw clip with smooth polished finish - Black
Detail showing the olive green marble texture and sturdy teeth of the hair claw clip - Green
Detail of amber tortoiseshell hair claw clip with gradient resin texture and polished finish - Leopard Brown
Close-up of cream leopard print hair claw clip with glossy resin texture and metal spring - Khaki
+21
Small Hair Claw Clips Acetate Resin Marble Leopard Print Gradient Fashion Styling Hair Accessories For Women Girls
$0.86
No MOQ
 · 
179 sold recently
Free Shipping
Cute Fruit Food Headband Felt Spring Hair Clips For Kids Party Costume Photo Props Funny Creative Decoration
Cute Fruit Food Headband Felt Spring Hair Clips For Kids Party Costume Photo Props Funny Creative Decoration
like
Find Similar
Funny watermelon headband with spring slices and black toothed grip for party - Sliced Watermelon Spring Hairband
Cute banana fruit headband on a spring-loaded frame for party and fun costumes - Banana Spring Hairband
Cute red apple headband with spring-loaded felt fruit decorations for parties - Apple Spring Hairband
Cute yellow pear fruit headband on black plastic frame for kids party and face washing - Pear Spring Hairband
+31
Cute Fruit Food Headband Felt Spring Hair Clips For Kids Party Costume Photo Props Funny Creative Decoration
-6%
$0.16-0.43
No MOQ
 · 
127 sold recently
Go to

More in accessories

Explore more in clips

clawsharkartificialshapehandmadedesigncolorswirepearl hairshark clips
stylealloyhairpinheartsolidlongtasselbangspartyplastic hair claw

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access