Everful

Wholesale clips

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Clips

Find the perfect pieces: hair claws, hair clips, hair bands & headbands and more

All products in clips

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Fascinator Hat With Mesh Flower And Feather Headband Clip For Women Wedding Tea Party Kentucky Derby Bridal Headpiece
Fascinator Hat With Mesh Flower And Feather Headband Clip For Women Wedding Tea Party Kentucky Derby Bridal Headpiece
like
Find Similar
Elegant bright yellow fascinator headband with mesh bow and feathers for weddings - Yellow
Elegant red British style fascinator hat with flower and feathers on headband - Red
Elegant dark green fascinator hat with flower mesh and feathers for weddings and parties - Green
Elegant black fascinator with bow net flower and feathers on headband for weddings - Black
+2
Fascinator Hat With Mesh Flower And Feather Headband Clip For Women Wedding Tea Party Kentucky Derby Bridal Headpiece
$5.48
No MOQ
 · 
12 sold recently
Kids Halloween Autumn Ribbon Bow Hair Clips Grosgrain Fabric Pumpkin Ghost Spider Pattern Accessories Girls
Kids Halloween Autumn Ribbon Bow Hair Clips Grosgrain Fabric Pumpkin Ghost Spider Pattern Accessories Girls
like
Find Similar
Halloween black grosgrain ribbon bow clip with spooky ghosts and skull prints - Black Ghost Pattern
Orange ribbed Halloween hair bow with purple and black Boo spooky patterns - Orange Ghost & BOO Style (2)
Halloween grosgrain ribbon hair clip with black bow and white ghost boo pattern - Black Ghost And Text Bubble
Orange Halloween hair bow with ghosts and BOO text printed on ribbed grosgrain ribbon - Orange Ghost Pattern
+8
Kids Halloween Autumn Ribbon Bow Hair Clips Grosgrain Fabric Pumpkin Ghost Spider Pattern Accessories Girls
$0.23
Mix MOQ : 2
 · 
228 sold recently
Polka Dot Star Rectangle Wave Hair Clips Faux Leather Metal BB Fringe Side Pins Sweet Cool Aesthetic For Women Girls
Polka Dot Star Rectangle Wave Hair Clips Faux Leather Metal BB Fringe Side Pins Sweet Cool Aesthetic For Women Girls
like
Find Similar
Detailed macro view of star shaped hair clip with white polka dots on beige fabric - 1# Black Star Style (HH6742)
Detailed view of star-shaped hair clip with black polka dots on white leather material - 2# White Star Style (HH6742)
Close-up of black wave-edged hair clip with white polka dots on a textured fabric - 3# Black Wave Cloud Style (HH6742)
Macro shot of stylish wave-shaped hair clip with black polka dots on white matte surface - 4# White Wave Cloud Style (HH6742)
+2
Polka Dot Star Rectangle Wave Hair Clips Faux Leather Metal BB Fringe Side Pins Sweet Cool Aesthetic For Women Girls
$0.48-0.52
No MOQ
 · 
12 sold recently
Free Shipping
Spiral Phone Cord Hair Ties High Elasticity Resin Non Marking Ponytail Hair Clips Minimalist For Women Girls
Spiral Phone Cord Hair Ties High Elasticity Resin Non Marking Ponytail Hair Clips Minimalist For Women Girls
like
Find Similar
Minimalist black spiral hair clip with gold metal buckle on a white book page - Black
Detail of white spiral telephone cord hair tie with golden metal clip on a wooden desk - Off-white
Detail of pearl white spiral hair tie with gold tips on a rustic wooden texture surface - Pearl White
Brown translucent spiral banana hair clip with golden metal hardware on a wooden table - Jelly Grey
+6
Spiral Phone Cord Hair Ties High Elasticity Resin Non Marking Ponytail Hair Clips Minimalist For Women Girls
-7%
$0.12
No MOQ
 · 
412 sold recently
Acetate Mini Hair Claw Clip For Women Korean Style Marble Leopard Tortoise Pattern Small Hair Clips Elegant Hair Accessories
Acetate Mini Hair Claw Clip For Women Korean Style Marble Leopard Tortoise Pattern Small Hair Clips Elegant Hair Accessories
like
Find Similar
Small rose red and orange marble texture acetate hair claw clip on white ceramic plate - Metallic Pink
Elegant beige acetate hair claw clip with marble texture for a chic ponytail look - Gemstone Brown
Small acetic acid hair claw clip with colorful orange, yellow and pink marbling - Multicolor
Small acetic acid hair claw clip with blue and cream marble texture finish - Light Multi-color
+8
Acetate Mini Hair Claw Clip For Women Korean Style Marble Leopard Tortoise Pattern Small Hair Clips Elegant Hair Accessories
-4%
$0.77
No MOQ
 · 
20 sold recently
Free Shipping
Satin Bow Hair Clip For Girls Kids Large Bowknot Barrette Handmade Solid Color Princess Hair Accessories For Celebration
Satin Bow Hair Clip For Girls Kids Large Bowknot Barrette Handmade Solid Color Princess Hair Accessories For Celebration
like
Find Similar
Macro shot of double-layered black satin bow hair clip with glossy silk finish - Black (1)
Detailed close-up of smooth satin fabric and symmetric texture on dark purple bow clip - Dark Purple (2)
Close-up of a dark blue satin bow hair clip with a smooth texture on a pink background - Navy Blue (3)
Macro detail of high-quality purple satin hair bow showing smooth texture and symmetry - Bright Purple (4)
+19
Satin Bow Hair Clip For Girls Kids Large Bowknot Barrette Handmade Solid Color Princess Hair Accessories For Celebration
-5%
$0.65
Mix MOQ : 2
Free Shipping
Heart Hair Clips Candy Colored Resin Metal Side Fringe BB Clips For Kids Girls Sweet Cute
Heart Hair Clips Candy Colored Resin Metal Side Fringe BB Clips For Kids Girls Sweet Cute
like
Find Similar
Detailed view of five pink heart hair clips with white metal base for girls - Rose Red
Macro detail of five pink heart hair clips arranged on a white stone background - Pink
Close-up of five purple heart-shaped BB hair clips on a pink and white textured surface - Purple
Close-up of five white metal BB hair clips featuring blue 3D heart shapes for girls - Blue
+4
Heart Hair Clips Candy Colored Resin Metal Side Fringe BB Clips For Kids Girls Sweet Cute
$0.09
Mix MOQ : 2
 · 
89 sold recently
Ocean Starfish Shell Hair Clip And Side Clip Resin With Faux Artificial Pearl Glitter Sweet Duckbill Accessory Women Girls
Ocean Starfish Shell Hair Clip And Side Clip Resin With Faux Artificial Pearl Glitter Sweet Duckbill Accessory Women Girls
like
Find Similar
Macro detail of starfish and shell hair clips with iridescent glitter and faux pearls - Starfish + Shell / Pink
Detail of yellow starfish and shell hair clips with pearls on a silver duckbill base - Starfish + Shell / Yellow
Detailed view of handmade starfish and shell hair clips with pearls on display card - Starfish + Shell / Mint Green
Detail of amber starfish and shell hair clips with pearls on a handmade display card - Starfish + Shell / Orange
Ocean Starfish Shell Hair Clip And Side Clip Resin With Faux Artificial Pearl Glitter Sweet Duckbill Accessory Women Girls
-4%
$0.41
No MOQ
 · 
12 sold recently
Kids Hair Clips Alloy Acrylic Fruit Star Butterfly Snap BB Clips Colorful Candy Color For Girls Cute Hair Styling Accessories
Kids Hair Clips Alloy Acrylic Fruit Star Butterfly Snap BB Clips Colorful Candy Color For Girls Cute Hair Styling Accessories
like
Find Similar
Cute red apple shaped hair clip for girls with green leaf detail and metal clip - Red Apple Kids Hair Clip
Cartoon cherry fruit hair clip for girls featuring red fruit and green leaves on linen - Red Cherry Kids Hair Clip
Cute yellow pineapple cartoon hair clip with metal base for girls on linen cloth - Yellow Pineapple Kids Hair Clip
Cute strawberry fruit hair clip with red polka dots and green leaf for girls - Polka Dot Strawberry
+10
Kids Hair Clips Alloy Acrylic Fruit Star Butterfly Snap BB Clips Colorful Candy Color For Girls Cute Hair Styling Accessories
$0.07
Mix MOQ : 100
 · 
310 sold recently
Mini Hair Claw Clips Small Matte Glossy Plastic Resin Hairpins Ponytail Holder Accessory For Women Girls Kids
Mini Hair Claw Clips Small Matte Glossy Plastic Resin Hairpins Ponytail Holder Accessory For Women Girls Kids
like
Find Similar
Detail of a matte black hair claw clip placed on a brown leather mat for elegant styling - Matte Black (Large Approx. 5cm)
Detailed close-up of a matte black mini hair claw clip on a stylish desk setting - Matte Black (Small Approx. 2cm)
Detailed close-up of a matte cream mini hair claw clip on a luxury textured surface - Matte White (Small Approx. 2cm)
Close-up of a small pink matte hair claw clip on a brown leather surface - Matte Pink (Small Approx. 2cm)
+18
Mini Hair Claw Clips Small Matte Glossy Plastic Resin Hairpins Ponytail Holder Accessory For Women Girls Kids
$0.10-0.24
No MOQ
 · 
21 views
Large Bow Hair Clip Grosgrain Ribbon Duckbill Barrette Handmade Solid Color Chic Hair Accessories For Kids Girls
Large Bow Hair Clip Grosgrain Ribbon Duckbill Barrette Handmade Solid Color Chic Hair Accessories For Kids Girls
like
Find Similar
Navy blue polyester fabric hair bow with golden glitter finish on a white background - Dark Blue
Black polyester bow hair clip with golden sparkles and shimmering metallic thread detail - Black
Close-up detail of the light blue satin polyester hair bow with a smooth texture - Light Blue
Polyester fabric hair bow in metallic gold color with textured ribbed ribbon finish - Gold
+4
Large Bow Hair Clip Grosgrain Ribbon Duckbill Barrette Handmade Solid Color Chic Hair Accessories For Kids Girls
$0.42
Mix MOQ : 2
 · 
1 reviews
Flower Hair Claw Clip Acrylic Resin Shark Clip With Faux Artificial Pearl Elegant Retro Chic Styling For Women Girls
Flower Hair Claw Clip Acrylic Resin Shark Clip With Faux Artificial Pearl Elegant Retro Chic Styling For Women Girls
like
Find Similar
Floral hair claw clip in clear acrylic with a central pearl and golden metal trim - Clear White
Pink petal flower hair claw clip with a large central pearl and gold trim detail - Beige
Floral claw clip in glossy black finish with pearl center and golden spiral base - Black
Amber floral hair claw clip in translucent resin with centered white pearl accent - Amber
Flower Hair Claw Clip Acrylic Resin Shark Clip With Faux Artificial Pearl Elegant Retro Chic Styling For Women Girls
-5%
$0.50
No MOQ
 · 
133 sold recently
Kids Rhinestone Crown Hair Clips Alloy Princess Sweet Satin Bow Headwear For Girls Toddler Birthday Party Gift
Kids Rhinestone Crown Hair Clips Alloy Princess Sweet Satin Bow Headwear For Girls Toddler Birthday Party Gift
like
Find Similar
Children's silver crown hair clip featuring sparkling rhinestones and a pink grosgrain bow - Crown Star Chain Style 1
Sparkly silver crown hair clip with pink ribbon bow and large pear-shaped rhinestone - Three Water Drops Style 2
Pink princess crown hair clip for girls with sparkling rhinestones and ribbon bow - Crown Large Water Drop Style 3
Pink ribbon princess crown hair clip with silver stars and sparkling rhinestones - Crown Five Stars Style 5
+7
Kids Rhinestone Crown Hair Clips Alloy Princess Sweet Satin Bow Headwear For Girls Toddler Birthday Party Gift
-4%
$0.69
No MOQ
 · 
344 sold recently
Cloud Shape Hair Claw Clip Acetate Artificial Pearl Embellished Shark Clip Marble Texture Hair Accessories For Women
Cloud Shape Hair Claw Clip Acetate Artificial Pearl Embellished Shark Clip Marble Texture Hair Accessories For Women
like
Find Similar
Cloud-shaped orange acetate hair claw clip with faux pearls and golden bead accents - 9.2cm / Orange
Green marble cloud hair claw clip with white pearls and luxury acetate finish - 9.2cm / Green
Cloud-shaped blue resin hair claw clip featuring inlaid pearls and starry glitter finish - 9.2cm / Dark Blue
Elegant pink pearlescent hair claw clip with pearl and rhinestone cloud design - 9.2cm / Purple
+1
Cloud Shape Hair Claw Clip Acetate Artificial Pearl Embellished Shark Clip Marble Texture Hair Accessories For Women
$4.03
No MOQ
Free Shipping
Mini Bow Hair Clips Satin Ribbon Velvet Small Duckbill Hairpins Sweet Cute Korean Style For Women Girls Braids Styling
Mini Bow Hair Clips Satin Ribbon Velvet Small Duckbill Hairpins Sweet Cute Korean Style For Women Girls Braids Styling
like
Find Similar
Close-up of pink ribbon bow hair clips with metal duckbill base on a pearl jewelry tray - Rose Pink
Detailed view of four light blue satin ribbon bows placed on a pink polka dot ceramic tray - Blue
Mini cream satin bow hair clips in a 3-piece set for sweet and elegant hairstyling - Off White
Three mini pink satin ribbon bow hair clips for sweet DIY styling and accessories - Snow Bud Pink
+14
Mini Bow Hair Clips Satin Ribbon Velvet Small Duckbill Hairpins Sweet Cute Korean Style For Women Girls Braids Styling
$0.03
Mix MOQ : 10
 · 
175 sold recently
Mardi Gras Hair Clips Glitter Ribbon Carnival Masquerade Accessories Purple Green Gold Jester Hat Crown Mask Headwear
Mardi Gras Hair Clips Glitter Ribbon Carnival Masquerade Accessories Purple Green Gold Jester Hat Crown Mask Headwear
like
Find Similar
Mini Mardi Gras top hat hair clip with purple glitter, fleur-de-lis and tricolor ribbons - Purple Top Hat
Mardi Gras mini top hat clip with green glitter and purple fleur-de-lis, 5.51 inches - Green Top Hat
Mardi Gras hair clip with purple gold green glitter ribbons and fleur-de-lis - Green Purple Gold Crown
Mardi Gras hair clip with purple drum, festive sequins, and ribbons in gold, purple, green - Little Drum
+4
Mardi Gras Hair Clips Glitter Ribbon Carnival Masquerade Accessories Purple Green Gold Jester Hat Crown Mask Headwear
-5%
$0.49
Mix MOQ : 10
 · 
286 sold recently
Elegant Korean Style Satin Ribbon Bow Hair Clip For Women Gentle Sweet Princess Aesthetic Long Streamer Hair Decoration Daily Accessory
Elegant Korean Style Satin Ribbon Bow Hair Clip For Women Gentle Sweet Princess Aesthetic Long Streamer Hair Decoration Daily Accessory
like
Find Similar
Detail of cream satin bow hair clip with long ribbons on a minimalist wooden shelf - Beige
Close-up of black satin bow hair clip with long ribbons on a minimalist wooden shelf - Black
Detailed close-up of a pink satin ribbon bow hair clip on a textured wooden shelf - Pink
Close-up of a silver-grey satin bow hair clip with long ribbons on a wooden surface - Gray
+1
Elegant Korean Style Satin Ribbon Bow Hair Clip For Women Gentle Sweet Princess Aesthetic Long Streamer Hair Decoration Daily Accessory
-5%
$1.01
No MOQ
 · 
20 sold recently
Childrens Gradient Color Wig Hair Clip Glitter Sequin Bow Long Curly Synthetic Extension Party Hairpiece For Girls
Childrens Gradient Color Wig Hair Clip Glitter Sequin Bow Long Curly Synthetic Extension Party Hairpiece For Girls
like
Find Similar
Close-up of sparkling blue sequin bow hair clip with curly gradient blue extensions - Single Piece / Blue
Detail of children's pink gradient hair extension with sparkling glitter bow hair clip - Single Piece / Pink
Kids gradient pink and blue hair extension clip with a pink sequin bow on card - Single Piece / Pink Blue Gradient
Girls purple sequin bow hair clip with 25cm colorful gradient curly synthetic hair extension - Single Piece / Purple
+4
Childrens Gradient Color Wig Hair Clip Glitter Sequin Bow Long Curly Synthetic Extension Party Hairpiece For Girls
-4%
$0.63-0.77
No MOQ
 · 
19 sold recently
Mini Hair Clips Metal Duckbill Alligator Square DIY Hair Accessories For Girls Kids Colorful Macaron Hair Styling Tools
Mini Hair Clips Metal Duckbill Alligator Square DIY Hair Accessories For Girls Kids Colorful Macaron Hair Styling Tools
like
Find Similar
Set of six matte macaron-colored 2cm metal alligator hair clips for kids in various colors - 2.5cm Macaron Mixed Colors Duckbill Clip
Bulk set of black 2cm mini metal alligator hair clips for children on white background - 2.5cm Matte Black Pointed Clip
Pair of mini 2cm black rectangular metal hair clips with a smooth matte finish - 2.0cm Matte Black Square Clip
Minimalist 2cm rectangular silver metal alligator hair clip with a polished finish - 2.5cm Silver Square Clip
+4
Mini Hair Clips Metal Duckbill Alligator Square DIY Hair Accessories For Girls Kids Colorful Macaron Hair Styling Tools
$0.01
Mix MOQ : 50
 · 
50 sold recently
Sequin Heart Hair Clip And Headband Fabric Sparkling Sweet Hair Accessories For Kids Girls Party Princess Style
Sequin Heart Hair Clip And Headband Fabric Sparkling Sweet Hair Accessories For Kids Girls Party Princess Style
like
Find Similar
Sweet heart-shaped hair clip with colorful sequins in candy tones for children - Colorful Rose Hair Clip
Pink glitter heart hair clip featuring shimmering sequins and a sweet sequin patch design - Pink Hair Clip
Sparkly heart hair clip with laser sequins in light blue and purple fish scale texture - Blue Hair Clip
Sparkly yellow heart sequin hair clip for girls with a shiny metallic finish - Yellow Hair Clip
+8
Sequin Heart Hair Clip And Headband Fabric Sparkling Sweet Hair Accessories For Kids Girls Party Princess Style
$0.13-0.26
Mix MOQ : 2
 · 
154 sold recently
Cartoon Butterfly Large Paper Clips Creative PVC Animal Shaped Bookmark Cute Stationery For Student Office School Supplies Document Organizer
Cartoon Butterfly Large Paper Clips Creative PVC Animal Shaped Bookmark Cute Stationery For Student Office School Supplies Document Organizer
like
Find Similar
Macro shot of 3D green butterfly paperclip with vivid PVC detail and coated metal finish - Green Butterfly Style
Close-up of a large red butterfly paperclip with detailed PVC wings on white background - Red Butterfly Style
Creative butterfly paperclip with orange PVC wing decor and yellow metal U-shaped bookmark - Orange Black Vein Butterfly Style
Close-up of a large red metal paperclip featuring a colorful PVC butterfly ornament - Purple Butterfly Style
+4
Cartoon Butterfly Large Paper Clips Creative PVC Animal Shaped Bookmark Cute Stationery For Student Office School Supplies Document Organizer
$0.12
Mix MOQ : 100
 · 
22 views
Vintage French Style Acetate Rose Flower Hair Claw Clip Elegant Camellia Sparkling Hair Accessories For Women Girls
Vintage French Style Acetate Rose Flower Hair Claw Clip Elegant Camellia Sparkling Hair Accessories For Women Girls
like
Find Similar
French vintage rose hair claw clip in gradient pink resin with pearlescent finish - Transparent Pink Rose
Detailed view of pink rose claw clip hair accessory in a vintage golden basket - Pink and White Two-Tone Rose
French vintage camellia hair claw clip with black and white petals for women - Cream White Rose with Black Edge
Pink rose claw clip with black outlines in a vintage French style hair accessory - Pink Rose with Black Edge
Vintage French Style Acetate Rose Flower Hair Claw Clip Elegant Camellia Sparkling Hair Accessories For Women Girls
$4.32
No MOQ
Free Shipping
Christmas Hair Clips Santa Hat Reindeer Antler Plush Sequins Glitter Festive Party Hair Accessories For Women Girls
Christmas Hair Clips Santa Hat Reindeer Antler Plush Sequins Glitter Festive Party Hair Accessories For Women Girls
like
Find Similar
Mini red felt Christmas hat hair clip with white plush trim and metal alligator base - 3D Hat
Mini red and white Christmas hat hair clip with metal base shown in hand - Slouchy Hat
Close-up of a Christmas hair clip featuring glittery golden reindeer antlers and a red hat - Lace Reindeer
Red sequin mini Christmas hat hair clip with white plush trim for party hair styling - Sequin Drooping Hat
+29
Christmas Hair Clips Santa Hat Reindeer Antler Plush Sequins Glitter Festive Party Hair Accessories For Women Girls
-5%
$0.49-1.78
Mix MOQ : 2
 · 
53 sold recently
Free Shipping
Glitter Bow And Shell Hair Clips Sparkly Holographic Duckbill Hairpins Korean Style Princess Headwear For Kids Girls
Glitter Bow And Shell Hair Clips Sparkly Holographic Duckbill Hairpins Korean Style Princess Headwear For Kids Girls
like
Find Similar
Sparkly purple and pink bow and shell hair clip set for girls on jewelry card - Bow/Shell / Purple
Cute girls' hair clips set with rainbow sequin bow and golden shell on display card - Bow/Shell / Yellow
Set of two pink glitter hair clips for girls featuring a bow and seashell on card - Bow/Shell / Pink
Pair of blue glitter hair clips with bow and shell designs for girls on display card - Bow/Shell / Sky Blue
+1
Glitter Bow And Shell Hair Clips Sparkly Holographic Duckbill Hairpins Korean Style Princess Headwear For Kids Girls
$0.66
No MOQ
Sweet Fruit Print PVC Large Shark Hair Claw Clip Strawberry Watermelon Cherry Grape Pattern Fashion Hair Accessories For Women
Sweet Fruit Print PVC Large Shark Hair Claw Clip Strawberry Watermelon Cherry Grape Pattern Fashion Hair Accessories For Women
like
Find Similar
Close-up of white PVC hair claw clip with fresh red cherry print and golden metal spring - PVC / Cherry (8.5cm Semicircle Acrylic)
Detailed macro view of white hair claw clip with red grape pattern and transparent teeth - PVC / Grape (8.5cm Semicircle Acrylic)
Detail of a semi-transparent white hair claw clip with a cute red strawberry print - PVC / Strawberry (8.5cm Semicircle Acrylic)
Detailed view of a large watermelon print hair claw clip on a white leather background - PVC / Watermelon (8.5cm Semicircle Acrylic)
Sweet Fruit Print PVC Large Shark Hair Claw Clip Strawberry Watermelon Cherry Grape Pattern Fashion Hair Accessories For Women
$1.30
No MOQ
Vintage Baroque Gold Alloy Metal Leaf Butterfly Hair Comb Clip Bridal Wedding Jewelry Women Elegant Headpiece
Vintage Baroque Gold Alloy Metal Leaf Butterfly Hair Comb Clip Bridal Wedding Jewelry Women Elegant Headpiece
like
Find Similar
Macro detail of golden alloy leaf hair comb with textured finish on white background - Gold Hair Comb 1#
Detailed close-up of golden metal butterfly hair comb with intricate leaf wing carvings - Small Butterfly Hair Comb 1#
Close-up of golden leaf hair comb showing intricate leaf texture and metallic finish - Gold Hair Comb 2#
Detailed macro view of the golden metal leaf texture and polished finish on the hair clip - Gold Spring Clip 3#
+7
Vintage Baroque Gold Alloy Metal Leaf Butterfly Hair Comb Clip Bridal Wedding Jewelry Women Elegant Headpiece
$0.52-4.61
Mix MOQ : 2
 · 
37 sold recently
Free Shipping
Cute Cat Ear Hair Clips Plush Faux Fur Cartoon Animal Duckbill Barrettes For Kids Girls Toddlers Sweet Hair Accessories
Cute Cat Ear Hair Clips Plush Faux Fur Cartoon Animal Duckbill Barrettes For Kids Girls Toddlers Sweet Hair Accessories
like
Find Similar
Cute white plush cat ear hair clip with pink inner ear for girls on a cloud board - Pink
Purple cat ear hair clip with white faux fur trim for girls on cloud card holder - Purple
Cute plush blue cat ear hair clip with white fur trim on a decorative cloud card - Blue
Cute yellow and white plush cat ear hair clip on a decorative white cloud card - Yellow
+2
Cute Cat Ear Hair Clips Plush Faux Fur Cartoon Animal Duckbill Barrettes For Kids Girls Toddlers Sweet Hair Accessories
$0.12
No MOQ
 · 
1K+ sold recently
French Acetate Hair Claw Clip Elegant Calla Lily Tulip Flower Pattern Large Hairpin Sweet Styling Accessory For Women
French Acetate Hair Claw Clip Elegant Calla Lily Tulip Flower Pattern Large Hairpin Sweet Styling Accessory For Women
like
Find Similar
French Calla Lily acetate hair claw clip with pearl white petals and pink buds - 11cm / White
French calla lily hair claw clip in tortoiseshell blue with yellow flower accents - 11cm / Blue Floral Tortoiseshell
Elegant black acetate hair claw clip featuring pink tulip flower designs for women - 11cm / Black
French Acetate Hair Claw Clip Elegant Calla Lily Tulip Flower Pattern Large Hairpin Sweet Styling Accessory For Women
$3.98
No MOQ
Free Shipping
Matte Silver Zinc Alloy Wave Star Rhinestone Hair Claw Clip Elegant Large Metal Shark Clip Hair Styling Accessory For Women
Matte Silver Zinc Alloy Wave Star Rhinestone Hair Claw Clip Elegant Large Metal Shark Clip Hair Styling Accessory For Women
like
Find Similar
Silver matte metal wavy hair claw clip with colorful rhinestones and star details - Silver Wave Multi-color Rhinestone Star Claw (1#)
Matte silver wave hair claw clip featuring purple crystals and black star patterns - Silver Wave Purple Pink Rhinestone Cross Star Claw (2#)
Matte Silver Zinc Alloy Wave Star Rhinestone Hair Claw Clip Elegant Large Metal Shark Clip Hair Styling Accessory For Women
-5%
$1.51
Mix MOQ : 2
3D Flower Hair Claw Clips Acetate Rose Shape Large Shark Clip Elegant Marbled Hair Accessories For Women Girls
3D Flower Hair Claw Clips Acetate Rose Shape Large Shark Clip Elegant Marbled Hair Accessories For Women Girls
like
Find Similar
Elegant 3D rose flower hair claw clip in pearlescent orange-pink resin finish - 8cm / Colorful Orange
Pink pearlescent acetate rose flower hair claw clip for elegant ponytail hairstyles - 8cm / Iridescent Light Purple
Pink and white gradient rose hair claw clip made of elegant translucent acetate material - 8cm / Metallic Pink
Blue-green gradient rose flower hair claw clip in glossy acetate for half-up hairstyles - 8cm / Teal
3D Flower Hair Claw Clips Acetate Rose Shape Large Shark Clip Elegant Marbled Hair Accessories For Women Girls
$6.57
No MOQ
Free Shipping
Matte Square Hollow Hair Claw Clip Geometric Non-Slip Resin Hair Clips For Women Girls Elegant Daily Headwear Accessories
Matte Square Hollow Hair Claw Clip Geometric Non-Slip Resin Hair Clips For Women Girls Elegant Daily Headwear Accessories
like
Find Similar
Detail view of a square matte cream hair claw clip with cutout design on textured surface - Matte Milky White Small Square Claw Clip (1#)
Matte cream-colored small square hair claw clip for elegant updo hairstyling - Off-white High Ponytail 3.8cm Claw Clip (1#)
Matte orange square hair claw clip for women made of durable resin with strong grip - Matte Orange High Ponytail 3.8cm Claw Clip (2#)
Elegant matte brown square hair claw clip in a minimalist resin design for women - Matte Brown High Ponytail 3.8cm Claw Clip (3#)
+13
Matte Square Hollow Hair Claw Clip Geometric Non-Slip Resin Hair Clips For Women Girls Elegant Daily Headwear Accessories
-6%
$0.14-0.20
No MOQ
 · 
80 sold recently
Large Acetate Shark Dolphin Hair Claw Clip Ocean Animal Marine Life Hair Clip For Women Daily Vacation Styling Accessories
Large Acetate Shark Dolphin Hair Claw Clip Ocean Animal Marine Life Hair Clip For Women Daily Vacation Styling Accessories
like
Find Similar
Elegant purple pearl texture dolphin hair claw clip with golden outlines and small diamond - 1# Purple Dolphin 12cm
Macro shot of blue acetate shark hair claw clip with marble texture on white table - 2# Blue Shark 12.5cm
Close-up of a realistic blue swordfish hair claw clip made of acetate with translucent belly - 3# Blue Marlin 14cm
Macro shot of large black and white fish-shaped hair claw made of premium cellulose acetate - 4# Black Marlin 14cm
+2
Large Acetate Shark Dolphin Hair Claw Clip Ocean Animal Marine Life Hair Clip For Women Daily Vacation Styling Accessories
$2.74-4.84
No MOQ
Vintage Hair Clips Alloy Rhinestone Faux Turquoise Butterfly Heart Geometric Bobby Pins Fashion For Women Girls
Vintage Hair Clips Alloy Rhinestone Faux Turquoise Butterfly Heart Geometric Bobby Pins Fashion For Women Girls
like
Find Similar
Detailed set of gold and silver hair clips with turquoise and ruby gemstones on a card - Set 1 (Red/Black/Turquoise Stones)
Minimalist gold hair clip set with turquoise triangle stone and clear crystal detail - Set 2 (Turquoise/Round Rhinestone)
Golden hairpin set featuring rectangular turquoise floral and pink rhinestone heart designs - Set 6 (Turquoise Flower/Pink Heart)
Silver hair clip set with sparkling rhinestone heart and blue stone accent detail - Set 7 (Silver Heart/Blue Horseshoe)
+3
Vintage Hair Clips Alloy Rhinestone Faux Turquoise Butterfly Heart Geometric Bobby Pins Fashion For Women Girls
-5%
$1.04-2.88
Mix MOQ : 3
Free Shipping
Ocean Starfish Shell Large Hair Claw Clip Acrylic Resin Faux Artificial Pearl Rhinestone High Texture Shark Clip Hairpin For Women
Ocean Starfish Shell Large Hair Claw Clip Acrylic Resin Faux Artificial Pearl Rhinestone High Texture Shark Clip Hairpin For Women
like
Find Similar
Dark iridescent ocean shell and starfish hair claw clip with pearls on white sand - H975-Iridescent Gold Powder Ocean Style
Deep blue shell-shaped hair claw clip with pearls and starfish on white sand - H979-Deep Blue Shell Pearl Style
Deep blue sparkling hair claw clip with pearls and starfish on a sandy beach background - H999-Blue Glitter Starfish Style
Ocean Starfish Shell Large Hair Claw Clip Acrylic Resin Faux Artificial Pearl Rhinestone High Texture Shark Clip Hairpin For Women
$2.80
No MOQ
 · 
10 views
Simulated Flower Hair Claw Clips Fabric Rose Mesh Camellia Shark Clips Elegant Hair Ties Accessories For Women Girls
Simulated Flower Hair Claw Clips Fabric Rose Mesh Camellia Shark Clips Elegant Hair Ties Accessories For Women Girls
like
Find Similar
Handmade pink and blue felt rose flower hair claw clip with a soft textured finish - 050 Felt Flower - Pink
Pink gauze rose hair claw clip with white beads for elegant updo hairstyles - 405 Mesh Flower Clip - Rose Red
Elegant beige fabric rose flower hair claw clip shown on woman's updo hairstyle - 430 Dried Rose Flower Claw - Double-sided Large Flower - Beige
Large beige fabric rose hair claw clip for women featuring elegant chiffon flower design - 434 Dried Rose Claw - AB Side
+17
Simulated Flower Hair Claw Clips Fabric Rose Mesh Camellia Shark Clips Elegant Hair Ties Accessories For Women Girls
-6%
$0.42-1.17
No MOQ
 · 
24 views
Colorful Glitter Kids Snap Hair Clips Metallic Lacquer Water Drop BB Clips For Girls Toddler Hair Styling Fashion Accessories
Colorful Glitter Kids Snap Hair Clips Metallic Lacquer Water Drop BB Clips For Girls Toddler Hair Styling Fashion Accessories
like
Find Similar
Pink glitter water drop BB hair clip with shiny sequins and matching metal finish - Pink
Black glitter hair clip with 3cm sparkling surface and secure BB snap fastener for girls - Black
Glittery purple snap hair clip for girls with a shiny sparkle finish and metal base - Purple
Sparkling dark blue glitter snap hair clip for girls on a luxury mirror tray - Dark Blue
+18
Colorful Glitter Kids Snap Hair Clips Metallic Lacquer Water Drop BB Clips For Girls Toddler Hair Styling Fashion Accessories
$0.07
Mix MOQ : 5
 · 
30 sold recently
Cute Panda Bamboo Hair Claw Acetate Cartoon Animal Hair Clip Versatile Headwear For Women Girls
Cute Panda Bamboo Hair Claw Acetate Cartoon Animal Hair Clip Versatile Headwear For Women Girls
like
Find Similar
Cute panda-shaped acetate hair claw clip with pink flower on white ceramic plate - Flower Panda (Acrylic Printing) (Approx. 8cm)
Cute panda hair claw clip in black and white acetate with pink flower accent - Flower Panda (Acetate Splicing) (Approx. 8cm)
Detail of panda and green bamboo claw clip on branch made from glossy acetate material - Panda Holding Bamboo Hair Claw (Acetate) (Approx. 11cm)
Cute panda hair claw clip made of pearlescent acetate material in black and white finish - Sparkling Eye Crawling Panda (Acetate)
Cute Panda Bamboo Hair Claw Acetate Cartoon Animal Hair Clip Versatile Headwear For Women Girls
-5%
$1.86-4.52
No MOQ
 · 
13 views
Free Shipping
Y2K Star Heart Rhinestone Hair Clips Alloy Artificial Pearl Shell Duckbill Clip Fashion Hair Accessories Women Girls
Y2K Star Heart Rhinestone Hair Clips Alloy Artificial Pearl Shell Duckbill Clip Fashion Hair Accessories Women Girls
like
Find Similar
Silver star rhinestone hair clip with blue starfish and seashells in Y2K style - 19# Silver Blue Duckbill Clip (Marine Starfish)
Starfish hair clip with purple crystal and faux pearls in vintage silver finish - 20# Silver Red Duckbill Clip (Marine Starfish)
Detail view of two silver bow hair clips with rhinestones on a ceramic plate - 1# Silver Rhinestone Bow Hair Clip
Detailed macro shot of silver rhinestone star hair clips on a ceramic tray display - 2# Silver Rhinestone Star Hair Pin
+9
Y2K Star Heart Rhinestone Hair Clips Alloy Artificial Pearl Shell Duckbill Clip Fashion Hair Accessories Women Girls
$0.69-8.30
No MOQ
 · 
16 views
Free Shipping
Large Bow Hair Clip Brooch Iridescent Satin Ribbon Long Streamer Layered Fairy Style Headwear Women Girls Hair Accessories
Large Bow Hair Clip Brooch Iridescent Satin Ribbon Long Streamer Layered Fairy Style Headwear Women Girls Hair Accessories
like
Find Similar
Elegant oversized light pink pearlescent ribbon bow hair clip with triple-layer design - Light Pink Spring Clip
Light blue pearlized satin bow hair clip with a handmade metallic spring fastener - Grey Spring Clip
Elegant champagne satin double-layered bow hair clip with secure metal spring closure - Beige Spring Clip
Pink pearlescent organza triple bow hair clip with long ribbon and metal duckbill clip - Light Pink Duckbill Clip
+8
Large Bow Hair Clip Brooch Iridescent Satin Ribbon Long Streamer Layered Fairy Style Headwear Women Girls Hair Accessories
-5%
$1.50
No MOQ
 · 
79 sold recently
Satin Bow Hair Clip With Long Ribbons And Artificial Pearls Elegant Ribbon Bowknot Spring Barrette Hairpin Accessory For Women
Satin Bow Hair Clip With Long Ribbons And Artificial Pearls Elegant Ribbon Bowknot Spring Barrette Hairpin Accessory For Women
like
Find Similar
Detail of black satin ribbon bow hair clip with elegant pearl embellishments - Black
Detail view of a cream satin bow hair clip with elegant pearl embellishments on ribbons - Beige
Close-up of a red satin bow hair clip featuring elegant white pearl bead tassels - Burgundy
Detail of red satin bow hair clip with white pearls on elegant long hanging ribbons - Red
Satin Bow Hair Clip With Long Ribbons And Artificial Pearls Elegant Ribbon Bowknot Spring Barrette Hairpin Accessory For Women
$1.41
Mix MOQ : 2
 · 
11 sold recently
Matte Plastic Flower Hair Claw Clip With Artificial Pearl Elegant Floral Shark Clip For Women Daily Vacation Hair Accessories
Matte Plastic Flower Hair Claw Clip With Artificial Pearl Elegant Floral Shark Clip For Women Daily Vacation Hair Accessories
like
Find Similar
Detail of pink matte flower hair claw with white pearl trim and floral grip structure - Pink
Detailed view of a matte blue flower hair claw clip with white pearlescent edges - Blue
Detailed close-up of a matte purple flower hair claw with pearl and pearlescent trim - Purple
Close-up of matte orange and white five-petal flower hair claw clip with sturdy teeth - Orange
+2
Matte Plastic Flower Hair Claw Clip With Artificial Pearl Elegant Floral Shark Clip For Women Daily Vacation Hair Accessories
$0.57
No MOQ
 · 
15 sold recently
Cute Crochet Hair Clips Handmade Knit Yarn Cartoon Animal Fruit Barrettes Sweet Headwear For Toddler Girls Kids
Cute Crochet Hair Clips Handmade Knit Yarn Cartoon Animal Fruit Barrettes Sweet Headwear For Toddler Girls Kids
like
Find Similar
Set of five cute hand-knitted animal BB hair clips featuring lions and bunnies - Animal Knitted Hair Clips
Handmade crochet avocado hair clip accessory featuring detailed green and yellow knit texture - Avocado
Close-up of a handmade crochet lion hair clip displayed on a white ceramic plate - Lion
Macro detail of hand-knitted yellow chick hair clip with orange comb and feet textures - Chicken
+8
Cute Crochet Hair Clips Handmade Knit Yarn Cartoon Animal Fruit Barrettes Sweet Headwear For Toddler Girls Kids
$0.11
No MOQ
 · 
27 views
Wavy Hair Claw Clip Glossy Resin Large Shark Hair Clamp For Women Girls Daily Ponytail Holder Korean Style
Wavy Hair Claw Clip Glossy Resin Large Shark Hair Clamp For Women Girls Daily Ponytail Holder Korean Style
like
Find Similar
Macro view of beige wavy hair claw clip on soft white silk paper in a gift box - Cream White
Close-up of pink wave-shaped hair claw clip with glossy finish in aesthetic packaging - Rose Pink
Minimalist large white translucent wavy claw clip for thick hair styling - Jelly White
Summer wavy hair claw clip in jelly pink resin finish presented in a premium gift box - Jelly Pink
+5
Wavy Hair Claw Clip Glossy Resin Large Shark Hair Clamp For Women Girls Daily Ponytail Holder Korean Style
$0.52
No MOQ
 · 
32 sold recently
Handmade Crochet Knitted Hair Clips Sweet Floral Cherry Pattern BB Pins Aesthetic Hair Accessories For Girls
Handmade Crochet Knitted Hair Clips Sweet Floral Cherry Pattern BB Pins Aesthetic Hair Accessories For Girls
like
Find Similar
Handmade crochet BB hair clip with orange floral motif and green scalloped knit edge - 1-Green Large Flower
Handmade knitted hair clip featuring a green oval design with orange bow and yellow dots - 2-Bowknot Style
Handmade knitted flower hair clip in green and yellow on a white ceramic plate - 3-Small Flower
Handmade knitted green flower BB hair clip with delicate white and orange floral crochet - 4-Small Polka Dot
+14
Handmade Crochet Knitted Hair Clips Sweet Floral Cherry Pattern BB Pins Aesthetic Hair Accessories For Girls
$0.29
No MOQ
 · 
18 views
Creative Book Shape Hair Claw Clip Acrylic 3D Stationery Design Lacquered Fresh Sweet Dopamine Color Hair Clips For Women
Creative Book Shape Hair Claw Clip Acrylic 3D Stationery Design Lacquered Fresh Sweet Dopamine Color Hair Clips For Women
like
Find Similar
Macro shot of creative book-shaped hair claw clip with pearlescent finish and red bookmark - Pink Books
Macro detail of the 3D book-shaped hair claw clip with colorful layered acetate edges - Purple Book
Creative Book Shape Hair Claw Clip Acrylic 3D Stationery Design Lacquered Fresh Sweet Dopamine Color Hair Clips For Women
$1.51
No MOQ
Vintage Tortoiseshell Cellulose Acetate Hair Claw Clip Hollow Geometric Square Medium Hair Catch Clip For Women Hair Accessories
Vintage Tortoiseshell Cellulose Acetate Hair Claw Clip Hollow Geometric Square Medium Hair Catch Clip For Women Hair Accessories
like
Find Similar
Medium acetate tortoise shell hair claw clip for women featuring hollow geometric design - Dark Tortoiseshell
Vintage Tortoiseshell Cellulose Acetate Hair Claw Clip Hollow Geometric Square Medium Hair Catch Clip For Women Hair Accessories
-5%
$2.60
Mix MOQ : 2
 · 
10 sold recently
Free Shipping
Elegant Faux Artificial Pearl Hair Clips Alloy Snap Barrettes Decorative Hair Pins Accessories For Women Girls Wedding Party
Elegant Faux Artificial Pearl Hair Clips Alloy Snap Barrettes Decorative Hair Pins Accessories For Women Girls Wedding Party
like
Find Similar
Elegant gold star hair clip with white faux pearls on soft fabric background - Pentagram Frog Clip
Elegant gold metal hair clip with a single pearl accent on a reflective surface - Leaf Pearl
Elegant rectangular pearl hair clip featuring white imitation pearls on a metallic base - Teardrop Pearl BB Clip
Elegant gold alloy hair pin with white gradient pearls on a minimalist 7cm bar clip - Caterpillar Small
+12
Elegant Faux Artificial Pearl Hair Clips Alloy Snap Barrettes Decorative Hair Pins Accessories For Women Girls Wedding Party
-8%
$0.11-0.52
No MOQ
 · 
10 sold recently
Butterfly Hair Clips Hollow Metal Beaded Moving Wings Spring Design Sweet Vintage Hanfu Style Headpiece For Women Girls
Butterfly Hair Clips Hollow Metal Beaded Moving Wings Spring Design Sweet Vintage Hanfu Style Headpiece For Women Girls
like
Find Similar
Close-up of golden butterfly hair clip with colorful beads on a woven basket edge - Beaded Style / Gold
Silver metal moving butterfly hair clip with colorful beads on bamboo basket background - Beaded Style / Silver
Exquisite golden hollow butterfly hair clip made of metal for vintage hairstyles - Basic Style / Gold
Detail view of silver hollow butterfly hair clip showing 4cm width and 4.3cm height dimensions - Basic Style / Silver
+6
Butterfly Hair Clips Hollow Metal Beaded Moving Wings Spring Design Sweet Vintage Hanfu Style Headpiece For Women Girls
-9%
$0.12-0.36
No MOQ
 · 
35 views
Big Ribbon Bow Hair Clip Satin Double Layer Long Streamers Korean Style Sweet Handmade Hair Accessories For Women
Big Ribbon Bow Hair Clip Satin Double Layer Long Streamers Korean Style Sweet Handmade Hair Accessories For Women
like
Find Similar
Pink satin double-layered bow hair clip displayed on a tray with a wooden background - Bean Pink 26
Taupe satin double bow hair clip on a beige tray with decorative accessories - Dark Grey 162
Detail of light blue satin double-layered bow hair clip with elegant long ribbons - Lake Blue 61
Close-up of pink satin bow hair clip with long streamers on an elegant display tray - Tender Pink 22
+7
Big Ribbon Bow Hair Clip Satin Double Layer Long Streamers Korean Style Sweet Handmade Hair Accessories For Women
$0.69
No MOQ
 · 
19 views
Elegant Lace Bowknot Hair Clip With Long Ribbon Streamer French Style Spring Hairpin For Women Girls
Elegant Lace Bowknot Hair Clip With Long Ribbon Streamer French Style Spring Hairpin For Women Girls
like
Find Similar
Detailed view of elegant black lace bow hair clip with floral embroidery long ribbons - Black
Rear view of a model wearing a large cream lace bow hair clip with long flowing ribbons - White
Pink lace bow hair clip for women, sweet floral crochet style for long hair - Pink
Elegant lace bow spring clips set in black, cream white and pink with long ribbons - Three-Piece Set
+3
Elegant Lace Bowknot Hair Clip With Long Ribbon Streamer French Style Spring Hairpin For Women Girls
$0.53-1.56
No MOQ
 · 
80 sold recently
Retro Flower Butterfly Hair Clip Alloy Enamel Rhinestone Elegant Spring Top Clip Accessory For Women
Retro Flower Butterfly Hair Clip Alloy Enamel Rhinestone Elegant Spring Top Clip Accessory For Women
like
Find Similar
Vintage butterfly hair clip with pink enamel flowers and sparkling rhinestones - Butterfly Spring Clip / Pink/Painted Butterfly
Macro shot of an enamel flower hair clip with purple and pink petals and rhinestones - Flower Spring Clip / Purple/Painted Flower
Vintage gold metal flower hair clip with colorful enamel and sparkling rhinestones - Flower Spring Clip / Multicolor/Painted Flower
Detail of vintage red floral hair clip with crystals on gold leaf branch design - Flower Spring Clip / Pink/Painted Flower
+11
Retro Flower Butterfly Hair Clip Alloy Enamel Rhinestone Elegant Spring Top Clip Accessory For Women
$1.56
No MOQ
 · 
29 sold recently
Kids Hair Accessories Colorful Elastic Rubber Bands And Mini Plastic Claw Clips In Organizer For Girls Toddlers
Kids Hair Accessories Colorful Elastic Rubber Bands And Mini Plastic Claw Clips In Organizer For Girls Toddlers
like
Find Similar
Macaron color elastic hair ties and mini clips set in a multi-grid storage box - Style E (Hair Ties and Clips Set)
Macro detail of assorted pastel hair ties and floral clips in a four-grid storage box - Style A (Hair Ties and Clips Set)
Close-up of kids hair accessories set in a cute box with macaron ties and flower clips - Style B (Hair Ties and Clips Set)
Detail of colorful star hair clips and spiral bands in a transparent 4-grid storage box - Style C (Hair Ties and Clips Set)
+8
Kids Hair Accessories Colorful Elastic Rubber Bands And Mini Plastic Claw Clips In Organizer For Girls Toddlers
$0.58-0.63
No MOQ
 · 
18 views
Butterfly Bowknot Hair Clips Litchi Texture PU Leather Metallic Shimmer Handmade Hairpins For Kids Girls Accessories
Butterfly Bowknot Hair Clips Litchi Texture PU Leather Metallic Shimmer Handmade Hairpins For Kids Girls Accessories
like
Find Similar
Magenta lychee texture butterfly hair clip for girls with elegant faux leather finish - Grape Purple Butterfly
Litchi pattern pearl white butterfly hair clip for kids with metallic faux leather finish - Pearly White Butterfly
Purple blue butterfly hair clip with lychee leather texture for kids hair styling - Charming Blue Butterfly
Litchi pattern butterfly hair clip for girls in metallic rose gold faux leather finish - Rose Gold Butterfly
+8
Butterfly Bowknot Hair Clips Litchi Texture PU Leather Metallic Shimmer Handmade Hairpins For Kids Girls Accessories
$0.35
No MOQ
 · 
38 sold recently
Large Double Layer Satin Bow Hair Clip With Faux Artificial Pearl Rhinestone Elegant Korean Style Spring Clip For Women Girls
Large Double Layer Satin Bow Hair Clip With Faux Artificial Pearl Rhinestone Elegant Korean Style Spring Clip For Women Girls
like
Find Similar
Blue satin double bow hair clip with pearl center worn on long brown hair back view - Spring Clips / Blue
Light green double satin bow hair clip with pearl detail shown on a model - Spring Clips / Fruit Green
Pink satin double layer bow hair clip with pearls and rhinestones shown on hair - Spring Clips / Lotus Pink
Elegant large double-layer black bow hair clip with oval pearl center in satin finish - Spring Clips / Black
+6
Large Double Layer Satin Bow Hair Clip With Faux Artificial Pearl Rhinestone Elegant Korean Style Spring Clip For Women Girls
-4%
$2.16
No MOQ
Free Shipping
Mini Acetate Sport Ball Hair Claw Clip For Women Girls Basketball Soccer Baseball Rugby Volleyball Pattern Hair Accessories
Mini Acetate Sport Ball Hair Claw Clip For Women Girls Basketball Soccer Baseball Rugby Volleyball Pattern Hair Accessories
like
Find Similar
Small acetate hair claw clip featuring a yellow and black soccer ball sports design - Yellow Football
Small soccer ball hair claw clip with black and white pattern for athletic hairstyles - Football
Mini orange basketball acetate hair claw clip for women with sporty texture design - Basketball
Small basketball pattern cellulose acetate hair claw with yellow marble finish for girls - Yellow Basketball
+6
Mini Acetate Sport Ball Hair Claw Clip For Women Girls Basketball Soccer Baseball Rugby Volleyball Pattern Hair Accessories
-4%
$0.82
No MOQ
Free Shipping
Kids Hair Clips Bow Lace Ribbon Faux Artificial Pearl Heart Wings Tassel Lolita Style Princess Hairpin Headwear For Girls
Kids Hair Clips Bow Lace Ribbon Faux Artificial Pearl Heart Wings Tassel Lolita Style Princess Hairpin Headwear For Girls
like
Find Similar
Detail of a large gradient lace bow hair clip with heart wings and pearl chain - Pearl Pink (A2943)
Close-up of light green bow hair clips with organza layers and white faux pearls - Green (1 Pair)
Detail of purple tulle bow hair clips for girls with centered pearl and handmade paper card - Purple (1 Pair)
Detailed view of handmade light yellow lace bow hair clip with faux pearl accents - Yellow (1 Pair)
+7
Kids Hair Clips Bow Lace Ribbon Faux Artificial Pearl Heart Wings Tassel Lolita Style Princess Hairpin Headwear For Girls
$0.52-1.31
No MOQ
 · 
24 views
Handmade Denim Fabric Rose Flower Brooch Hair Clip Versatile 3D Floral Decoration Large Small Denim Accessory For Women
Handmade Denim Fabric Rose Flower Brooch Hair Clip Versatile 3D Floral Decoration Large Small Denim Accessory For Women
like
Find Similar
Handmade 9cm navy denim rose brooch and hair clip with layered fabric flower petals - Dark Denim Blue
Close-up of blue denim fabric rose hair clip showing detailed textile texture and layers - Light Denim Blue
Elegant 9cm light blue denim fabric rose brooch and hair clip on a soft white plush surface - Large Brooch Hair Clip Dual Purpose / Light Denim Blue
Close-up of a 9cm dusty blue denim fabric rose hair clip with detailed layered petals - Large Brooch Hair Clip Dual Purpose / Blue Gray
+4
Handmade Denim Fabric Rose Flower Brooch Hair Clip Versatile 3D Floral Decoration Large Small Denim Accessory For Women
$0.37-0.58
Mix MOQ : 2
Free Shipping
Retro Snake Shape Braiding Hair Rings Alloy Metal Spiral Braid Clips Ethnic Hair Jewelry Accessory For Women Men
Retro Snake Shape Braiding Hair Rings Alloy Metal Spiral Braid Clips Ethnic Hair Jewelry Accessory For Women Men
like
Find Similar
Set of 10 vintage bronze snake spiral hair rings for dreadlocks and braided hairstyles - Bronze 10Pcs/Set
Retro golden snake-shaped hair ring jewelry with spiral vintage metal texture on white background - 1 Piece / Antique Gold
Retro snake spiral hair rings in gold and silver finish for dreadlocks hair styling - 9Pcs/Set / Antique Gold
Retro serpent ear cuff earring in polished silver metal finish with a spiral snake design - 1 Piece / Antique Silver
+5
Retro Snake Shape Braiding Hair Rings Alloy Metal Spiral Braid Clips Ethnic Hair Jewelry Accessory For Women Men
$0.04-0.43
Mix MOQ : 2
 · 
21 views
Angel Wing Hair Clips Plush Sweet Kawaii Side Duckbill Clips Hair Accessories For Girls
Angel Wing Hair Clips Plush Sweet Kawaii Side Duckbill Clips Hair Accessories For Girls
like
Find Similar
Cute white plush angel wing hair clips for girls displayed in a minimalist aesthetic tray - White Wing Hair Clip
Sweet pink plush angel wing hair clips for girls displayed in a ceramic tray - Pink Wing Hair Clip
Angel Wing Hair Clips Plush Sweet Kawaii Side Duckbill Clips Hair Accessories For Girls
$0.07
No MOQ
 · 
94 sold recently
Bow Hairnet Hair Clip Satin Ribbon With Rhinestone Flower Professional Bun Cover For Women Flight Attendant Nurse
Bow Hairnet Hair Clip Satin Ribbon With Rhinestone Flower Professional Bun Cover For Women Flight Attendant Nurse
like
Find Similar
Detailed view of navy satin bow hair clip with black net and elegant gold lace trim - Willow Leaf Lace Gold Edge Blue
Blue satin nurse hair clip with snood net, featuring a pearl and rhinestone floral bow - One Pearl Lace Gold Edge Blue
Navy blue satin bow hair net with gold trim and crystal flower for professionals - Willow Leaf Lace Gold Edge Blue - Fine Net
Navy blue satin hair bow with gold trim and pearl center on black crochet hair net - Pentagon Small Pearl Lace Gold Edge Blue
+17
Bow Hairnet Hair Clip Satin Ribbon With Rhinestone Flower Professional Bun Cover For Women Flight Attendant Nurse
$1.12
No MOQ
 · 
13 sold recently
Go to

More in accessories

Explore more in clips

clawsharkartificialshapehandmadedesigncolorswirepearl hairshark clips
stylealloyhairpinheartsolidlongtasselbangspartyplastic hair claw

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access