Everful

Wholesale candy boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Candy Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

Popular collections in candy boxes

All products in candy boxes

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Reversible Halloween Bucket Hat Polyester Pumpkin Skeleton Print Breathable Sunshade Unisex Retro Party Accessory Cap
Reversible Halloween Bucket Hat Polyester Pumpkin Skeleton Print Breathable Sunshade Unisex Retro Party Accessory Cap
like
Find Similar
Detailed view of Halloween bucket hat with pumpkin, bat, and ghost printed patterns - M (56-58cm) / White Print-Pumpkin Bat Reaper (1#)
Close-up of Halloween bucket hat with pumpkin monster, bat, and candy cane print details - M (56-58cm) / White Print-Witch Hat Pumpkin Candy (2#)
Close-up of white Halloween bucket hat with pumpkin, black cat, and ghost print patterns - M (56-58cm) / White Print-Black Cat Ghost Moon (3#)
Detailed pattern of Halloween pumpkin and ghost print on white cotton bucket hat - M (56-58cm) / White Print-Boo Cartoon Ghost (4#)
+5
Reversible Halloween Bucket Hat Polyester Pumpkin Skeleton Print Breathable Sunshade Unisex Retro Party Accessory Cap
$2.88
No MOQ
Christmas Knitted Beanie Hat Acrylic Warm Winter Pom Pom Santa Christmas Tree Embroidery For Men Women Holiday
Christmas Knitted Beanie Hat Acrylic Warm Winter Pom Pom Santa Christmas Tree Embroidery For Men Women Holiday
like
Find Similar
Detailed knit texture of a black winter hat featuring a plush pom-pom and Santa patch - Black Santa Claus
Detail of red Christmas knit beanie with pom-pom and Santa Claus embroidery patch - Santa Claus Red
Dark green Christmas knit beanie with a fluffy pom-pom and Santa Claus patch decoration - Army Green Santa Claus
Detail of black knit beanie featuring colorful Christmas tree embroidery and a fluffy pom-pom - Black Christmas Tree
+1
Christmas Knitted Beanie Hat Acrylic Warm Winter Pom Pom Santa Christmas Tree Embroidery For Men Women Holiday
$2.88
No MOQ
Christmas Embroidery Patches Iron On Santa Claus Snowman Reindeer DIY Clothing Decoration For Xmas Gift
Christmas Embroidery Patches Iron On Santa Claus Snowman Reindeer DIY Clothing Decoration For Xmas Gift
like
Find Similar
Detailed view of elf hat Christmas patch with size measurements 5.6cm by 6.3cm - Christmas Patch 1# (Elf Hat)
Detailed size view of Christmas ball embroidery patch with red bow and snowflake motif - Christmas Patch 10# (Snowflake Ornament)
Detailed embroidery of a Christmas bow with green pine needles and size measurements - Christmas Patch 19# (Bow with Pine)
Detail view of candy cane embroidery patch with green bow and dimensions shown - Christmas Patch 3# (Candy Cane)
+29
Christmas Embroidery Patches Iron On Santa Claus Snowman Reindeer DIY Clothing Decoration For Xmas Gift
$0.20-8.87
No MOQ
 · 
14 views
Free Shipping
Christmas Door Corner Decoration Wooden Santa Claus Elk L-Shaped Frame Ornament Festive Holiday Home Wall Decor
Christmas Door Corner Decoration Wooden Santa Claus Elk L-Shaped Frame Ornament Festive Holiday Home Wall Decor
like
Find Similar
Christmas wooden door corner decor with Santa and penguin, size 21x21cm and 0.5cm thick - Santa Claus & Penguin Style (Y24Y51183_Q)
Christmas wooden door corner decor featuring Christmas tree and gift box design 24x20cm - Christmas Tree & Gift Box Style (Y24Y51184_Q)
Christmas Santa and reindeer wooden door frame decor with HD printing detail - Santa Claus & Elk Style (Y24Y51185_Q)
Christmas Door Corner Decoration Wooden Santa Claus Elk L-Shaped Frame Ornament Festive Holiday Home Wall Decor
-4%
$2.33
Mix MOQ : 2
Christmas Enamel Brooches Alloy Pin Jewelry Santa Claus Snowman Reindeer Tree Gingerbread Party Holiday Decor Gift
Christmas Enamel Brooches Alloy Pin Jewelry Santa Claus Snowman Reindeer Tree Gingerbread Party Holiday Decor Gift
like
Find Similar
Cartoon tooth enamel pin with Christmas scarf and rhinestones for festive backpack decor - Christmas Tooth with Scarf (CZ2272-1)
Cartoon boy in Christmas tree costume enamel pin with sparkling rhinestones decoration - Boy in Christmas Tree Costume (CZ2272-2)
Christmas tooth enamel pin with a red Santa hat and sparkling rhinestone belt detail - Christmas Hat Tooth with Belt (CZ2272-3)
Cute gingerbread man Christmas brooch with red hat and sparkling rhinestones - Rhinestone Christmas Gingerbread Man (CZ2272-4)
+60
Christmas Enamel Brooches Alloy Pin Jewelry Santa Claus Snowman Reindeer Tree Gingerbread Party Holiday Decor Gift
-12%
$0.14-0.41
Mix MOQ : 2
 · 
10 sold recently
Free Shipping
Christmas Brooches Enamel Pins Alloy Rhinestone Santa Claus Reindeer Cat Tree Festive Holiday Jewelry Gifts For Women
Christmas Brooches Enamel Pins Alloy Rhinestone Santa Claus Reindeer Cat Tree Festive Holiday Jewelry Gifts For Women
like
Find Similar
Christmas enamel cat brooch with gray orange and white kittens wearing holiday hats - Three-Color Cat
Charming Christmas tree brooch with colorful rhinestones on a gold-plated alloy base - Gold Large Christmas Tree
Close-up of Santa Claus enamel brooch with gold trim for festive Christmas apparel - Santa Claus
Macro detail of Christmas glove brooches with silver snowflakes and white rhinestones - Christmas Gloves (Brown + White)
+5
Christmas Brooches Enamel Pins Alloy Rhinestone Santa Claus Reindeer Cat Tree Festive Holiday Jewelry Gifts For Women
-9%
$0.50-1.26
No MOQ
 · 
20 views
Free Shipping
Mini Artificial Christmas Pine Branch PVC Pine Needles Natural Pine Cone Red Gold Berries Desktop Ornament For Holiday Home Decor
Mini Artificial Christmas Pine Branch PVC Pine Needles Natural Pine Cone Red Gold Berries Desktop Ornament For Holiday Home Decor
like
Find Similar
Mini Christmas pine branch with red and champagne berries for festive desktop decoration - Red Candy Mini Christmas Tree
Mini Artificial Christmas Pine Branch PVC Pine Needles Natural Pine Cone Red Gold Berries Desktop Ornament For Holiday Home Decor
-4%
$0.96
Mix MOQ : 2
Christmas Snowman Reindeer Tree Silicone Molds 3D DIY Crafting Tools For Candle Soap Resin Making Holiday Home Decor
Christmas Snowman Reindeer Tree Silicone Molds 3D DIY Crafting Tools For Candle Soap Resin Making Holiday Home Decor
like
Find Similar
3D snowman silicone mold with red hat and green scarf for DIY scented candles - Snowman with Candy Cane
3D snowman silicone mold for DIY Christmas candles with finished snowman and dimensions - Snowman with Snowflake
White 4-cavity silicone mold featuring textured Christmas trees with heart and star patterns - 4-Hole Christmas Tree
+5
Christmas Snowman Reindeer Tree Silicone Molds 3D DIY Crafting Tools For Candle Soap Resin Making Holiday Home Decor
-5%
$1.37-2.74
Mix MOQ : 5
Valentine's Day DIY Diamond Painting Wind Chime Acrylic Rhinestone Hanging Pendant Handmade Heart Gnome Home Window Decor
Valentine's Day DIY Diamond Painting Wind Chime Acrylic Rhinestone Hanging Pendant Handmade Heart Gnome Home Window Decor
like
Find Similar
DIY Diamond Painting Wind Chime Kit with Gnome and Rose Heart Valentines Ornaments - Gnome Rose Dessert Style
Valentine DIY diamond painting wind chime kit with gnome pendants and red beads - Gnome Collection Style
DIY Valentine Diamond Painting Wind Chime Kit with heart LOVE motifs and pink crystal beads - LOVE Gnome Telephone Style
DIY Valentine's diamond painting wind chime kit with red heart gnome charms - Gnome Heart Bear Style
+24
Valentine's Day DIY Diamond Painting Wind Chime Acrylic Rhinestone Hanging Pendant Handmade Heart Gnome Home Window Decor
$4.90
Mix MOQ : 50
DIY Diamond Painting Wind Chime St Patrick's Day Shamrock Gnome Hanging Ornament Green Acrylic Rhinestone Bell Home Decor
DIY Diamond Painting Wind Chime St Patrick's Day Shamrock Gnome Hanging Ornament Green Acrylic Rhinestone Bell Home Decor
like
Find Similar
DIY St. Patrick's Day diamond painting wind chime kit with green clover and boot charms - Style 1-Boots Hat Shamrock
St. Patrick's Day DIY diamond painting wind chime kit with green clovers and bells - Style 2-Beer Money Bag Shamrock
DIY St. Patrick's Day diamond painting wind chime kit with green clover charms - Style 3-Assorted Shamrock Shapes
DIY St. Patrick's Day diamond painting wind chime kit with green lucky shamrock theme - Style 4-Lucky Letters Shamrock
+7
DIY Diamond Painting Wind Chime St Patrick's Day Shamrock Gnome Hanging Ornament Green Acrylic Rhinestone Bell Home Decor
$4.90
Mix MOQ : 50
Cartoon Ghost Enamel Pins Halloween Zinc Alloy Brooches Music Theme Ghost Badges For Clothing Bags Cool Trendy Gift
Cartoon Ghost Enamel Pins Halloween Zinc Alloy Brooches Music Theme Ghost Badges For Clothing Bags Cool Trendy Gift
like
Find Similar
Cute cartoon ghost enamel pin wearing headphones and holding a black vinyl record - Ghost with Headphones
Cute cartoon ghost enamel pin featuring a multimedia player interface design - Music Player Ghost
Gothic ghost enamel pin in black and white finish featuring a cute monster in a coffin - Ghost in the Box
Cute ghost enamel pin with "Don't be sad be rad" banner in white finish - Banner Ghost
+1
Cartoon Ghost Enamel Pins Halloween Zinc Alloy Brooches Music Theme Ghost Badges For Clothing Bags Cool Trendy Gift
-8%
$0.45
Mix MOQ : 2
 · 
44 sold recently
Free Shipping
Christmas Brooch Pin Alloy Enamel Rhinestone Santa Reindeer Tree Bell Snowman Festive Holiday Accessory For Women Men
Christmas Brooch Pin Alloy Enamel Rhinestone Santa Reindeer Tree Bell Snowman Festive Holiday Accessory For Women Men
like
Find Similar
Detail view of a skating Santa Claus brooch with red enamel, gold plating and crystals - Gold Santa Claus
Close-up of skating Santa brooch with red enamel and crystal on black leather - Silver Santa Claus
Detailed view of Christmas candy cane brooch with colorful enamel on dark leather - Gold Christmas Candy Cane
Macro detail of Christmas candy cane brooch with red and green enamel bow on black background - Silver Christmas Candy Cane
+20
Christmas Brooch Pin Alloy Enamel Rhinestone Santa Reindeer Tree Bell Snowman Festive Holiday Accessory For Women Men
-9%
$1.27
No MOQ
 · 
19 sold recently
Free Shipping
Christmas Brooches Pins Acrylic Resin Alloy Cartoon Santa Snowman Reindeer Festive Holiday Decoration Fashion Jewelry
Christmas Brooches Pins Acrylic Resin Alloy Cartoon Santa Snowman Reindeer Festive Holiday Decoration Fashion Jewelry
like
Find Similar
Detailed view of snowman and gift box acrylic Christmas brooches on white display cards - Snowman/Santa Hat/Gift Box 3-Piece Set
Detailed view of Christmas brooch set with gingerbread man, red mitten and festive tree - Gingerbread Man/Glove/Christmas Tree 3-Piece Set
Detail of Christmas stud earrings set featuring Santa Claus, Reindeer and Candy Cane on card - Santa/Reindeer/Candy Cane 3-Piece Set
Detail view of 4-piece resin Christmas brooch set with Santa, tree, star, and polar bear - Santa/Christmas Tree/Star/Polar Bear 4-Piece Set
+2
Christmas Brooches Pins Acrylic Resin Alloy Cartoon Santa Snowman Reindeer Festive Holiday Decoration Fashion Jewelry
-13%
$0.55-0.95
No MOQ
Free Shipping
Christmas Brooch Pin Alloy Enamel Rhinestone Santa Snowman Reindeer Tree Holiday Party Decoration Gift Jewelry For Women
Christmas Brooch Pin Alloy Enamel Rhinestone Santa Snowman Reindeer Tree Holiday Party Decoration Gift Jewelry For Women
like
Find Similar
Christmas tree brooch in gold finish with colorful crystals on red festive background - BR0036-Gemstone Christmas Tree
Christmas tree brooch in gold finish with green enamel and colorful rhinestones - BR0043-Green Christmas Tree 2
Christmas red gift box brooch with gold bow and rhinestones for dress accessory - BR0066-Red Gift Box
Christmas reindeer brooch with red enamel gold finish and a large white center pearl - BR0064-Pearl Reindeer
+31
Christmas Brooch Pin Alloy Enamel Rhinestone Santa Snowman Reindeer Tree Holiday Party Decoration Gift Jewelry For Women
-18%
$0.47-1.02
Mix MOQ : 10
 · 
12 sold recently
Free Shipping
Christmas Hair Ties With Cartoon Resin Santa And Reindeer Elastic Scrunchies Holiday Party Hair Accessories For Girls
Christmas Hair Ties With Cartoon Resin Santa And Reindeer Elastic Scrunchies Holiday Party Hair Accessories For Girls
like
Find Similar
Christmas snowman hair tie with red and green elastic bands for festive hair styling - 9# Bicolor Hair Tie - Christmas Snowman
Green Christmas tree elastic hair tie with red and green cord and snow texture - 2# Bicolor Hair Tie - Christmas Tree
Christmas hair tie set featuring red and green elastic bands with a brown reindeer charm - 10# Bicolor Hair Tie - Christmas Reindeer
Christmas hair tie with red and green elastic bands and a white snowflake stocking charm - 1# Bicolor Hair Tie - Christmas Boot
+6
Christmas Hair Ties With Cartoon Resin Santa And Reindeer Elastic Scrunchies Holiday Party Hair Accessories For Girls
-7%
$0.12
No MOQ
Christmas Headband Reindeer Antlers Plush Hairband Sequin Santa Hat Bow Party Hair Accessories Women Kids Decoration
Christmas Headband Reindeer Antlers Plush Hairband Sequin Santa Hat Bow Party Hair Accessories Women Kids Decoration
like
Find Similar
Christmas plush reindeer headband with red ears and green plaid bows holiday hair accessory - Red Sequin Reindeer Antlers
Christmas reindeer antler headband with beige plush fabric and red green plaid bow - Brown Antler Headband
Detail of Christmas headband with red glitter antlers, satin bow and white plush balls - Red Antler Bow Style
Detail of Christmas headband with gold glitter antlers, red bows, and soft white pom-poms - Gold Antlers Bow
+38
Christmas Headband Reindeer Antlers Plush Hairband Sequin Santa Hat Bow Party Hair Accessories Women Kids Decoration
$0.32-1.38
Mix MOQ : 2
Christmas Tree Tapestry Polyester Wall Hanging Holiday Decoration For Home Bedroom Living Room Festive Aesthetic
Christmas Tree Tapestry Polyester Wall Hanging Holiday Decoration For Home Bedroom Living Room Festive Aesthetic
like
Find Similar
Detail of Christmas tree tapestry with red ornaments and gift boxes on fabric - 73X95CM (Cross-border Brushed) / Realistic Xmas Tree-ZJ100559
Detail of Christmas tree tapestry with green branches, golden stars and colorful ornaments - 73X95CM (Cross-border Brushed) / Decorated Xmas Tree-ZJ100560
Detail of Bohemian Christmas tree tapestry with white star patterns for wall decor - 73X95CM (Cross-border Brushed) / Starlight Xmas Tree-ZJ100561
Detailed view of white Christmas tree tapestry with festive ornaments and red stockings - 73X95CM (Cross-border Brushed) / Gift Box Xmas Tree-ZJ100562
+116
Christmas Tree Tapestry Polyester Wall Hanging Holiday Decoration For Home Bedroom Living Room Festive Aesthetic
$2.80-22.19
No MOQ
Christmas Hair Clips Antler Reindeer Glitter Mesh Plush Ball Festive Party Hairpins Headwear For Girls Toddlers Kids
Christmas Hair Clips Antler Reindeer Glitter Mesh Plush Ball Festive Party Hairpins Headwear For Girls Toddlers Kids
like
Find Similar
Handmade Christmas penguin hair clip with sequins and a red hat for festive kids' hairstyling - Penguin
Christmas candy cane hair clip with green bow and golden bells for girls - Candy Cane
Christmas reindeer hair clip with Mickey sequins, fuzzy pom poms and a green bow - Pompom Cartoon Round Ears
Christmas reindeer hair clip with red base, gold antlers, and white pom-poms for girls - Transparent Hat with Antlers
+3
Christmas Hair Clips Antler Reindeer Glitter Mesh Plush Ball Festive Party Hairpins Headwear For Girls Toddlers Kids
-5%
$0.71-1.15
Mix MOQ : 2
Free Shipping
Christmas Bathroom Decor Waterproof Polyester Shower Curtain Flannel Rug Toilet Lid Cover Santa Snowman Red Truck
Christmas Bathroom Decor Waterproof Polyester Shower Curtain Flannel Rug Toilet Lid Cover Santa Snowman Red Truck
like
Find Similar
Christmas 4-piece bathroom set with Santa shower curtain and matching floor mats - 3-Piece Bath Mat Set / Christmas Red Truck & Golden Retriever Puppies
Christmas winter snow mountain window view 4-piece bathroom shower curtain set - 3-Piece Bath Mat Set / Winter Snow Mountain Window View
Christmas bathroom set including snowman shower curtain, toilet cover, and matching floor mats - 3-Piece Bath Mat Set / Winter Snowman & Forest Cabin
Detail showing 4-piece Christmas bathroom set with Santa pattern, rug and shower curtain - 3-Piece Bath Mat Set / Christmas Red Santa & Snowman
+45
Christmas Bathroom Decor Waterproof Polyester Shower Curtain Flannel Rug Toilet Lid Cover Santa Snowman Red Truck
-4%
$6.17-13.16
No MOQ
Christmas Hair Claw Clips Acrylic Glitter Santa Snowman Tree Snowflake Festive Hair Clamp For Women Girls
Christmas Hair Claw Clips Acrylic Glitter Santa Snowman Tree Snowflake Festive Hair Clamp For Women Girls
like
Find Similar
Festive green Christmas boot hair claw clip with reindeer pattern and sequins - Christmas Boot
Christmas snowman hair claw clip with red hats and glittery silver sequins for winter holidays - Double Snowmen
Sparkly gift box hair claw clip with red and green glitter finish for Christmas holidays - Christmas Gift Box
Sparkly Santa Claus hair claw clip with colorful glitter for Christmas festive hair styling - Santa Face Circle
+5
Christmas Hair Claw Clips Acrylic Glitter Santa Snowman Tree Snowflake Festive Hair Clamp For Women Girls
$0.93
Mix MOQ : 2
Christmas Floor Mat Flannel Polyester Non Slip Absorbent Entrance Rug Kitchen Living Room Festive Snowflake Design
Christmas Floor Mat Flannel Polyester Non Slip Absorbent Entrance Rug Kitchen Living Room Festive Snowflake Design
like
Find Similar
Christmas flannel absorbent floor mat with festive pine branches and red berries design - 40x60cm / Green Pine Branches & Bells
Christmas flannel absorbent door mat with 3D snowflakes and pine branch on wood floor - 40x60cm / Blue Snowflake Gift Box
Christmas flannel absorbent door mat with vintage lantern and snowy pine branch design - 40x60cm / Winter Retro Lantern
Happy New Year festive flannel floor mat with pine needles and golden stars decor - 40x60cm / White Happy New Year
+21
NewChristmas Floor Mat Flannel Polyester Non Slip Absorbent Entrance Rug Kitchen Living Room Festive Snowflake Design
$3.46-10.95
No MOQ
Christmas Tapestry Wall Hanging Polyester Fabric Fireplace Christmas Tree Pattern Holiday Home Dorm Decor Backdrop
Christmas Tapestry Wall Hanging Polyester Fabric Fireplace Christmas Tree Pattern Holiday Home Dorm Decor Backdrop
like
Find Similar
Christmas wall tapestry with Santa, snowman and Christmas tree for room decor - 150x130cm / Style 1-Blue Starry Night Santa
Christmas tapestry featuring a grand library with festive tree and vintage bookcases - 150x130cm / Style 2-Vintage Library Christmas Tree
Detail of Christmas tapestry showing a warm fireplace, lit tree, and holiday decor - 150x130cm / Style 3-Cozy Indoor Fireplace Rocking Chair
Christmas tree and fireplace wall tapestry with Merry Christmas text for home decor - 150x130cm / Style 4-Modern Blue Background Christmas Tree
+59
Christmas Tapestry Wall Hanging Polyester Fabric Fireplace Christmas Tree Pattern Holiday Home Dorm Decor Backdrop
$2.59-11.53
No MOQ
Christmas Tapestry Wall Hanging Fireplace Scene Polyester Fabric Festive Holiday Backdrop Living Room Bedroom Cozy Home Decoration
Christmas Tapestry Wall Hanging Fireplace Scene Polyester Fabric Festive Holiday Backdrop Living Room Bedroom Cozy Home Decoration
like
Find Similar
Detail of Christmas tapestry showing a fireplace scene and Merry Christmas text - 150x130cm / Fireplace Glow Scene(1)
Christmas fireplace wall tapestry with stockings and tree for holiday home decoration - 150x130cm / White Wood Wall Fireplace(2)
Christmas tapestry featuring a festive fireplace scene and decorated holiday tree - 150x130cm / Christmas Tree and Sofa Scene(3)
Close-up of festive Christmas fireplace tapestry with holiday stockings on wall - 150x130cm / Grey Concrete Wall Fireplace(4)
+36
Christmas Tapestry Wall Hanging Fireplace Scene Polyester Fabric Festive Holiday Backdrop Living Room Bedroom Cozy Home Decoration
$2.59-10.95
No MOQ
Christmas Tapestry Polyester Winter Snow Gingerbread House Wall Hanging Bedroom Dorm Festive Decoration Cartoon
Christmas Tapestry Polyester Winter Snow Gingerbread House Wall Hanging Bedroom Dorm Festive Decoration Cartoon
like
Find Similar
Merry Christmas tapestry with pine branches and red ornaments on white brick wall - 150x130cm / Forest Snow Pine(Style 1)
Christmas tapestry featuring gingerbread house and candy patterns for wall decoration - 150x130cm / Warm Brown Gingerbread House(Style 2)
Christmas wall tapestry featuring a gingerbread house with snow and candy cane details - 150x130cm / Colorful Candy House(Style 3)
Christmas wall tapestry featuring a cozy gingerbread house and snowy trees for room decor - 150x130cm / Bokeh Light House(Style 4)
+44
Christmas Tapestry Polyester Winter Snow Gingerbread House Wall Hanging Bedroom Dorm Festive Decoration Cartoon
-5%
$2.46-10.40
No MOQ
Christmas Tapestry Wall Hanging Polyester Fabric Backdrop Vintage Winter Snow Scene For Room Decor Festive Holiday Ornament
Christmas Tapestry Wall Hanging Polyester Fabric Backdrop Vintage Winter Snow Scene For Room Decor Festive Holiday Ornament
like
Find Similar
Detailed Christmas tapestry wall hanging featuring snow steps, candy canes and red flowers - 150x130cm / Christmas Stairs & Candy (Style 1)
Christmas tapestry with vintage clock, pine needles and red berries for wall decor - 150x130cm / Vintage Winter Clock (Style 2)
Christmas wall tapestry with pine branches and red berries over white wood background - 150x130cm / White Wood Grain Pine (Style 3)
Winter night forest landscape tapestry with snow pinecones and moon over sofa decor - 150x130cm / Winter Night Moon (Style 4)
+44
Christmas Tapestry Wall Hanging Polyester Fabric Backdrop Vintage Winter Snow Scene For Room Decor Festive Holiday Ornament
-5%
$2.46-10.40
No MOQ
Christmas Starry Night Tarot Tapestry Wall Hanging Polyester Fabric Home Decor Aesthetic Bedroom Living Room Background
Christmas Starry Night Tarot Tapestry Wall Hanging Polyester Fabric Home Decor Aesthetic Bedroom Living Room Background
like
Find Similar
Detail of starry night tapestry hanging over a wooden desk with a warm glowing lamp - 150x130cm / Golden Starry Sky
Christmas wall tapestry with gift boxes and holly leaves for dormitory holiday decoration - 150x130cm / Christmas White Wood
Detail of Christmas tapestry featuring festive dinnerware, pine cones and warm fairy lights - 150x130cm / Christmas Feast Table
Polyester hanging tapestry featuring golden star patterns and white bokeh on black background - 150x130cm / Black All-over Stars
+31
Christmas Starry Night Tarot Tapestry Wall Hanging Polyester Fabric Home Decor Aesthetic Bedroom Living Room Background
$2.59-9.80
No MOQ
Glitter Christmas Hair Claw Clips Acrylic Santa Claus Tree Bell Festive Party Hair Accessories For Women
Glitter Christmas Hair Claw Clips Acrylic Santa Claus Tree Bell Festive Party Hair Accessories For Women
like
Find Similar
Glittery Merry Xmas letter hair claw clip in festive red and green colors - Merry Xmas Letters Hair Claw
Close-up of a festive Santa Claus hair claw clip with red hat and glittery details - Santa Claus Hair Claw
Festive Christmas hair claw clip with golden sequined bells and green holly leaf design - Christmas Bells Hair Claw
Sparkly silver Christmas gift box hair claw clip with a red bow and snowflake details - Christmas Gift Box Hair Claw
Glitter Christmas Hair Claw Clips Acrylic Santa Claus Tree Bell Festive Party Hair Accessories For Women
$1.06
No MOQ
 · 
13 sold recently
Christmas Antler Hair Clips Reindeer Ears Flocking Alloy Fabric Pom Pom Berries Santa Holiday Party Dress Up Women Girls
Christmas Antler Hair Clips Reindeer Ears Flocking Alloy Fabric Pom Pom Berries Santa Holiday Party Dress Up Women Girls
like
Find Similar
Pair of red flocked reindeer antler hair clips with handmade festive holiday styling - 1# Red Antler Pair Clips
Brown plush reindeer antler hair clips handmade for Christmas festive hair styling - 2# Brown Antler Pair Clips
Brown reindeer antler hair clips with red mushroom accents for Christmas hair styling - 3# Christmas Antler Hair Clip
Brown reindeer antler hair clips with white plush balls and fabric ears for Christmas - 5# Christmas Brown Antler Pom Pom Pair Clips
+53
Christmas Antler Hair Clips Reindeer Ears Flocking Alloy Fabric Pom Pom Berries Santa Holiday Party Dress Up Women Girls
-6%
$0.27-1.59
Mix MOQ : 2
 · 
11 sold recently
Free Shipping
Halloween Witch Hat Headband For Women Kids Cosplay Party Mini Hat Spider Web Pumpkin Skull Mesh Ribbon Hair Accessory
Halloween Witch Hat Headband For Women Kids Cosplay Party Mini Hat Spider Web Pumpkin Skull Mesh Ribbon Hair Accessory
like
Find Similar
Detailed view of Halloween witch hat headband with orange pumpkin patterns and mesh - Orange Pumpkin Bat and Candy Style
Macro view of a black Halloween witch hat headband with gold cat and star foil prints - Black and Gold Cat Style
Close-up of Halloween witch hat headband with orange fabric, mesh veil and black bow detail - Orange Blue Bat and Star Style
Close-up of the Halloween witch hat headband featuring a vibrant spider web pattern and bow. - Orange Colorful Spider Web Style
+16
Halloween Witch Hat Headband For Women Kids Cosplay Party Mini Hat Spider Web Pumpkin Skull Mesh Ribbon Hair Accessory
$0.66
Mix MOQ : 2
 · 
234 sold recently
Christmas Plush Hair Ties Cartoon Santa Reindeer Christmas Tree Gingerbread Man Braided Rope With Bells Holiday Headwear
Christmas Plush Hair Ties Cartoon Santa Reindeer Christmas Tree Gingerbread Man Braided Rope With Bells Holiday Headwear
like
Find Similar
Detail of Christmas reindeer scrunchie with plush elk head and festive jingle bells - Reindeer Antlers
Detail of a festive Christmas scrunchie with red and green bells and plush snowflake charm - Candy
Detail of plush Santa Claus hair scrunchie with red and green woven rope and small bells - Santa Claus
Close-up of plush green Christmas tree scrunchie with Merry Christmas embroidery - Christmas Tree
+2
Christmas Plush Hair Ties Cartoon Santa Reindeer Christmas Tree Gingerbread Man Braided Rope With Bells Holiday Headwear
-9%
$0.58-0.68
No MOQ
 · 
10 views
Christmas Hair Clips Glitter Reindeer Santa Bow Ribbon Duckbill Edge Clips Cute Holiday Party Girls Kids Accessories
Christmas Hair Clips Glitter Reindeer Santa Bow Ribbon Duckbill Edge Clips Cute Holiday Party Girls Kids Accessories
like
Find Similar
Detail of Christmas reindeer bow hair clip with green snowflake ribbon and glitter accent - Green Reindeer Snowflake (1)
Christmas green glitter bow hair clip with snowflake and candy pattern prints - Green Polka Dot Candy (2)
Green ribbon Christmas hair clip with Santa Claus glitter bow for little girls - Dark Green Santa
Detail of Christmas reindeer bow hair clip with Merry Christmas print and glitter deer - Dark Green Gold Deer Print
+3
Christmas Hair Clips Glitter Reindeer Santa Bow Ribbon Duckbill Edge Clips Cute Holiday Party Girls Kids Accessories
-5%
$0.35-0.49
Mix MOQ : 10
 · 
10 sold recently
Mini Crown Tiara Alloy Rhinestone Faux Artificial Pearl Hair Accessory Princess Birthday Party Decoration Cake Topper Ornament
Mini Crown Tiara Alloy Rhinestone Faux Artificial Pearl Hair Accessory Princess Birthday Party Decoration Cake Topper Ornament
like
Find Similar
Detailed view of a gold alloy mini crown with pearls and crystals measuring 7.5cm - Small Round Gold 01
Exquisite gold mini alloy crown featuring sparkling rhinestones and embossed dot texture - 6-Diamond Finger Small Gold 01
Detail showing gold alloy mini crown with 3.6cm height, 3.2cm base and crystal rhinestones - Noble Small Crown Gold 01
Mini gold crown cake topper with sparkling rhinestones, size 3.2cm high and 3.1cm wide - Heart Finger Small Gold 01
+44
Mini Crown Tiara Alloy Rhinestone Faux Artificial Pearl Hair Accessory Princess Birthday Party Decoration Cake Topper Ornament
$0.36-1.67
No MOQ
 · 
660 sold recently
Free Shipping
Led Light Up Christmas Knitted Beanie Hat Acrylic Colorful Glowing Cartoon Jacquard Pom Pom Winter Party Accessory
Led Light Up Christmas Knitted Beanie Hat Acrylic Colorful Glowing Cartoon Jacquard Pom Pom Winter Party Accessory
like
Find Similar
LED Christmas knit hat with red and white stripes and glowing green Xmas tree pattern - Christmas Tree Short Hat
LED Christmas knit hat with gingerbread man pattern and power switch feature - Dwarf Gnome Short Hat
Detail of Christmas knitted hat with LED lights featuring reindeer patterns and DEER ME text - Emerald Green Cute
LED Christmas knitted hat with festive Christmas tree pattern and red pompom - 3 Christmas Trees
+34
Led Light Up Christmas Knitted Beanie Hat Acrylic Colorful Glowing Cartoon Jacquard Pom Pom Winter Party Accessory
$2.36
No MOQ
 · 
59 sold recently
Christmas Earrings Alloy Acrylic Zircon Faux Artificial Pearl Snowflake Tree Santa Holiday Jewelry With Silver Earring Post
Christmas Earrings Alloy Acrylic Zircon Faux Artificial Pearl Snowflake Tree Santa Holiday Jewelry With Silver Earring Post
like
Find Similar
Detailed view of Christmas tree earrings with green stones and hanging white pearls - 1# Silver Earring Post - Green - Christmas Tree
Close-up of Christmas tree stud earrings with zircon and pearls on woman's ear - 3# Silver Earring Post - Gold (Real Gold Plated) Christmas Tree
Detailed view of silver Christmas tree earrings with colorful cubic zirconia on foam - 8# Silver Earring Post-Silver-Multicolor Zircon Christmas Tree
Macro shot of festive red bow earrings with plush pom-poms and gold snowflake charms - 10# Silver Needle-Gold-Red Bow Snowflake Pom Pom Short Style
+26
Christmas Earrings Alloy Acrylic Zircon Faux Artificial Pearl Snowflake Tree Santa Holiday Jewelry With Silver Earring Post
$0.65-4.77
No MOQ
Free Shipping
Christmas Hanging Paper Star Snowflake Ornaments 3D Laser Cut Hollow Foldable For Holiday Party Window Display Decor
Christmas Hanging Paper Star Snowflake Ornaments 3D Laser Cut Hollow Foldable For Holiday Party Window Display Decor
like
Find Similar
White 3D hollow paper snowflake ornament for Christmas tree decoration, 25cm size - 25cm White 3D Snowflake
3D white hollow paper snowflake ornament 30cm for Christmas tree and party decor - 30cm White 3D Snowflake
30cm cream white 3D paper star ornament with laser-cut patterns for Christmas tree - 30cm White 3D Multi-pointed Star
White 40cm 3D paper star snowflake pendant with hollow geometric patterns and hanging rope - 40cm White 3D Multi-Point Star
+6
Christmas Hanging Paper Star Snowflake Ornaments 3D Laser Cut Hollow Foldable For Holiday Party Window Display Decor
$3.34-4.84
Mix MOQ : 2
Free Shipping
3D Hollow Paper Star Snowflake Hanging Ornaments Nordic Minimalist Christmas Party Home Window Ceiling Decor
3D Hollow Paper Star Snowflake Hanging Ornaments Nordic Minimalist Christmas Party Home Window Ceiling Decor
like
Find Similar
White 3D hollow paper snowflake ornament for Christmas tree decoration, 25cm size - 25cm White 3D Snowflake
3D white hollow paper snowflake ornament 30cm for Christmas tree and party decor - 30cm White 3D Snowflake
30cm cream white 3D paper star ornament with laser-cut patterns for Christmas tree - 30cm White 3D Multi-pointed Star
White 40cm 3D paper star snowflake pendant with hollow geometric patterns and hanging rope - 40cm White 3D Multi-Point Star
+6
3D Hollow Paper Star Snowflake Hanging Ornaments Nordic Minimalist Christmas Party Home Window Ceiling Decor
$3.34-4.84
Mix MOQ : 2
Free Shipping
Christmas Miniature Resin Ornaments Santa Claus Snowman Train Tree Micro Landscape Desktop Decor Festive Figurine Accessory
Christmas Miniature Resin Ornaments Santa Claus Snowman Train Tree Micro Landscape Desktop Decor Festive Figurine Accessory
like
Find Similar
Miniature Santa Claus resin figurine in red and white colors measuring 3.7cm x 2.7cm - Santa Claus No. 7
Miniature Christmas Santa Claus resin figurine standing in snow, size 3.3cm by 2cm - Santa Claus No. 8
Miniature Santa Claus resin figurine for Christmas decor measuring 3cm by 2.2cm - Santa Claus No. 9
Miniature sleeping Santa Claus figurine in red suit on white snow scene, 3.7x2.4cm size - Santa Claus No. 10
+19
Christmas Miniature Resin Ornaments Santa Claus Snowman Train Tree Micro Landscape Desktop Decor Festive Figurine Accessory
$0.09-0.46
Mix MOQ : 3
 · 
20 sold recently
Christmas Wreath Window Sticker PVC Static Cling Pine Needle Berry Glass Decal Xmas Home Decoration Reusable Waterproof
Christmas Wreath Window Sticker PVC Static Cling Pine Needle Berry Glass Decal Xmas Home Decoration Reusable Waterproof
like
Find Similar
Detailed view showing dimensions for Christmas wreath wall sticker with pine and berries - Red Ball Pine Needle Wreath Style(JDT-X31)
Size chart showing dimensions for Christmas wreath wall sticker measured in inches and cm - Pine Needle Red Ball Pine Cone Wreath Style(JDT-X32)
Detailed size guide for Christmas wreath wall sticker with layout and finish dimensions - Ribbon Candy Wreath Style(JDT-X33)
Detailed size specifications for Christmas wreath wall sticker showing before and after dimensions - Pine Cone Bow Wreath Style(JDT-X35)
Christmas Wreath Window Sticker PVC Static Cling Pine Needle Berry Glass Decal Xmas Home Decoration Reusable Waterproof
$1.01
No MOQ
Christmas Dog Window Clings Double Sided Static Stickers Cartoon Puppy Santa Hat Snowflake Holiday Glass Decor Novelty
Christmas Dog Window Clings Double Sided Static Stickers Cartoon Puppy Santa Hat Snowflake Holiday Glass Decor Novelty
like
Find Similar
Christmas window sticker size chart featuring dog gingerbread house and holiday tree - White Dog with Gingerbread House Style (BQ618)
Golden retriever Christmas window sticker set with product dimensions in centimeters - Golden Retriever with Christmas Sign Style (BQ619)
Christmas Golden Retriever window decal size guide with gift box and snowflake dimensions - Golden Retriever with Gift Box Style (BQ620)
Size chart for Christmas dachshund stickers and decorative holiday window decals - Dachshund with Christmas Tree Style (BQ621)
+17
Christmas Dog Window Clings Double Sided Static Stickers Cartoon Puppy Santa Hat Snowflake Holiday Glass Decor Novelty
$0.26-2.42
Mix MOQ : 2
Christmas Candle Holder Golden Iron Metal Hollow Star Tree Deer Desktop Ornament Pine Needle Berry Pine Cone Decor
Christmas Candle Holder Golden Iron Metal Hollow Star Tree Deer Desktop Ornament Pine Needle Berry Pine Cone Decor
like
Find Similar
Christmas gold iron double candle holder with stars berries and pine cones decor - Double-head Star / Without Candle
Golden reindeer iron double candle holder with festive pine needles and red berries decor - Double-head Reindeer / Without Candle
Golden iron snowflake candle holder with pine cones and red berries decorations - Gold Snowflake / Without Candle
Golden star iron candle holder with pine cones and red berries for Christmas decor - Gold Five-pointed Star / Without Candle
+9
Christmas Candle Holder Golden Iron Metal Hollow Star Tree Deer Desktop Ornament Pine Needle Berry Pine Cone Decor
$1.61-2.19
No MOQ
Christmas Desktop Ornaments Santa Snowman Bear Gnome Foam Cement Figurines With Artificial Pine Berries For Holiday Home Decor
Christmas Desktop Ornaments Santa Snowman Bear Gnome Foam Cement Figurines With Artificial Pine Berries For Holiday Home Decor
like
Find Similar
Christmas gnome resin ornament with red hat and berry branches, size 16x6cm, weight 250g - 3D Faceless Gnome
Santa resin ornament with pine needles and red berries, 16cm height, weight 267g - 3D Santa Claus
Christmas snowman resin ornament with pine needles and red berries, 16cm height decoration - 3D Snowman
Christmas bear figurine with red hat and green scarf holding red berry branches 16cm - 3D Bear
+1
Christmas Desktop Ornaments Santa Snowman Bear Gnome Foam Cement Figurines With Artificial Pine Berries For Holiday Home Decor
-5%
$4.27
No MOQ
Mini Christmas Tree Ornament Handmade Crochet Knitted Yarn Tabletop Decor Wooden Base Festive Gift
Mini Christmas Tree Ornament Handmade Crochet Knitted Yarn Tabletop Decor Wooden Base Festive Gift
like
Find Similar
Handmade pink crochet mini Christmas tree on wooden base with festive decorations - Handmade Crochet Finished Product / Pink
Miniature handmade crochet Christmas tree with colorful pom-poms and wood base - Handmade Crochet Finished Product / Green
Handmade purple crochet Christmas tree tabletop decoration with star and ornaments - Handmade Crochet Finished Product / Purple
Miniature blue gradient crochet Christmas tree with star topper and festive balls, 21cm high - Handmade Crochet Finished Product / Blue
+8
Mini Christmas Tree Ornament Handmade Crochet Knitted Yarn Tabletop Decor Wooden Base Festive Gift
$10.09-12.10
No MOQ
Christmas Window Clings Static PVC Double Sided Snowflake Reindeer Snowman Decals For Glass Winter Party Home Decor
Christmas Window Clings Static PVC Double Sided Snowflake Reindeer Snowman Decals For Glass Winter Party Home Decor
like
Find Similar
Blue snowman and candle static Christmas window stickers with snowflake decals - BQ532 Snowman & Candle
Blue Christmas window clings set with size chart for Santa Claus and snowflake stickers - BQ533 Santa & Gift Box
Blue Christmas snowman window sticker set dimensions 20x30cm for festive decoration - BQ534 Snowman & Gnome
Size chart for blue Christmas static window stickers with tree and snowflake dimensions - BQ535 Christmas Tree & Birds
+23
Christmas Window Clings Static PVC Double Sided Snowflake Reindeer Snowman Decals For Glass Winter Party Home Decor
$0.26-2.42
Mix MOQ : 2
Plush Christmas Tree Hanging Ornament Layered Knit Ball Desktop Decor Star Top Beaded Chain Festive Atmosphere Pendant
Plush Christmas Tree Hanging Ornament Layered Knit Ball Desktop Decor Star Top Beaded Chain Festive Atmosphere Pendant
like
Find Similar
Colorful plush Christmas tree ornament with gold star and CHANGE silk ribbon, 28cm height - Charm / Snow Top Coffee
Pink and green plush Christmas tree ornament with silver star and Change ribbon strap - Charm / Cranberry Pink
Pink and red gradient plush ball Christmas tree hanging decoration with wood base - Charm / Cranberry Red
Three-layer green and white plush Christmas tree hanging ornament with star topper and ribbon - Charm / Cranberry White
+10
Plush Christmas Tree Hanging Ornament Layered Knit Ball Desktop Decor Star Top Beaded Chain Festive Atmosphere Pendant
$5.62-6.20
No MOQ
Christmas Window Stickers Static Cling PVC Reindeer Snowman Santa Claus Snowflakes Holiday Glass Decals For Decoration
Christmas Window Stickers Static Cling PVC Reindeer Snowman Santa Claus Snowflakes Holiday Glass Decals For Decoration
like
Find Similar
Gingerbread man and reindeer Christmas window static stickers for glass decor - 2-Pack Set Gingerbread Man & Reindeer Sock (BQ481+483)
Christmas window stickers featuring Santa, snowman, and reindeer for holiday decoration - 2-Pack Set Santa Claus & Snowman (BQ482+486)
Christmas window decals set with Santa, snowman and snowflake static stickers - 2-Pack Set Peeking Santa & Snowman Penguin (BQ484+487)
Gingerbread man and Santa Claus static window stickers for Christmas home party decor - 2-Pack Set Snow House & Merry Christmas (BQ488+491)
+20
Christmas Window Stickers Static Cling PVC Reindeer Snowman Santa Claus Snowflakes Holiday Glass Decals For Decoration
$0.26-2.42
Mix MOQ : 2
Red Flocked Christmas Ornaments Velvet Reindeer Snowflake Bow Tree Hanging Decoration Luxury Festive Holiday Decor
Red Flocked Christmas Ornaments Velvet Reindeer Snowflake Bow Tree Hanging Decoration Luxury Festive Holiday Decor
like
Find Similar
Red flocked snowflake Christmas ornament with gold beads for festive tree decoration - Red Flocked Snowflake
Red flocked Christmas carriage ornament with golden glitter and unicorn detail - Red Flocked Unicorn Carriage
Red flocked Christmas bow ornament with gold glitter edges and a matching silk hanging ribbon - Red Flocked Bow
Red flocked reindeer Christmas ornament with gold glitter details and hanging ribbon - Red Flocked Walking Reindeer
+19
Red Flocked Christmas Ornaments Velvet Reindeer Snowflake Bow Tree Hanging Decoration Luxury Festive Holiday Decor
$1.10-2.07
No MOQ
Christmas Microfiber Kitchen Towels Super Soft Absorbent Dish Cloths Holiday Decor Santa Snowman Tree Pattern Festive
Christmas Microfiber Kitchen Towels Super Soft Absorbent Dish Cloths Holiday Decor Santa Snowman Tree Pattern Festive
like
Find Similar
Red plaid Christmas kitchen towels with Merry Christmas text and snowy tree print - Red Christmas Tree (2pcs)
Christmas kitchen towels with gingerbread man and train prints hanging in kitchen - Gingerbread Man & Train White (2pcs)
Gingerbread and candy pattern kitchen towels set for Christmas festive home decor - Gingerbread & Candy White (2pcs)
Set of two red Merry Christmas kitchen towels with golden star patterns and text - Gold Merry Christmas Text Red (2pcs)
+8
Christmas Microfiber Kitchen Towels Super Soft Absorbent Dish Cloths Holiday Decor Santa Snowman Tree Pattern Festive
$1.99
Mix MOQ : 2
 · 
10 views
Christmas Table Runner Polyester Linen Texture Holiday Festive Kitchen Dining Room Table Decor Xmas Patterns
Christmas Table Runner Polyester Linen Texture Holiday Festive Kitchen Dining Room Table Decor Xmas Patterns
like
Find Similar
Christmas table runner featuring Merry Christmas print with classic black and white plaid borders - ZQ036-1 (Black and White Plaid Xmas Tree)
Pink striped Merry Christmas table runner with festive holiday tree prints on wood - ZQ036-2 (Pink Christmas Tree)
Christmas table runner with gingerbread house and Noel print on beige linen texture - ZQ036-3 (Gingerbread Man and Noel)
Christmas table runner with green trees and golden bows on cotton linen fabric - ZQ036-4 (Classic Red Berry Xmas Tree)
+5
Christmas Table Runner Polyester Linen Texture Holiday Festive Kitchen Dining Room Table Decor Xmas Patterns
$3.03
Mix MOQ : 2
Christmas Penguin Plush Ornaments Knitted Hat Scarf LED Glowing Telescopic Legs Holiday Home Party Decoration
Christmas Penguin Plush Ornaments Knitted Hat Scarf LED Glowing Telescopic Legs Holiday Home Party Decoration
like
Find Similar
Detail of Christmas penguin plush with red knitted hat and plaid scarf in festive setting - Red Hat Telescopic Penguin
Close-up of a Christmas penguin doll with knitted hat and red plaid skirt by a festive tree - Grey Hat Telescopic Penguin
Detail of Christmas penguin candy jar with red knitted hat and transparent container - Red Hat Penguin Candy Jar
Detailed view of Christmas penguin candy jar with red knit hat on a festive background - Grey Hat Penguin Candy Jar
+8
Christmas Penguin Plush Ornaments Knitted Hat Scarf LED Glowing Telescopic Legs Holiday Home Party Decoration
$2.02-6.92
No MOQ
Nutcracker Soldier Ornaments Colorful Resin Christmas Tree Hanging Decorations Desktop Statues European Style Festive Home Decor
Nutcracker Soldier Ornaments Colorful Resin Christmas Tree Hanging Decorations Desktop Statues European Style Festive Home Decor
like
Find Similar
Pink Christmas Nutcracker soldier pendant holding accordion made of resin 11cm height - Pink Nutcracker Soldier
White and gold nutcracker soldier ornament with axe, 10.5cm Christmas tree decoration - White Gold Nutcracker Soldier
Golden resin Nutcracker drummer hanging ornament for Christmas tree decor, 11cm height - Champagne Resin Nutcracker
Christmas nutcracker soldier ornament with red uniform and mini tree, 10.5cm tall - Black Hat Nutcracker Soldier
+1
Nutcracker Soldier Ornaments Colorful Resin Christmas Tree Hanging Decorations Desktop Statues European Style Festive Home Decor
$2.25
No MOQ
Wool Felt Christmas Ball Ornaments Handmade Hanging Decorations With Snowflake Tree Stocking Patterns Holiday Decor
Wool Felt Christmas Ball Ornaments Handmade Hanging Decorations With Snowflake Tree Stocking Patterns Holiday Decor
like
Find Similar
Set of 4 handmade felt Christmas balls with candy cane patterns in a craft box - Candy Cane Style
Handmade wool felt Christmas balls set with tree and sock patterns in a craft box - Christmas Tree & Sock Style
Handmade wool felt Christmas balls set with leaf patterns in a kraft paper gift box - Christmas Leaf Style
Set of 4 handmade wool felt Christmas balls with snowflake embroidery in 5cm diameter - Snowflake Style
+2
Wool Felt Christmas Ball Ornaments Handmade Hanging Decorations With Snowflake Tree Stocking Patterns Holiday Decor
$3.98-6.57
No MOQ
Christmas Wreath Artificial PE Pine Needle With Pine Cones Berries Ornaments LED Lights Front Door Hanging Festive Decor
Christmas Wreath Artificial PE Pine Needle With Pine Cones Berries Ornaments LED Lights Front Door Hanging Festive Decor
like
Find Similar
45cm Christmas wreath variant with red and gold ornaments and red velvet ribbon - 45CM Gold Red Flower Pine Needle (No Light)
45cm Christmas wreath with pine cones, blue and gold ornaments, and velvet bows - 45CM PE Leaf Gold Series (No Light)
45cm Christmas wreath with pine cones and pink ornaments with brown velvet bow - 45CM Rose Pink Flocked Pinecone (No Light)
50cm Christmas wreath with snow pine needles, gold ornaments, and warm LED lights - 50CM American Flocking Snow (With Light String)
+1
Christmas Wreath Artificial PE Pine Needle With Pine Cones Berries Ornaments LED Lights Front Door Hanging Festive Decor
$31.12-39.77
No MOQ
Christmas Garland Pre-lit Warm White LED Lights PE Frosted Pine Needles Natural Pine Cones Ribbon Mantel Staircase Party Decor
Christmas Garland Pre-lit Warm White LED Lights PE Frosted Pine Needles Natural Pine Cones Ribbon Mantel Staircase Party Decor
like
Find Similar
1.35m Christmas garland with pine needles, red gold baubles and velvet bows - 135CM Gold-Red Flowering Pine Needle (Decoration)
1.35m Christmas garland with pink ornaments and pine cones weighing 940g - 135CM Rose Pink White-Tipped Pinecone (Decoration)
Deluxe 1.35m Christmas garland with velvet bows and pine cones on a grey backdrop - 135CM PE Leaf Golden Series (Decoration)
1.35m pre-lit Christmas garland with red bows, ornaments and pine cones - 135CM Red Candy Series (With Lights)
+2
Christmas Garland Pre-lit Warm White LED Lights PE Frosted Pine Needles Natural Pine Cones Ribbon Mantel Staircase Party Decor
$36.89-68.59
No MOQ
Christmas Iron Hanging Ornaments Vintage Painted Metal Santa Snowman Pendants For Holiday Tree Decor With Jute Rope
Christmas Iron Hanging Ornaments Vintage Painted Metal Santa Snowman Pendants For Holiday Tree Decor With Jute Rope
like
Find Similar
Christmas stocking metal ornament with deer, 12cm green tin pendant decoration - Green Christmas Stocking
6cm painted metal Santa Claus Christmas tree ornament with snowflake patterns and jute rope - Left Facing Santa
Retro tin Santa Claus flying pendant with jute string and colorful painted finish, 7cm - Right Facing Santa
Vintage red iron Santa Claus hanging ornament with rustic finish and jute rope, 10cm height - Santa in Blue Robe
+11
Christmas Iron Hanging Ornaments Vintage Painted Metal Santa Snowman Pendants For Holiday Tree Decor With Jute Rope
$1.12-2.25
No MOQ
Free Shipping
Plastic Christmas Ball Ornaments Glitter Sequin Painted Tree Hanging Decorative Baubles For Holiday Party Home Decor
Plastic Christmas Ball Ornaments Glitter Sequin Painted Tree Hanging Decorative Baubles For Holiday Party Home Decor
like
Find Similar
Christmas tree decoration set with 8cm silver and blue glitter balls and candy canes - Silver Series Ornament Set (8 Pcs/Set)
42-piece Christmas tree ornament set with red gold silver baubles and deer pendants - Christmas Red Ornament Set (42pcs/1.16kg)
43-piece set of red and gold Christmas ornaments with painted balls and star tree toppers - Red Ornament Set (43pcs/0.98kg)
Silver glitter cube Christmas tree ornaments with white bows and hanging cords, 6cm size - Silver Glitter Gift Boxes (2 Pcs/Set)
Plastic Christmas Ball Ornaments Glitter Sequin Painted Tree Hanging Decorative Baubles For Holiday Party Home Decor
$2.77-57.06
No MOQ
Christmas Ornaments Acrylic Transparent Snowflake Reindeer Star Hanging Decorations Holiday Tree Decor Sparkling Novelty
Christmas Ornaments Acrylic Transparent Snowflake Reindeer Star Hanging Decorations Holiday Tree Decor Sparkling Novelty
like
Find Similar
Transparent acrylic Christmas tree ornament with gold glitter finish and hanging string - Crystal Gold Christmas Tree
Hanging acrylic crystal snowflake decoration with teardrop pendant, 23cm length - Crystal Snowflake String
15cm clear acrylic snowflake ornament with textured finish and silver string for Christmas - Crystal Snowflake
Sparkling 15cm acrylic Christmas snowflake wreath ornament with glittery ice crystal finish - Crystal Wreath
+11
Christmas Ornaments Acrylic Transparent Snowflake Reindeer Star Hanging Decorations Holiday Tree Decor Sparkling Novelty
-5%
$1.26-4.05
No MOQ
Free Shipping
Antique Bronze Christmas Snow Globe Lantern LED Floating Glitter Night Light Plastic Resin Festive Decorative Ornament
Antique Bronze Christmas Snow Globe Lantern LED Floating Glitter Night Light Plastic Resin Festive Decorative Ornament
like
Find Similar
Close-up of vintage bronze Christmas lantern with Santa Claus and glitter inside on snow - Santa Claus in House
Detail of vintage bronze Christmas lantern with Santa Claus and glitter water feature - Gift Box Santa Claus
Close-up of vintage bronze Christmas lantern with LED snowmen and sparkling snow - Snowman
Close-up of bronze Christmas lantern with a miniature tree and warm LED glow - Christmas Tree
Antique Bronze Christmas Snow Globe Lantern LED Floating Glitter Night Light Plastic Resin Festive Decorative Ornament
$3.46
No MOQ
Christmas Miniature Resin Ornaments Santa Claus Snowman Reindeer Hedgehog Bear Tiny Figurine Micro Landscape Desktop Decor
Christmas Miniature Resin Ornaments Santa Claus Snowman Reindeer Hedgehog Bear Tiny Figurine Micro Landscape Desktop Decor
like
Find Similar
Miniature resin Santa Claus figurine with gift box, 8cm tall Christmas ornament - Santa with Gift Box
Resin Santa Claus figurine sitting on gift box, holiday ornament size 6.5cm x 5cm - Santa with Bell
Miniature resin Santa Claus figurine with green tree and red outfit 6.5cm height - Santa with Christmas Tree
Resin Santa Claus figurine ornament in red coat with gift bag and 6.5cm height - Santa with Sack
+16
Christmas Miniature Resin Ornaments Santa Claus Snowman Reindeer Hedgehog Bear Tiny Figurine Micro Landscape Desktop Decor
-4%
$1.81-2.14
No MOQ
Miniature Christmas Figurines Resin Gingerbread Man Snow House Train Micro Landscape DIY Desktop Ornaments Pink Festive
Miniature Christmas Figurines Resin Gingerbread Man Snow House Train Micro Landscape DIY Desktop Ornaments Pink Festive
like
Find Similar
Miniature pink Christmas train figurine with snow detail, 3.7cm long holiday DIY decor - 1# Car
Pink miniature Christmas resin gingerbread house with snow roof, 2.9cm mini ornament - 2# House
Miniature pink Christmas tree figurine with glitter snow and dimensions of 2.6cm by 2cm - 3# Tree
Pink gingerbread man resin figurine with candy cane for DIY miniature landscape - 4# Holding Candy
+6
Miniature Christmas Figurines Resin Gingerbread Man Snow House Train Micro Landscape DIY Desktop Ornaments Pink Festive
$0.07-0.44
Mix MOQ : 3
Christmas Gingerbread Man Ornaments Felt Cloth Hanging Decorations For Holiday Tree Home Party Festive Decor
Christmas Gingerbread Man Ornaments Felt Cloth Hanging Decorations For Holiday Tree Home Party Festive Decor
like
Find Similar
Close-up of a felt gingerbread man ornament hanging on a twine with a small wooden clip - Lollipop Gingerbread Man
Felt gingerbread man ornament hanging with a mini scarf and santa hat on a string - Candy Cane Gingerbread Man
Detailed view of a felt gingerbread man ornament with red hat and striped scarf hanging - Scarf Gingerbread Man
Christmas Gingerbread Man Ornaments Felt Cloth Hanging Decorations For Holiday Tree Home Party Festive Decor
$1.07
No MOQ
Go to

More in party supplies

Explore more in candy boxes

partystoragesquarewindowdecorativeholidaytagspackaging bagshape jewelryround
hollowgoldartificial pearlheartdiycakewhitegirlsflipsolid color

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access