Everful

Wholesale bibs

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bibs

Find the perfect pieces: toys & games, kids bags, baby clothing & essentials and more

All products in bibs

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Toddler Girls Summer Cotton Floral Lace Short Sleeve Top And Purple Ruffle Shorts Set Pieces Casual Korean Style Outfit
Toddler Girls Summer Cotton Floral Lace Short Sleeve Top And Purple Ruffle Shorts Set Pieces Casual Korean Style Outfit
like
Find Similar
Toddler girl summer short sleeve floral blouse in apricot with cute lace hem and bows - Floral Pattern (Top Only (Without Shorts)) / 73cm
Lavender toddler shorts with white lace trim and elastic waistband for baby girls - Purple (Shorts Only (Without Top)) / 73cm
+8
Toddler Girls Summer Cotton Floral Lace Short Sleeve Top And Purple Ruffle Shorts Set Pieces Casual Korean Style Outfit
$7.20-7.78
No MOQ
Free Shipping
Children's Knitted Vest Cartoon Cat Ginger Yellow Sleeveless Knit Top For Boys Girls Casual Autumn Spring Clothes
Children's Knitted Vest Cartoon Cat Ginger Yellow Sleeveless Knit Top For Boys Girls Casual Autumn Spring Clothes
like
Find Similar
Kids knitted sleeveless vest in warm yellow featuring a cute cartoon cat patch design - Ginger Yellow (CY16022KB) / 73
Children's stylish outfit featuring grey plaid shirt and black casual joggers - Black And White Check Set (CT86081) / 80
Three-piece boy outfit with yellow knitted vest, plaid shirt, and black jogger pants - Yellow Three-Piece (CY16022KBA) / 80
+41
Children's Knitted Vest Cartoon Cat Ginger Yellow Sleeveless Knit Top For Boys Girls Casual Autumn Spring Clothes
$11.10-29.74
No MOQ
Free Shipping
Baby Summer Cotton Gauze Clothing Set Sleeveless Vest And Lantern Pants With Cartoon House Print For Infant Toddler
Baby Summer Cotton Gauze Clothing Set Sleeveless Vest And Lantern Pants With Cartoon House Print For Infant Toddler
like
Find Similar
Toddler summer cotton gauze outfit with Lucky Everyday sleeveless vest and green pants - 73cm
Baby Summer Cotton Gauze Clothing Set Sleeveless Vest And Lantern Pants With Cartoon House Print For Infant Toddler
$10.09
No MOQ
Free Shipping
Baby Warm Quilted Vest Floral Ruffle Collar Sunflower Applique Snap Cotton Waistcoat Outerwear For Infant Toddler
Baby Warm Quilted Vest Floral Ruffle Collar Sunflower Applique Snap Cotton Waistcoat Outerwear For Infant Toddler
like
Find Similar
Infant quilted vest in cream with floral ruffle collar and small green flower detail - 66CM / Flower Warm Vest (768810)
+4
NewBaby Warm Quilted Vest Floral Ruffle Collar Sunflower Applique Snap Cotton Waistcoat Outerwear For Infant Toddler
-5%
$4.52
No MOQ
Newborn Baby Cotton Long Sleeve Romper Soft Infact Jumpsuit With Squirrel Dragonfly Christmas Tree Embroidery Star Print
Newborn Baby Cotton Long Sleeve Romper Soft Infact Jumpsuit With Squirrel Dragonfly Christmas Tree Embroidery Star Print
like
Find Similar
Newborn cotton romper with acorn embroidery and star print in soft white and pink tones - 66CM / Squirrel-Khaki
Pink long sleeve newborn romper with Peter Pan lace collar and dragonfly embroidery - 73cm / Dragonfly-Peach Pink
Newborn cream cotton bodysuit with Peter Pan collar and delicate dragonfly embroidery - 73cm / Dragonfly-Yellow
Newborn cotton romper in white and green featuring acorn embroidery and star patterns - 66CM / Squirrel-Light Green
+19
Newborn Baby Cotton Long Sleeve Romper Soft Infact Jumpsuit With Squirrel Dragonfly Christmas Tree Embroidery Star Print
-4%
$7.54
No MOQ
Baby Girl Winter Thickened Fleece Lined Leggings High Waist Ribbed Knit Footed Tights Warm Thermal Bottoms For Infants Toddlers
Baby Girl Winter Thickened Fleece Lined Leggings High Waist Ribbed Knit Footed Tights Warm Thermal Bottoms For Infants Toddlers
like
Find Similar
Close-up of light pink ribbed infant leggings on a rustic wooden bench background - M / Pink Fleece Lined
Detailed close-up of thick white cable knit baby leggings on a vintage wooden stool - M / White Fleece-lined
Close-up of baby thick black knit leggings with elastic waist and ribbed texture details - M / Black Fleece Lined
+3
Baby Girl Winter Thickened Fleece Lined Leggings High Waist Ribbed Knit Footed Tights Warm Thermal Bottoms For Infants Toddlers
$8.59
Mix MOQ : 2
Baby Kids Unisex Cotton Jumpsuit Overalls Korean Style Summer Toddler Suspender Romper Sleeveless Solid Color Bodysuit Pants
Baby Kids Unisex Cotton Jumpsuit Overalls Korean Style Summer Toddler Suspender Romper Sleeveless Solid Color Bodysuit Pants
like
Find Similar
Close-up of neutral-toned cotton linen kids overalls with button detail and side pockets - 80cm / Beige Grey
Detail view of brown cotton-linen kids overalls with double straps and large side pockets - 80cm / Mocha Brown
+10
Baby Kids Unisex Cotton Jumpsuit Overalls Korean Style Summer Toddler Suspender Romper Sleeveless Solid Color Bodysuit Pants
$10.09
No MOQ
Free Shipping
Infant Toddler Winter Thickened Warm White Duck Down Jacket Polyester Hooded Outerwear Coat For Boys Casual Daily Wear
Infant Toddler Winter Thickened Warm White Duck Down Jacket Polyester Hooded Outerwear Coat For Boys Casual Daily Wear
like
Find Similar
Toddler winter jacket in light beige with brown plaid pocket and button closure - 80cm / Off White
Infant Toddler Winter Thickened Warm White Duck Down Jacket Polyester Hooded Outerwear Coat For Boys Casual Daily Wear
$19.60
No MOQ
Baby Winter Down Romper Thickened Hooded Jumpsuit Cartoon Frog Design Warm Outdoor Puffer Suit For Infants Toddlers
Baby Winter Down Romper Thickened Hooded Jumpsuit Cartoon Frog Design Warm Outdoor Puffer Suit For Infants Toddlers
like
Find Similar
Thick winter baby romper with cute green frog hood and 3D design for warmth - 90 / Green
Baby Winter Down Romper Thickened Hooded Jumpsuit Cartoon Frog Design Warm Outdoor Puffer Suit For Infants Toddlers
$36.02
Mix MOQ : 2
Free Shipping
Baby Thermal Underwear Set Three Layer Quilted Cotton Floral Print Long Sleeve Top And High Waist Pants For Infants Toddlers
Baby Thermal Underwear Set Three Layer Quilted Cotton Floral Print Long Sleeve Top And High Waist Pants For Infants Toddlers
like
Find Similar
Quilted cotton baby thermal pajama set with purple floral pattern and ribbed cuffs - Size 66 / Purple Floral
Quilted cotton baby thermal set with high waist pants in pink floral print design - Size 100 / Pink Floral
+8
Baby Thermal Underwear Set Three Layer Quilted Cotton Floral Print Long Sleeve Top And High Waist Pants For Infants Toddlers
$6.77
No MOQ
Washable Breathable Kids Face Mask With Fruit Embroidery Strawberry Apple Pattern Reusable Dustproof Protective Mask For Children
Washable Breathable Kids Face Mask With Fruit Embroidery Strawberry Apple Pattern Reusable Dustproof Protective Mask For Children
like
Find Similar
Close-up of black breathable cotton face mask for kids with grape embroidery detail - Grapes
Close-up of black breathable cotton face mask for kids with yellow banana embroidery - Banana
Front view of a child wearing a breathable black face mask with a red strawberry embroidery - Strawberry
Close-up of children's breathable black fabric face mask with red apple embroidery - Apple
+2
NewWashable Breathable Kids Face Mask With Fruit Embroidery Strawberry Apple Pattern Reusable Dustproof Protective Mask For Children
$0.29
No MOQ
Ribbed Cotton Baby Romper And Ruffled Hat Long Sleeve Button Front Newborn Infant Girl Clothing
Ribbed Cotton Baby Romper And Ruffled Hat Long Sleeve Button Front Newborn Infant Girl Clothing
like
Find Similar
White ribbed cotton baby bodysuit set with matching sun hat and ruffles in size 73 - 80cm / White
Beige ribbed cotton baby romper and matching sun hat set with lace trim and wooden buttons - 80cm / Off White
Gray ribbed cotton baby romper and matching sun hat set with delicate ruffle trim detail - 80cm / Gray
Caramel ribbed cotton baby romper and matching sun hat set with long sleeves - 90cm / Dark Orange
+3
Ribbed Cotton Baby Romper And Ruffled Hat Long Sleeve Button Front Newborn Infant Girl Clothing
$6.89-7.18
No MOQ
Newborn Baby Hooded Fleece Romper Warm Winter Jumpsuit With 3D Bear Ears For Infants Unisex Autumn Outing Clothes
Newborn Baby Hooded Fleece Romper Warm Winter Jumpsuit With 3D Bear Ears For Infants Unisex Autumn Outing Clothes
like
Find Similar
Winter infant hooded fleece romper in cream with cute bear ears and front zipper - 73cm / Off White
Newborn Baby Hooded Fleece Romper Warm Winter Jumpsuit With 3D Bear Ears For Infants Unisex Autumn Outing Clothes
-4%
$11.50
Mix MOQ : 2
Girls Summer Cotton T-Shirt And Shorts Pink Cartoon Rainbow Print Short Sleeve Top Elastic Waist Shorts Casual Kids Outfit
Girls Summer Cotton T-Shirt And Shorts Pink Cartoon Rainbow Print Short Sleeve Top Elastic Waist Shorts Casual Kids Outfit
like
Find Similar
Pink cotton summer pajama set for girls with rainbow print and drawstring shorts - T-shirt And Shorts / 2Y(90cm)
Pink short sleeve girl t-shirt with Sleep Over Squad rainbow and star cartoon prints - T-shirt Only (Without Shorts)(5446) / 2Y(90cm)
Girls pink cotton shorts with elastic waistband drawstring and floral patchwork detail - Shorts Only (Without T-shirt)(3145) / 2Y(90cm)
+15
Girls Summer Cotton T-Shirt And Shorts Pink Cartoon Rainbow Print Short Sleeve Top Elastic Waist Shorts Casual Kids Outfit
-5%
$4.52-10.58
No MOQ
Free Shipping
Baby Girl Patchwork Cartoon Bear Sweatshirt Top And Pants Set Autumn Casual Soft Cotton Blend Outfit For Toddler Infant
Baby Girl Patchwork Cartoon Bear Sweatshirt Top And Pants Set Autumn Casual Soft Cotton Blend Outfit For Toddler Infant
like
Find Similar
Infant girl casual lounge set in light grey and pink with cute cartoon bear print - 73cm
+4
NewBaby Girl Patchwork Cartoon Bear Sweatshirt Top And Pants Set Autumn Casual Soft Cotton Blend Outfit For Toddler Infant
$17.29
No MOQ
Free Shipping
Toddler Girls Summer Ruffle Sleeve Top And Rainbow Striped Shorts Cotton Outfit Set Seahorse Print Casual Clothes
Toddler Girls Summer Ruffle Sleeve Top And Rainbow Striped Shorts Cotton Outfit Set Seahorse Print Casual Clothes
like
Find Similar
Girls summer red sleeveless top with seahorse applique and rainbow striped shorts set - 2Y(90cm) / Red Seahorse Print Style (2308)
+5
Toddler Girls Summer Ruffle Sleeve Top And Rainbow Striped Shorts Cotton Outfit Set Seahorse Print Casual Clothes
-5%
$8.43
No MOQ
Magic Tree Printed Striped Long Sleeve Sweatshirt And Pants Set For Toddler Boys Autumn Casual Outfits Green Clothing
Magic Tree Printed Striped Long Sleeve Sweatshirt And Pants Set For Toddler Boys Autumn Casual Outfits Green Clothing
like
Find Similar
2-piece baby boy clothing set with green striped long sleeve tee and joggers - Green / 73cm
+4
Magic Tree Printed Striped Long Sleeve Sweatshirt And Pants Set For Toddler Boys Autumn Casual Outfits Green Clothing
$17.87
No MOQ
Free Shipping
Boys Girls Summer Casual Cotton Shorts Kids Solid Color Elastic Waist Soft Breathable Straight Pants For Toddlers Toddler
Boys Girls Summer Casual Cotton Shorts Kids Solid Color Elastic Waist Soft Breathable Straight Pants For Toddlers Toddler
like
Find Similar
Detail view of dark grey kids cotton shorts showing elastic waistband and terry fabric - 80cm / Dark Gray
Detailed flat lay of children's khaki cotton shorts with raw edge and elastic waistband - 80cm / Apricot
Detailed texture of khaki cotton French Terry fabric on kids leisure shorts with elastic waist - 80cm / Light Coffee
+15
Boys Girls Summer Casual Cotton Shorts Kids Solid Color Elastic Waist Soft Breathable Straight Pants For Toddlers Toddler
$8.36
No MOQ
Free Shipping
Toddler Boys 3-Piece Clothing Set Cotton Hooded Grid Jacket Cartoon Dog Print T-Shirt And Casual Pants Outfit Set
Toddler Boys 3-Piece Clothing Set Cotton Hooded Grid Jacket Cartoon Dog Print T-Shirt And Casual Pants Outfit Set
like
Find Similar
Three-piece boy casual set with grey checkered hooded cardigan and jogger pants - Gray / 73cm
Toddler Boys 3-Piece Clothing Set Cotton Hooded Grid Jacket Cartoon Dog Print T-Shirt And Casual Pants Outfit Set
$27.95
No MOQ
Free Shipping
Girls Cotton Ruffle Shorts Summer Elastic Waist Casual Solid Color Toddler Kids Comfortable Sweet Daily Beach Bottoms
Girls Cotton Ruffle Shorts Summer Elastic Waist Casual Solid Color Toddler Kids Comfortable Sweet Daily Beach Bottoms
like
Find Similar
Girls' bright green cotton shorts with ruffle trim and comfortable elastic waist - 90cm / Grass Green
Girls' light purple cotton shorts with frill hem detail, comfortable elastic waist design - 90cm / Purple
Girls dopamine style ginger yellow cotton shorts with ruffled edges and elastic waistband - 100cm / Yellow
+3
Girls Cotton Ruffle Shorts Summer Elastic Waist Casual Solid Color Toddler Kids Comfortable Sweet Daily Beach Bottoms
$11.50
No MOQ
Free Shipping
Girls Two Piece Outfit Set Fleece Lined Bunny Print Sweatshirt And Ribbed Flared Pants Autumn Winter Casual Clothes For Kids
Girls Two Piece Outfit Set Fleece Lined Bunny Print Sweatshirt And Ribbed Flared Pants Autumn Winter Casual Clothes For Kids
like
Find Similar
Pink bunny sweatshirt and striped flare pants set for girls with warm fleece lining - 2Y(90cm) / Pink Bunny Set (Fleece Lined)
Creamy white ribbed cotton flared pants for girls with elastic waist and ruffled hem - 6Y(130cm) / Cream Ribbed Flared Pants Only (Without Top)
Pink cotton long sleeve toddler sweatshirt with white cartoon rabbit and mesh bow decoration - 6Y(130cm) / Pink Bunny Sweatshirt Only (Without Pants)
+15
Girls Two Piece Outfit Set Fleece Lined Bunny Print Sweatshirt And Ribbed Flared Pants Autumn Winter Casual Clothes For Kids
-30%
$2.86-7.42
No MOQ
Baby Girls Winter Thick Hooded Romper Warm Polyester Polka Dot Jumpsuit With Bow Heart Embroidery Outdoor Snowsuit
Baby Girls Winter Thick Hooded Romper Warm Polyester Polka Dot Jumpsuit With Bow Heart Embroidery Outdoor Snowsuit
like
Find Similar
Pink quilted hooded baby romper with bow details and heart embroidery for winter warmth - 66CM / Pink
+4
Baby Girls Winter Thick Hooded Romper Warm Polyester Polka Dot Jumpsuit With Bow Heart Embroidery Outdoor Snowsuit
$25.36
No MOQ
Korean Style Baby Toddler 2 Piece Clothing Set Long Sleeve Checked Shirt And Denim Suspender Pants Outfit For Boys Girls
Korean Style Baby Toddler 2 Piece Clothing Set Long Sleeve Checked Shirt And Denim Suspender Pants Outfit For Boys Girls
like
Find Similar
Kids plaid shirt and cream overalls set with adjustable straps for spring - 80cm / White
Spring plaid shirt and denim overalls set with white sneakers for kids - 80cm / Blue
+6
Korean Style Baby Toddler 2 Piece Clothing Set Long Sleeve Checked Shirt And Denim Suspender Pants Outfit For Boys Girls
$9.80
No MOQ
Kids Cotton Cargo Pants Korean Style Casual Loose Trousers Boys Girls Japanese Versatile Solid Color Fashion Children Clothing
Kids Cotton Cargo Pants Korean Style Casual Loose Trousers Boys Girls Japanese Versatile Solid Color Fashion Children Clothing
like
Find Similar
Detailed close-up of elastic waistband and cargo pockets on cotton kids trousers - 80cm / Beige
Detail of children's cotton cargo pants featuring elastic waistband and large side pockets - 80cm / Dark Brown
+10
Kids Cotton Cargo Pants Korean Style Casual Loose Trousers Boys Girls Japanese Versatile Solid Color Fashion Children Clothing
$9.80
No MOQ
Infant Baby Girls Long Sleeve Floral Romper Ruffled Peter Pan Collar Jumpsuit Autumn Spring Polyester One-Piece Jumpsuit Outfit
Infant Baby Girls Long Sleeve Floral Romper Ruffled Peter Pan Collar Jumpsuit Autumn Spring Polyester One-Piece Jumpsuit Outfit
like
Find Similar
Floral baby girl long sleeve romper in cream with ruffle collar and embroidery details - Size 66 / Brown
Infant Baby Girls Long Sleeve Floral Romper Ruffled Peter Pan Collar Jumpsuit Autumn Spring Polyester One-Piece Jumpsuit Outfit
$17.29
No MOQ
Free Shipping
Toddler Kids Summer Muslin Sleeveless Vest Breathable Cotton V-Neck Solid Color Tank Top Casual Boys Girls Clothes
Toddler Kids Summer Muslin Sleeveless Vest Breathable Cotton V-Neck Solid Color Tank Top Casual Boys Girls Clothes
like
Find Similar
Close-up of beige sleeveless toddler top showing breathable cotton linen fabric texture - 80cm / Beige
Breathable cotton linen summer tank tops for toddlers in natural earth tone colors - 80cm / Khaki
Flat lay of breathable cotton sleeveless vests in earthy tones for children fashion - 80cm / Purple and Coffee
+15
Toddler Kids Summer Muslin Sleeveless Vest Breathable Cotton V-Neck Solid Color Tank Top Casual Boys Girls Clothes
$6.60
No MOQ
 · 
10 views
Free Shipping
Summer Kids Breathable Cotton Shorts For Boys Girls Korean Style Casual Checkered Striped Loose Comfortable Short Pants
Summer Kids Breathable Cotton Shorts For Boys Girls Korean Style Casual Checkered Striped Loose Comfortable Short Pants
like
Find Similar
Close-up of breathable linen cotton kids shorts with brown gingham pattern and elastic waist - 80 / Plaid
Detail view of elastic waistband and striped cotton linen fabric on kids casual shorts - 80 / Striped
Detailed close-up of breathable linen cotton kids shorts featuring elastic waist and side pockets - 80 / Light Khaki
+15
Summer Kids Breathable Cotton Shorts For Boys Girls Korean Style Casual Checkered Striped Loose Comfortable Short Pants
$9.22
No MOQ
Free Shipping
Children's Cotton Bloomers Summer Boys Girls Korean Style Loose Harem Shorts Solid Color Elastic Waist Toddler Pants
Children's Cotton Bloomers Summer Boys Girls Korean Style Loose Harem Shorts Solid Color Elastic Waist Toddler Pants
like
Find Similar
Detailed flat lay of olive green cotton linen kids bloomers with elastic waist and pockets - 80cm / Pine Tea
Detailed view of kids cotton bloomers featuring elastic waistband and charcoal texture - 80cm / Dark Gray
+10
Children's Cotton Bloomers Summer Boys Girls Korean Style Loose Harem Shorts Solid Color Elastic Waist Toddler Pants
$8.65
No MOQ
Free Shipping
Kids Thickened Fleece Pajamas Set Winter Warm Flannel Home Wear For Boys Girls Toddler Soft Polyester Top And Pants Set
Kids Thickened Fleece Pajamas Set Winter Warm Flannel Home Wear For Boys Girls Toddler Soft Polyester Top And Pants Set
like
Find Similar
Thick beige fleece pajama set for toddlers with red car embroidery detail - Beige / 80
Thick light green fleece pajama set for kids with soft long sleeves and cuffed pants - Green / 110
+13
Kids Thickened Fleece Pajamas Set Winter Warm Flannel Home Wear For Boys Girls Toddler Soft Polyester Top And Pants Set
$13.80
No MOQ
Baby Long Sleeve Romper Polka Dot Giraffe Pattern Viscose Blend Jumpsuit Class A Soft Infant Spring Autumn One Piece Clothes
Baby Long Sleeve Romper Polka Dot Giraffe Pattern Viscose Blend Jumpsuit Class A Soft Infant Spring Autumn One Piece Clothes
like
Find Similar
Baby cotton romper in cream with brown polka dots and giraffe motif decoration - Apricot / 66CM
Baby Long Sleeve Romper Polka Dot Giraffe Pattern Viscose Blend Jumpsuit Class A Soft Infant Spring Autumn One Piece Clothes
$14.99
No MOQ
Free Shipping
Boys Casual Cotton Blend Star Printed Polo Shirt Korean Style Contrast Color Lapel Short Sleeve Top For Toddlers
Boys Casual Cotton Blend Star Printed Polo Shirt Korean Style Contrast Color Lapel Short Sleeve Top For Toddlers
like
Find Similar
Detail of baby boy polo shirt with light blue collar and watercolor star patterns - 90cm / White Star Print
Close-up of white polo shirt neckline with blue striped collar and star print details - 90cm / White
+8
Boys Casual Cotton Blend Star Printed Polo Shirt Korean Style Contrast Color Lapel Short Sleeve Top For Toddlers
$5.48
No MOQ
Baby Girls Boys Rabbit Embroidery Denim Pants Elastic Waist Light Blue Wash Cotton Blend Toddler Jeans Long Trousers
Baby Girls Boys Rabbit Embroidery Denim Pants Elastic Waist Light Blue Wash Cotton Blend Toddler Jeans Long Trousers
like
Find Similar
Light blue wash denim joggers for kids with cute bunny embroidery and elastic cuffs - Light Blue / 73cm
Baby Girls Boys Rabbit Embroidery Denim Pants Elastic Waist Light Blue Wash Cotton Blend Toddler Jeans Long Trousers
$10.66
No MOQ
Free Shipping
Toddler Boys Korean Style Waffle Knit Cardigan Jacket Long Sleeve Cartoon Patch Buttons Acetate Fiber Outerwear For Autumn
Toddler Boys Korean Style Waffle Knit Cardigan Jacket Long Sleeve Cartoon Patch Buttons Acetate Fiber Outerwear For Autumn
like
Find Similar
2 options
Toddler Boys Korean Style Waffle Knit Cardigan Jacket Long Sleeve Cartoon Patch Buttons Acetate Fiber Outerwear For Autumn
$12.97
No MOQ
Free Shipping
Baby Girls Cotton Floral Romper Class A Long Sleeve Jumpsuit With Lace Trim And 3D Flower Decoration For Autumn Sleepwear
Baby Girls Cotton Floral Romper Class A Long Sleeve Jumpsuit With Lace Trim And 3D Flower Decoration For Autumn Sleepwear
like
Find Similar
Infant long sleeve cotton romper in white with yellow floral print and lace collar - Yellow Floral / Size 66 (3-6 Months)
Baby girl long sleeve white romper with pink floral print and delicate lace trim - Pink Floral / Size 66 (3-6 Months)
+6
Baby Girls Cotton Floral Romper Class A Long Sleeve Jumpsuit With Lace Trim And 3D Flower Decoration For Autumn Sleepwear
$7.64
No MOQ
Children's Raglan Color Block T-Shirt 100% Cotton Short Sleeve Loose Casual Summer Top For Boys Girls Kids Korean Style
Children's Raglan Color Block T-Shirt 100% Cotton Short Sleeve Loose Casual Summer Top For Boys Girls Kids Korean Style
like
Find Similar
Detail of raglan sleeves and contrast color stitching on kids cotton t-shirt - 80cm / Gray And Coffee
Close-up of kids raglan t-shirt showing breathable cotton slub fabric texture - 80cm / Khaki/Green
+10
Children's Raglan Color Block T-Shirt 100% Cotton Short Sleeve Loose Casual Summer Top For Boys Girls Kids Korean Style
$7.20
No MOQ
Free Shipping
Toddler Baby Boys Denim Pants Cotton Blend Soft Washed Jeans With Bear Pattern Letter Embroidery Casual Trousers For Kids
Toddler Baby Boys Denim Pants Cotton Blend Soft Washed Jeans With Bear Pattern Letter Embroidery Casual Trousers For Kids
like
Find Similar
Kids blue washed denim jeans with elastic waist and cute printed bear illustration - 73cm / Blue
Toddler Baby Boys Denim Pants Cotton Blend Soft Washed Jeans With Bear Pattern Letter Embroidery Casual Trousers For Kids
$10.95
No MOQ
Free Shipping
Toddler Boys Girls Hooded Fleece Base Shirt Korean Style Long Sleeve Pullover Soft Warm Thermal Top Casual Kids Clothing
Toddler Boys Girls Hooded Fleece Base Shirt Korean Style Long Sleeve Pullover Soft Warm Thermal Top Casual Kids Clothing
like
Find Similar
Detail of children's hooded long sleeve top with black and white stripes and ribbed cuffs - 80cm / Black Apricot Striped
Close-up of soft beige fleece hooded sweatshirt for kids with premium fabric texture - 80cm / Beige Apricot
Detail view of light purple hooded fleece sweatshirt for kids with ribbed cuffs - 80cm / Light Gray
Detail of soft dark coffee fleece lining and ribbed cuffs on kids' hooded sweatshirt - 80cm / Coffee
+20
Toddler Boys Girls Hooded Fleece Base Shirt Korean Style Long Sleeve Pullover Soft Warm Thermal Top Casual Kids Clothing
$8.36
No MOQ
Toddler Kids Summer Denim Three-Piece Set Cotton Short Sleeve Jacket Printed T-Shirt And Shorts Heart Bunny Pattern Casual Outfit
Toddler Kids Summer Denim Three-Piece Set Cotton Short Sleeve Jacket Printed T-Shirt And Shorts Heart Bunny Pattern Casual Outfit
like
Find Similar
Three-piece denim kids clothing set with embroidered heart and rabbit patterns - 80cm / Navy Blue
+4
Toddler Kids Summer Denim Three-Piece Set Cotton Short Sleeve Jacket Printed T-Shirt And Shorts Heart Bunny Pattern Casual Outfit
$10.66
No MOQ
Girls Autumn Cotton Long Sleeve Outfit Set Rainbow Polka Dot Pattern Pullover Top And Pants Two Piece Casual Kids Clothes
Girls Autumn Cotton Long Sleeve Outfit Set Rainbow Polka Dot Pattern Pullover Top And Pants Two Piece Casual Kids Clothes
like
Find Similar
Toddler girls autumn set with rainbow sun pattern top and black polka dot pants - 2Y(90cm) / Rainbow Polka Dot (2071)
Girls Autumn Cotton Long Sleeve Outfit Set Rainbow Polka Dot Pattern Pullover Top And Pants Two Piece Casual Kids Clothes
-30%
$6.72
No MOQ
Toddler Girls Hooded Long Sleeve Cotton Star Print Sweatshirt And Pants Two Piece Set Casual Kids Winter Fall Clothing
Toddler Girls Hooded Long Sleeve Cotton Star Print Sweatshirt And Pants Two Piece Set Casual Kids Winter Fall Clothing
like
Find Similar
Yellow velvet hooded sweatshirt set for girls featuring black star patches and matching pants - Yellow / 80cm
Toddler girls red velvet hooded tracksuit with black sequin star patches and joggers - Red / 80cm
Pink velvet hooded sweatshirt and pants set for girls with black star patches and soft shoes - Pink / 80cm
+9
Toddler Girls Hooded Long Sleeve Cotton Star Print Sweatshirt And Pants Two Piece Set Casual Kids Winter Fall Clothing
-4%
$7.12
No MOQ
Toddler Girl Summer Cotton Clothing Set Floral Puff Sleeve Top Lace Trim And Ruffled Shorts Pastoral Casual Outfit
Toddler Girl Summer Cotton Clothing Set Floral Puff Sleeve Top Lace Trim And Ruffled Shorts Pastoral Casual Outfit
like
Find Similar
Khaki cotton kids shorts with floral elastic waist and ruffled edges in a cute pastoral style - 73cm / Green (Ruffled Shorts)
Cute baby girls floral short sleeve blouse with cream purple print and lace trim - 73cm / Floral (Floral Short Sleeve)
+8
Toddler Girl Summer Cotton Clothing Set Floral Puff Sleeve Top Lace Trim And Ruffled Shorts Pastoral Casual Outfit
$6.92-8.07
No MOQ
Free Shipping
Boys Summer Short Sleeve Clothing Set Cotton Cartoon Zebra Printed T-Shirt And Striped Shorts Casual Two-Piece Kids Outfit
Boys Summer Short Sleeve Clothing Set Cotton Cartoon Zebra Printed T-Shirt And Striped Shorts Casual Two-Piece Kids Outfit
like
Find Similar
Toddler boys summer set with white zebra print t-shirt and beige striped shorts - 2Y(90cm) / Zebra Print Striped Set (2267)
Boys summer cotton set featuring yellow aircraft print T-shirt and blue plaid shorts - 6Y (120cm) / Airplane Pattern Plaid Set (2239)
Boys summer cotton set with grey cartoon truck T-shirt and yellow blue checkered shorts - 6Y (120cm) / Construction Vehicle Grid Set (2247)
Kids cotton summer set with grey excavator print T-shirt and plaid shorts outfit - 6Y (120cm) / Excavator Print Plaid Set (2236)
+30
Boys Summer Short Sleeve Clothing Set Cotton Cartoon Zebra Printed T-Shirt And Striped Shorts Casual Two-Piece Kids Outfit
$8.30-8.59
No MOQ
Baby Floral Turban Hat With Large Mesh Flower Decoration Soft Polyester Spandex Toddler Infant Beanie Cap For Daily Photography
Baby Floral Turban Hat With Large Mesh Flower Decoration Soft Polyester Spandex Toddler Infant Beanie Cap For Daily Photography
like
Find Similar
Detail of baby floral turban hat with a 3D tulle flower and gold sequin accents - Pale Green
Detail of baby floral turban hat with deep blue print and large 3D mesh flower - Navy Blue
Close-up of pink mesh flower detail and floral print on gray cotton baby turban - Gray
Detail of baby floral turban hat featuring red mesh flower with gold star sequins - Black
Baby Floral Turban Hat With Large Mesh Flower Decoration Soft Polyester Spandex Toddler Infant Beanie Cap For Daily Photography
$1.04
No MOQ
Newborn Baby Winter Mink Fleece Thickened Quilted Cartoon Bear Ears Hooded Romper For Infant Jumpsuit Outdoor Warm Crawler
Newborn Baby Winter Mink Fleece Thickened Quilted Cartoon Bear Ears Hooded Romper For Infant Jumpsuit Outdoor Warm Crawler
like
Find Similar
Plush baby romper in white and yellow with animal hood and zip closure for winter warmth - 66CM / Yellow
NewNewborn Baby Winter Mink Fleece Thickened Quilted Cartoon Bear Ears Hooded Romper For Infant Jumpsuit Outdoor Warm Crawler
-5%
$18.62
Mix MOQ : 2
Toddler Girls Casual Color Block Sweatshirt And Pants Outfit Cute Cartoon Bear Printed Long Sleeve Pullover Spring Clothing
Toddler Girls Casual Color Block Sweatshirt And Pants Outfit Cute Cartoon Bear Printed Long Sleeve Pullover Spring Clothing
like
Find Similar
Pink and grey toddler girls casual two-piece sweatshirt set with cute bear embroidery - Pink / 73cm
+4
Toddler Girls Casual Color Block Sweatshirt And Pants Outfit Cute Cartoon Bear Printed Long Sleeve Pullover Spring Clothing
$17.29
No MOQ
Free Shipping
Newborn Baby Girl Hooded Romper Rabbit Ears Heart Embroidery Cotton Long Sleeve Jumpsuit Infant Toddler Pink Casual Autumn
Newborn Baby Girl Hooded Romper Rabbit Ears Heart Embroidery Cotton Long Sleeve Jumpsuit Infant Toddler Pink Casual Autumn
like
Find Similar
Pink long-sleeved hooded baby romper with rabbit ears and heart pattern embroidery - Size 66 / Pink
Newborn Baby Girl Hooded Romper Rabbit Ears Heart Embroidery Cotton Long Sleeve Jumpsuit Infant Toddler Pink Casual Autumn
-5%
$10.95
No MOQ
Kids Mosquito Pants Summer Thin Breathable Viscose Lantern Pants For Boys Girls Cartoon Embroidery Casual Trousers
Kids Mosquito Pants Summer Thin Breathable Viscose Lantern Pants For Boys Girls Cartoon Embroidery Casual Trousers
like
Find Similar
Kids lightweight cream cotton linen mosquito pants with cute animal embroidery - Nordic Cream Apricot / 80cm
Kids navy blue anti-mosquito pants with white floral patterns and cinched ankles - Palace Blue / 80cm
Kids grass green mosquito pants with cute koala embroidery and elastic waistband - 80cm / Grayish Green
Pink lightweight mosquito-proof children's pants with elastic waist and cat pattern - Rose Red / 100cm
+12
Kids Mosquito Pants Summer Thin Breathable Viscose Lantern Pants For Boys Girls Cartoon Embroidery Casual Trousers
-4%
$10.93
No MOQ
Free Shipping
Boys Casual Cotton Blend Harem Pants With Dinosaur Patch Cargo Pockets Elastic Waist Trousers For Kids Toddlers
Boys Casual Cotton Blend Harem Pants With Dinosaur Patch Cargo Pockets Elastic Waist Trousers For Kids Toddlers
like
Find Similar
Kids khaki joggers with elastic waist and cute green dinosaur patch detail - Khaki / 90cm
Boys navy blue cotton harem pants with orange dinosaur patch and drawstring waist - Navy Blue / 90cm
+5
Boys Casual Cotton Blend Harem Pants With Dinosaur Patch Cargo Pockets Elastic Waist Trousers For Kids Toddlers
$6.28
No MOQ
Newborn Baby Quilted Romper Thickened Cotton Padded Jumpsuit With Rabbit Embroidery Ruffle Trim Long Sleeve Climbing Suit
Newborn Baby Quilted Romper Thickened Cotton Padded Jumpsuit With Rabbit Embroidery Ruffle Trim Long Sleeve Climbing Suit
like
Find Similar
Newborn cream cotton romper with rabbit embroidery and cute pink ruffle details - Size 59 / Apricot Pink
Thick warm cream baby romper with ruffle details and cute pink rabbit embroidery - Size 59 / Fresh Green
+8
Newborn Baby Quilted Romper Thickened Cotton Padded Jumpsuit With Rabbit Embroidery Ruffle Trim Long Sleeve Climbing Suit
$11.24
No MOQ
Baby Girl Long Sleeve Romper Dress Cotton Double Gauze Autumn Newborn Bodysuit Cute Bear Embroidery Lace Trim Princess Jumpsuit Khaki Apricot Infant Clothing
Baby Girl Long Sleeve Romper Dress Cotton Double Gauze Autumn Newborn Bodysuit Cute Bear Embroidery Lace Trim Princess Jumpsuit Khaki Apricot Infant Clothing
like
Find Similar
Beige double-layer gauze baby romper dress with cute bear embroidery and lace trim - 66CM / Apricot
Baby Girl Long Sleeve Romper Dress Cotton Double Gauze Autumn Newborn Bodysuit Cute Bear Embroidery Lace Trim Princess Jumpsuit Khaki Apricot Infant Clothing
$10.37
Mix MOQ : 2
Free Shipping
Kids Cotton Casual Sweatpants Loose Joggers With Elastic Waist Letter Print Spring Autumn Trousers For Boys Girls
Kids Cotton Casual Sweatpants Loose Joggers With Elastic Waist Letter Print Spring Autumn Trousers For Boys Girls
like
Find Similar
Detail view of cotton kids sweatpants featuring elastic waistband and soft texture - 80cm / Grey-Beige
Detailed close-up of dark grey cotton kids casual pants featuring elastic waistband and pockets - 80cm / Dark Gray
+10
Kids Cotton Casual Sweatpants Loose Joggers With Elastic Waist Letter Print Spring Autumn Trousers For Boys Girls
$10.37
No MOQ
Baby Boy Summer Romper Cotton Blend Van Gogh Art Print Short Sleeve Jumpsuit Artistic Newborn Outing Clothes One Piece
Baby Boy Summer Romper Cotton Blend Van Gogh Art Print Short Sleeve Jumpsuit Artistic Newborn Outing Clothes One Piece
like
Find Similar
Short sleeve white cotton baby romper with Van Gogh style artsy prints and snaps - Orange / 66CM
Baby Boy Summer Romper Cotton Blend Van Gogh Art Print Short Sleeve Jumpsuit Artistic Newborn Outing Clothes One Piece
-11%
$7.86
No MOQ
Baby Girls 100% Cotton Long Sleeve Pajama Set Unicorn Floral Print Sweet Peter Pan Collar Top And Pants 2 Piece Outfit
Baby Girls 100% Cotton Long Sleeve Pajama Set Unicorn Floral Print Sweet Peter Pan Collar Top And Pants 2 Piece Outfit
like
Find Similar
Baby cotton long-sleeved pajamas set with unicorn and rose print in cream color - 73 Size / Unicorn Floral Print
Baby Girls 100% Cotton Long Sleeve Pajama Set Unicorn Floral Print Sweet Peter Pan Collar Top And Pants 2 Piece Outfit
$7.49
No MOQ
Toddler Baby Harem Pants Cotton Big PP Pants Loose Casual Spring Autumn Long Trousers Striped Solid Color Boys Girls
Toddler Baby Harem Pants Cotton Big PP Pants Loose Casual Spring Autumn Long Trousers Striped Solid Color Boys Girls
like
Find Similar
Kids baggy cotton pants in beige, dark coffee, and white with elastic waist - 80cm / Beige
Kids harem pants in brown, cream and striped patterns made of soft cotton knit fabric - 80cm / Coffee
Kids black and white striped harem pants with elastic waist and soft cotton fabric - 80cm / Striped
Baby harem pants set in cream white and black stripes with comfortable elastic waist - 80cm / White
+16
Toddler Baby Harem Pants Cotton Big PP Pants Loose Casual Spring Autumn Long Trousers Striped Solid Color Boys Girls
$8.07
No MOQ
Free Shipping
Toddler Boys Casual Cotton Long Sleeve Sweatshirt And Pants Set Cute Cartoon Dinosaur Embroidered Navy Blue Outfits
Toddler Boys Casual Cotton Long Sleeve Sweatshirt And Pants Set Cute Cartoon Dinosaur Embroidered Navy Blue Outfits
like
Find Similar
Navy blue boys cotton tracksuit with colorful embroidered dinosaur patterns and drawstrings - 2Y(90) / Navy Blue (8293+3170)
+5
Toddler Boys Casual Cotton Long Sleeve Sweatshirt And Pants Set Cute Cartoon Dinosaur Embroidered Navy Blue Outfits
$14.55
No MOQ
Kids Short Sleeve T-Shirt 100 Percent Cotton Cartoon Dog Painting Leisure Hobbies Print Crew Neck Summer Casual Top
Kids Short Sleeve T-Shirt 100 Percent Cotton Cartoon Dog Painting Leisure Hobbies Print Crew Neck Summer Casual Top
like
Find Similar
Navy blue cotton T-shirt for kids with artistic cartoon dog and yellow varsity text - 90 / Royal Blue
Kids cream cotton short sleeve T-shirt with cartoon dog and blue leisure hobbies print - 90 / Beige Apricot
+10
NewKids Short Sleeve T-Shirt 100 Percent Cotton Cartoon Dog Painting Leisure Hobbies Print Crew Neck Summer Casual Top
-4%
$3.43
No MOQ
Baby Cotton Quilted Warm Clothing Set Cartoon Dragon Print High Waist Belly Protection Infants Long Sleeve Top And Pants
Baby Cotton Quilted Warm Clothing Set Cartoon Dragon Print High Waist Belly Protection Infants Long Sleeve Top And Pants
like
Find Similar
Quilted red baby thermal underwear set with festive dragon embroidery and Fu character - 66CM / Red
Quilted cotton baby thermal loungewear set with red festive dragon embroidery - 66CM / Off White
+6
Baby Cotton Quilted Warm Clothing Set Cartoon Dragon Print High Waist Belly Protection Infants Long Sleeve Top And Pants
-4%
$8.08
No MOQ
Toddler Kids Winter Fleece Plaid Hoodie Pants Set Panda Crossbody Bag Bear Embroidery Thick Warm Baby Clothes Outfit
Toddler Kids Winter Fleece Plaid Hoodie Pants Set Panda Crossbody Bag Bear Embroidery Thick Warm Baby Clothes Outfit
like
Find Similar
Winter fleece children plaid tracksuit with bear embroidery and panda shoulder bag - Dark Gray / 80cm
Winter fleece children tracksuit with teddy embroidery and panda crossbody bag - Tan / 80cm
+8
Toddler Kids Winter Fleece Plaid Hoodie Pants Set Panda Crossbody Bag Bear Embroidery Thick Warm Baby Clothes Outfit
$14.41
No MOQ
Infant Quilted Cotton Long Sleeve Romper Warm Baby Floral Printed One-Piece Jumpsuit For Autumn Winter Newborn Clothes
Infant Quilted Cotton Long Sleeve Romper Warm Baby Floral Printed One-Piece Jumpsuit For Autumn Winter Newborn Clothes
like
Find Similar
Quilted cotton baby romper in cream with pink ribbed trim and floral Lucky print - 66CM / Floral Pattern Romper
Infant Quilted Cotton Long Sleeve Romper Warm Baby Floral Printed One-Piece Jumpsuit For Autumn Winter Newborn Clothes
$7.35
No MOQ
Girls Cotton Short Sleeve T-Shirt With 3D Bee Patch Cute Polka Dot Pattern Summer Top For Toddler Kids Casual Clothing
Girls Cotton Short Sleeve T-Shirt With 3D Bee Patch Cute Polka Dot Pattern Summer Top For Toddler Kids Casual Clothing
like
Find Similar
White cotton t-shirt for girls featuring black polka dots and a yellow bee embroidery - 7T(140) / White Polka Dot (52139)
Girls Cotton Short Sleeve T-Shirt With 3D Bee Patch Cute Polka Dot Pattern Summer Top For Toddler Kids Casual Clothing
-4%
$4.80
No MOQ
Go to

More in baby & kids

Explore more in bibs

babylayerpolyesterboysstrapbandhandmaterialkerchiefface
solid colorstylepetkidsheartwarmdesignmetalwhiteears

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access