Everful

Wholesale bibs

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bibs

Find the perfect pieces: toys & games, kids bags, baby clothing & essentials and more

All products in bibs

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Toddler Baby Girl Summer Clothing Set Rabbit Patch Embroidery Short Sleeve T-Shirt And Floral Print Pants Cotton Outfit
Toddler Baby Girl Summer Clothing Set Rabbit Patch Embroidery Short Sleeve T-Shirt And Floral Print Pants Cotton Outfit
like
Find Similar
Cute baby girls summer cotton set with pink rabbit t-shirt and floral wide-leg pants - Pink/Floral / 73cm
Toddler Baby Girl Summer Clothing Set Rabbit Patch Embroidery Short Sleeve T-Shirt And Floral Print Pants Cotton Outfit
$11.24
No MOQ
Free Shipping
Baby Girl Ruffle Ribbed Cotton Long Sleeve Top And Pants Set French Vintage Solid Color Toddler Infant Casual Outfits
Baby Girl Ruffle Ribbed Cotton Long Sleeve Top And Pants Set French Vintage Solid Color Toddler Infant Casual Outfits
like
Find Similar
Pink knit two-piece toddler set with ruffled sleeves and elastic waist trousers - 73cm / Pink
Baby Girl Ruffle Ribbed Cotton Long Sleeve Top And Pants Set French Vintage Solid Color Toddler Infant Casual Outfits
-4%
$9.86
Mix MOQ : 2
Baby Long Sleeve Romper Padded Cotton Jumpsuit Cartoon Bunny House Embroidery Boneless Warm Outing Pajamas For Infant Newborn
Baby Long Sleeve Romper Padded Cotton Jumpsuit Cartoon Bunny House Embroidery Boneless Warm Outing Pajamas For Infant Newborn
like
Find Similar
White cotton quilted baby romper with lace collar and cute rabbit embroidery design - 59 / White
Light pink knitted baby romper with cute bunny pattern and white lace collar detail - 59 / Pink
Off-white infant romper with cute rabbit embroidery and lace collar details - 59 / Green
+12
Baby Long Sleeve Romper Padded Cotton Jumpsuit Cartoon Bunny House Embroidery Boneless Warm Outing Pajamas For Infant Newborn
$11.24
No MOQ
Free Shipping
Toddler Kids Cotton Long Sleeve T-Shirt Korean Style Fruit Vegetable Printed Round Neck Casual Pullover Top For Boys Girls
Toddler Kids Cotton Long Sleeve T-Shirt Korean Style Fruit Vegetable Printed Round Neck Casual Pullover Top For Boys Girls
like
Find Similar
Detail of soft cotton kids sweatshirt featuring colorful food illustrations and text - Beige Apricot / 80cm
Detail of cotton kids long sleeve sweatshirt with colorful food illustrations and text - Dark Brown / 80cm
+10
Toddler Kids Cotton Long Sleeve T-Shirt Korean Style Fruit Vegetable Printed Round Neck Casual Pullover Top For Boys Girls
$9.51
No MOQ
Free Shipping
Infant Quilted Cotton Padded Romper Winter Thick Warm Baby Jumpsuit For Newborn Boys Girls Autumn Winter Outdoor Wear
Infant Quilted Cotton Padded Romper Winter Thick Warm Baby Jumpsuit For Newborn Boys Girls Autumn Winter Outdoor Wear
like
Find Similar
Light blue quilted baby romper with diamond pattern and cute duck patch design - Blue / 73cm
Infant Quilted Cotton Padded Romper Winter Thick Warm Baby Jumpsuit For Newborn Boys Girls Autumn Winter Outdoor Wear
$16.43
No MOQ
Baby Toddler Girls Cotton Home Wear Set Long Sleeve Cherry Embroidery Ruffle Collar Top And Pants Two Piece Casual Outfit
Baby Toddler Girls Cotton Home Wear Set Long Sleeve Cherry Embroidery Ruffle Collar Top And Pants Two Piece Casual Outfit
like
Find Similar
White muslin cotton baby lounge set featuring red cherry embroidery on a ruffled collar - 100cm / White
Pink infant girl cherry pajamas set with long sleeves and ruffled Peter Pan collar - 100cm / Pink
Baby Toddler Girls Cotton Home Wear Set Long Sleeve Cherry Embroidery Ruffle Collar Top And Pants Two Piece Casual Outfit
$11.24
Mix MOQ : 2
Newborn Baby Cotton Long Sleeve Romper Breathable Thin Side Opening Jumpsuit Soft Pointelle Pajamas For Infant Summer Air Conditioning Clothes
Newborn Baby Cotton Long Sleeve Romper Breathable Thin Side Opening Jumpsuit Soft Pointelle Pajamas For Infant Summer Air Conditioning Clothes
like
Find Similar
Soft cotton long sleeve baby romper in light green with vertical knit texture and snaps - Size 59 / Aqua
Light pink long-sleeve baby bodysuit in breathable rib-knit cotton with snap closure - Size 59 / Orange Pink
Light pink newborn cotton romper with vertical breathable texture and snap closure - Size 59 / Smoky Purple
Long-sleeve cotton baby romper in cream white with ribbed texture and side buttons - Size 59 / Milk Yellow
+16
Newborn Baby Cotton Long Sleeve Romper Breathable Thin Side Opening Jumpsuit Soft Pointelle Pajamas For Infant Summer Air Conditioning Clothes
$5.33
No MOQ
Infant Long Sleeve Quilted Romper Cotton Warm Jumpsuit For Newborn Baby Boys Girls Winter Spring Autumn Floral Rabbit Print Clothing
Infant Long Sleeve Quilted Romper Cotton Warm Jumpsuit For Newborn Baby Boys Girls Winter Spring Autumn Floral Rabbit Print Clothing
like
Find Similar
Detail of quilted cotton baby romper with floral bunny print and side snap closure - Size 59 / Energetic Rabbit
Detail of quilted cotton baby romper featuring cute bear prints and snap buttons - Size 59 / Pink Sheep
Detailed macro view of quilted cotton baby romper with cute bear and floral prints - Size 59 / Yellow Bear
Detail of quilted cotton baby romper with car and tree prints showing soft warm texture - Size 59 / Car & Tree
+23
Infant Long Sleeve Quilted Romper Cotton Warm Jumpsuit For Newborn Baby Boys Girls Winter Spring Autumn Floral Rabbit Print Clothing
$6.48
No MOQ
Toddler Boys Girls Cotton Harem Pants Korean Style Loose Casual Wide Leg Trousers Solid Color Spring Autumn Bottoms
Toddler Boys Girls Cotton Harem Pants Korean Style Loose Casual Wide Leg Trousers Solid Color Spring Autumn Bottoms
like
Find Similar
Close-up of kids wide-leg cotton harem pants with elastic waistband and stitch detail - Apricot / 80cm
Detail of loose dark grey cotton harem pants for kids featuring an elastic waistband - Dark Gray / 80cm
+10
Toddler Boys Girls Cotton Harem Pants Korean Style Loose Casual Wide Leg Trousers Solid Color Spring Autumn Bottoms
$9.48
No MOQ
Baby Boy Pure Cotton Short Sleeve Romper Cartoon Forest Animal Printed Jumpsuit Lapel Collar Breathable Newborn Clothes
Baby Boy Pure Cotton Short Sleeve Romper Cartoon Forest Animal Printed Jumpsuit Lapel Collar Breathable Newborn Clothes
like
Find Similar
Short sleeve baby romper in white cotton with cartoon animal prints and polo collar - 66CM / Rainbow
Baby Boy Pure Cotton Short Sleeve Romper Cartoon Forest Animal Printed Jumpsuit Lapel Collar Breathable Newborn Clothes
$8.65
No MOQ
Free Shipping
Cotton Infant Long Sleeve Romper Cartoon Animal Bear Printed Newborn Jumpsuit Soft Comfortable Casual Baby Bodysuit
Cotton Infant Long Sleeve Romper Cartoon Animal Bear Printed Newborn Jumpsuit Soft Comfortable Casual Baby Bodysuit
like
Find Similar
Close-up of cotton baby bodysuit with cute cartoon bear print and snap closure - Size 59 / Bear Print
Detail of baby cotton romper with cartoon panda prints and front button closure - Size 59 / Panda Print
Close-up of pure cotton baby romper with delicate deer prints and yellow contrast edges - Size 59 / Deer Print
+12
Cotton Infant Long Sleeve Romper Cartoon Animal Bear Printed Newborn Jumpsuit Soft Comfortable Casual Baby Bodysuit
$4.76
No MOQ
Baby Romper Long Sleeve Cotton Christmas My 1st Christmas Cartoon Prints With Bow Tie
Baby Romper Long Sleeve Cotton Christmas My 1st Christmas Cartoon Prints With Bow Tie
like
Find Similar
Flat lay of baby Christmas romper with 1st Christmas print and festive holiday decor - 80cm / Red
+4
Baby Romper Long Sleeve Cotton Christmas My 1st Christmas Cartoon Prints With Bow Tie
$7.49
No MOQ
Korean Style Kids Cotton Sleeveless Henley T-Shirt Minimalist Solid Color Summer Breathable Vest Top For Boys Girls Children
Korean Style Kids Cotton Sleeveless Henley T-Shirt Minimalist Solid Color Summer Breathable Vest Top For Boys Girls Children
like
Find Similar
Close-up of olive green knit cotton Henley vest with two wooden buttons for kids - 80cm / Fruit Green
Detail of coffee brown baby vest featuring a ribbed henley neck and soft cotton texture - 80cm / Khaki
Detail view of cotton knit toddler vest with brown color and wood-style buttons - 80cm / Brown
Detail of minimalist beige cotton kids tank top with Henley collar and wooden buttons - 80cm / Beige Apricot
+20
Korean Style Kids Cotton Sleeveless Henley T-Shirt Minimalist Solid Color Summer Breathable Vest Top For Boys Girls Children
$6.31
No MOQ
Free Shipping
Girls Pink Cartoon Rabbit Printed Cotton Sweatshirt And Ribbed Pants Fall Toddler Clothing Set Long Sleeve Pullover Tops
Girls Pink Cartoon Rabbit Printed Cotton Sweatshirt And Ribbed Pants Fall Toddler Clothing Set Long Sleeve Pullover Tops
like
Find Similar
Pink girl sweatshirt with long sleeves and a cute cartoon white rabbit illustration - 2Y(90cm) / Pink Rabbit Sweatshirt (2178T)
+5
Girls Pink Cartoon Rabbit Printed Cotton Sweatshirt And Ribbed Pants Fall Toddler Clothing Set Long Sleeve Pullover Tops
$5.33
No MOQ
Baby Girls Summer Cotton Romper Tulip Embroidery Ruffle Sleeveless Bodysuit Floral Infant Sunsuit Outfit With Snap Button
Baby Girls Summer Cotton Romper Tulip Embroidery Ruffle Sleeveless Bodysuit Floral Infant Sunsuit Outfit With Snap Button
like
Find Similar
Close-up of baby floral bodysuit with tulip embroidery and green ruffled neckline - Green / 73cm
Infant summer floral bodysuit with ruffled pink collar and matching knit beret set - Pink / 73cm
+6
Baby Girls Summer Cotton Romper Tulip Embroidery Ruffle Sleeveless Bodysuit Floral Infant Sunsuit Outfit With Snap Button
-5%
$7.94
Mix MOQ : 2
Kids Casual Cotton Thin Long Pants Korean Style Elastic Waist Solid Color Trousers For Boys Girls Toddler Summer Clothing
Kids Casual Cotton Thin Long Pants Korean Style Elastic Waist Solid Color Trousers For Boys Girls Toddler Summer Clothing
like
Find Similar
Detail view of children's cotton pants showing elastic waist and button stitching - Apricot / 80cm
Detail of kids casual cotton pants featuring elastic waist and decorative buttons - Dusty Blue / 80cm
+10
Kids Casual Cotton Thin Long Pants Korean Style Elastic Waist Solid Color Trousers For Boys Girls Toddler Summer Clothing
$9.22
No MOQ
Free Shipping
Sweet Baby Girl Floral Romper Short Sleeve Ruffle Collar Bow Jumpsuit Cotton Infant Summer Bodysuit Outfit White
Sweet Baby Girl Floral Romper Short Sleeve Ruffle Collar Bow Jumpsuit Cotton Infant Summer Bodysuit Outfit White
like
Find Similar
Floral baby girl romper with puff sleeves and decorative bows in cream white - 66CM / White
Sweet Baby Girl Floral Romper Short Sleeve Ruffle Collar Bow Jumpsuit Cotton Infant Summer Bodysuit Outfit White
$9.22
No MOQ
Free Shipping
Newborn Baby Cotton Long Sleeve Romper Cartoon Bear Plaid Patchwork Jumpsuit Comfortable Infant Autumn Spring Playwear
Newborn Baby Cotton Long Sleeve Romper Cartoon Bear Plaid Patchwork Jumpsuit Comfortable Infant Autumn Spring Playwear
like
Find Similar
Detail of baby romper with grape patterns, purple bows, and soft cotton fabric texture - Size 59 / Purple Bowknot
Detail of infant waffle cotton romper with bear applique and snap button closure - Size 59 / Number Eight Bear
Close-up of baby romper featuring a wavy green collar and hand-drawn flower details - Size 59 / Floral Collar
Detail view of cotton baby onesie with giraffe prints and safety Class A wash label - Size 59 / Giraffe with Bib
+27
Newborn Baby Cotton Long Sleeve Romper Cartoon Bear Plaid Patchwork Jumpsuit Comfortable Infant Autumn Spring Playwear
$5.76
No MOQ
Baby Down Jumpsuit Cute Cartoon Bear Ear Hooded Romper For Infants Winter Warm Thick Quilted Outerwear Puffer Snowsuit
Baby Down Jumpsuit Cute Cartoon Bear Ear Hooded Romper For Infants Winter Warm Thick Quilted Outerwear Puffer Snowsuit
like
Find Similar
Cute light green baby hooded down romper with bear ears and floral lining for winter - Blue / 66CM
+8
Baby Down Jumpsuit Cute Cartoon Bear Ear Hooded Romper For Infants Winter Warm Thick Quilted Outerwear Puffer Snowsuit
$38.04
No MOQ
Free Shipping
Kids Cotton Linen Shorts Korean Style Solid Color Lantern Pants Toddler Baby Summer Breathable Loose Bloomer Shorts For Boys Girls
Kids Cotton Linen Shorts Korean Style Solid Color Lantern Pants Toddler Baby Summer Breathable Loose Bloomer Shorts For Boys Girls
like
Find Similar
Close-up of brown cotton linen kids shorts with elastic waistband and tapered leg detail - 80cm / Brown
Detail view of cotton linen kids bloomers with elastic waist and textured fabric - 80cm / Off-white
+10
Kids Cotton Linen Shorts Korean Style Solid Color Lantern Pants Toddler Baby Summer Breathable Loose Bloomer Shorts For Boys Girls
$8.65
No MOQ
Free Shipping
Toddler Kids Sporty Color Block Polo Shirt And Shorts Set Boys Girls Cotton Embroidered Bear Summer Outfit Clothing
Toddler Kids Sporty Color Block Polo Shirt And Shorts Set Boys Girls Cotton Embroidered Bear Summer Outfit Clothing
like
Find Similar
Kids color-block cotton polo shirt and shorts set with bear embroidery for summer - 80cm / Black and White
Kids color-block polo shirt and shorts set in green, red, and white with bear motif - 80cm / Green/White
+6
Toddler Kids Sporty Color Block Polo Shirt And Shorts Set Boys Girls Cotton Embroidered Bear Summer Outfit Clothing
-5%
$6.02
No MOQ
Baby Girl Summer Sleeveless Romper 100% Cotton Muslin Heart Print Lace Collar Princess Jumpsuit Newborn Infant Bodysuit Outfit
Baby Girl Summer Sleeveless Romper 100% Cotton Muslin Heart Print Lace Collar Princess Jumpsuit Newborn Infant Bodysuit Outfit
like
Find Similar
Infant cotton bodysuit and matching shoes with heart prints and lace collar detail - 66CM / Heart Print Style
Baby Girl Summer Sleeveless Romper 100% Cotton Muslin Heart Print Lace Collar Princess Jumpsuit Newborn Infant Bodysuit Outfit
$8.04
Mix MOQ : 2
Free Shipping
Newborn Baby Girl Knit Romper Set Ruffle Collar Long Sleeve Cotton Pointelle Bodysuit With Matching Hat Vintage Infant Clothes
Newborn Baby Girl Knit Romper Set Ruffle Collar Long Sleeve Cotton Pointelle Bodysuit With Matching Hat Vintage Infant Clothes
like
Find Similar
Infant girl knit romper with lace collar and matching bonnet in beige pointelle fabric - 90cm / Flesh Pink
Newborn baby girl knitted romper and hat set in cream white with hollow floral lace - 100cm / White Apricot
Newborn Baby Girl Knit Romper Set Ruffle Collar Long Sleeve Cotton Pointelle Bodysuit With Matching Hat Vintage Infant Clothes
-5%
$12.59
Mix MOQ : 2
Free Shipping
Baby Girls Cotton Long Sleeve T-Shirt With Lettuce Trim Ribbed Knit Floral Polka Dot Striped Spring Autumn Bottoming Tops
Baby Girls Cotton Long Sleeve T-Shirt With Lettuce Trim Ribbed Knit Floral Polka Dot Striped Spring Autumn Bottoming Tops
like
Find Similar
Toddler girl floral long sleeve top in cream with ruffle trim and red flower patterns - 66CM / Floral
Infant long sleeve base layer with black polka dots and ruffle edge detailing - 66CM / Dot
Striped baby long-sleeve top with ruffle trim and Mary Jane shoes in a nursery basket - 66CM / Black Stripe
Toddler girl striped turtleneck top with ruffled edges in cream and brown stripes - 66CM / Brown Stripe
+16
Baby Girls Cotton Long Sleeve T-Shirt With Lettuce Trim Ribbed Knit Floral Polka Dot Striped Spring Autumn Bottoming Tops
$5.48
Mix MOQ : 2
Baby Girls Cotton Romper Polka Dot Printed Peter Pan Collar Short Sleeve Bodysuit With Headband Summer Newborn Clothing
Baby Girls Cotton Romper Polka Dot Printed Peter Pan Collar Short Sleeve Bodysuit With Headband Summer Newborn Clothing
like
Find Similar
Infant polka dot short sleeve bodysuit and headband set in beige and brown - 73cm / Caramel (Without Headband)
Baby Girls Cotton Romper Polka Dot Printed Peter Pan Collar Short Sleeve Bodysuit With Headband Summer Newborn Clothing
$8.36
No MOQ
Free Shipping
Newborn Baby Long Sleeve Cotton Bodysuit Bone-Free Printed Kimono Style Onesie For Infant Boys Girls Spring Autumn Winter
Newborn Baby Long Sleeve Cotton Bodysuit Bone-Free Printed Kimono Style Onesie For Infant Boys Girls Spring Autumn Winter
like
Find Similar
Flat lay of cream cotton baby bodysuit with snowmen prints and wooden rabbit rattle toy - Size 59 / Snow Day Elf
Detail of 100% cotton baby bodysuit with rabbit print and fabric care label - Size 59 / Childhood Bunny
Detail view of cotton baby bodysuit featuring side-opening snaps and 3D bear ornament - Size 59 / Bear Umbrella
Detail view of 100% cotton baby bodysuit with cute bear embroidery and snap buttons - Size 66 / Capybara Style
+14
Newborn Baby Long Sleeve Cotton Bodysuit Bone-Free Printed Kimono Style Onesie For Infant Boys Girls Spring Autumn Winter
$4.76
No MOQ
Boys Long Sleeve Cotton Shirt Casual Solid Color Button Down Top With Pocket For Toddlers Kids Spring Autumn Clothing
Boys Long Sleeve Cotton Shirt Casual Solid Color Button Down Top With Pocket For Toddlers Kids Spring Autumn Clothing
like
Find Similar
Classic yellow long-sleeved cotton shirt for boys with a chest pocket and button front - 90cm / Yellow
Close-up of pink children's long-sleeve shirt showing buttons, chest pocket, and collar detail - 90cm / Light Purple
Detail of light blue cotton shirt featuring wooden buttons and a front flap pocket - 100cm / Blue
Toddler boy's long-sleeve white cotton linen shirt with front pocket and contrast buttons - 130cm / White
+11
Boys Long Sleeve Cotton Shirt Casual Solid Color Button Down Top With Pocket For Toddlers Kids Spring Autumn Clothing
$6.05
No MOQ
 · 
13 views
Winter Padded Baby Romper Cartoon Rabbit Ear Hooded Jumpsuit For Infant Girls Warm Snowsuit Thick Outerwear
Winter Padded Baby Romper Cartoon Rabbit Ear Hooded Jumpsuit For Infant Girls Warm Snowsuit Thick Outerwear
like
Find Similar
Thick padded baby winter romper in soft pink with cute bunny ears and warm quilted design - 66CM / Purple
+4
Winter Padded Baby Romper Cartoon Rabbit Ear Hooded Jumpsuit For Infant Girls Warm Snowsuit Thick Outerwear
$25.07
No MOQ
Baby Plush Romper Long Sleeve Warm Fleece Jumpsuit With Cute Bear Ear Hat For Infant Toddler Boys Girls Winter Pajamas
Baby Plush Romper Long Sleeve Warm Fleece Jumpsuit With Cute Bear Ear Hat For Infant Toddler Boys Girls Winter Pajamas
like
Find Similar
Beige fleece baby hooded romper suit with cute ears and warm thermal plush material - 66CM / Off White
Pink plush baby romper set with bear ear hood and zipper in soft coral fleece - 66CM / Pink
Deep brown plush infant romper with bear ear hood and zip closure for winter warmth - 66CM / Dark Brown
Navy blue plush baby romper with matching 3D bear ear hat for winter warmth - 66CM / Navy Blue
+12
Baby Plush Romper Long Sleeve Warm Fleece Jumpsuit With Cute Bear Ear Hat For Infant Toddler Boys Girls Winter Pajamas
$5.73-6.60
Mix MOQ : 2
Toddler Girls Spring Outfit Cotton Blend Ruffle Hem Long Sleeve Sweatshirt Flare Pants Cartoon Bear Print Casual Clothing
Toddler Girls Spring Outfit Cotton Blend Ruffle Hem Long Sleeve Sweatshirt Flare Pants Cartoon Bear Print Casual Clothing
like
Find Similar
Girls toddler 2-piece set with grey ruffle sweatshirt featuring bear print and pink flared pants - 73cm / Pink
Toddler Girls Spring Outfit Cotton Blend Ruffle Hem Long Sleeve Sweatshirt Flare Pants Cartoon Bear Print Casual Clothing
$15.85
No MOQ
Free Shipping
Kids Girls Casual Cotton Blend Short Sleeve T-Shirt Strawberry Print Letter Graphic Summer Round Neck Tee Top For Children
Kids Girls Casual Cotton Blend Short Sleeve T-Shirt Strawberry Print Letter Graphic Summer Round Neck Tee Top For Children
like
Find Similar
Detailed flat lay of white cotton strawberry t-shirt with toddler shoes and pearl handbag - 90cm / White
Detail of a kids black t-shirt with strawberry print and pearl bag accessory - 90cm / Black
Detail of pink cotton kids t-shirt with strawberry print and Mary Jane shoes - 90cm / Rose Red
Detailed flat lay of dark grey cotton t-shirt with vibrant strawberry print and lettering - 90cm / Dark Gray
+52
Kids Girls Casual Cotton Blend Short Sleeve T-Shirt Strawberry Print Letter Graphic Summer Round Neck Tee Top For Children
$4.61
No MOQ
Toddler Boys Summer 2 Piece Outfit Set Bear Print Cotton T-Shirt And Multi Color Striped Overalls Shorts Casual Baby Clothes
Toddler Boys Summer 2 Piece Outfit Set Bear Print Cotton T-Shirt And Multi Color Striped Overalls Shorts Casual Baby Clothes
like
Find Similar
Infant boy summer set with striped overalls and a short-sleeved cotton t-shirt - 73cm / Brown
Toddler Boys Summer 2 Piece Outfit Set Bear Print Cotton T-Shirt And Multi Color Striped Overalls Shorts Casual Baby Clothes
$11.82
No MOQ
Free Shipping
Kids Winter Hooded Cotton Padded Jacket With Animal Ears Solid Color Thickened Warm Windproof Outwear Coat For Toddlers
Kids Winter Hooded Cotton Padded Jacket With Animal Ears Solid Color Thickened Warm Windproof Outwear Coat For Toddlers
like
Find Similar
Detail of hood with brown bear ears and ribbed cuffs on kids' padded winter coat - Green / 90cm
Detail of children's black quilted winter jacket featuring cute brown bear ear hood design - Black / 90cm
Detail of hooded padded jacket for kids with cute animal ears and ribbed cuffs - Deep Pink / 90cm
Detail of child winter jacket featuring cute bear ears on hood and windproof zipper closure - Coffee / 90cm
+16
Kids Winter Hooded Cotton Padded Jacket With Animal Ears Solid Color Thickened Warm Windproof Outwear Coat For Toddlers
$13.40
No MOQ
Newborn Baby Quilted Warm Romper Cotton Stars Moon Embroidered Jumpsuit Long Sleeve Thermal Autumn Winter Thick Clothes
Newborn Baby Quilted Warm Romper Cotton Stars Moon Embroidered Jumpsuit Long Sleeve Thermal Autumn Winter Thick Clothes
like
Find Similar
Detailed close-up of quilted cotton baby romper with embossed star and moon patterns - Butterfly Romper Style / Cream White / 52cm
Detail of quilted newborn romper with moon stars embossing and side snap ties - Butterfly Romper Style / Milk Yellow / 52cm
Detail of baby quilted romper with embroidered star moon pattern and side-tie design - Butterfly Romper Style / Pale Green / 52cm
Close-up of light blue quilted baby romper featuring moon star patterns and moon embroidery - Butterfly Romper Style / Fog Blue / 52cm
+11
Newborn Baby Quilted Warm Romper Cotton Stars Moon Embroidered Jumpsuit Long Sleeve Thermal Autumn Winter Thick Clothes
$5.33
No MOQ
Baby Girls Combed Cotton Pointelle Leggings Knitted Hollow Out Tights With Bowknot For Infants Toddler Summer Breathable Pantyhose
Baby Girls Combed Cotton Pointelle Leggings Knitted Hollow Out Tights With Bowknot For Infants Toddler Summer Breathable Pantyhose
like
Find Similar
Detailed knit pattern on white toddler tights with a cute side satin bow decoration - S 0-1 Years / White
Close-up of baby girl pink hollow knit leggings with a delicate white bow detail - S 0-1 Years / Pink
Baby Girls Combed Cotton Pointelle Leggings Knitted Hollow Out Tights With Bowknot For Infants Toddler Summer Breathable Pantyhose
-5%
$5.42
Mix MOQ : 2
Free Shipping
Baby Fleece Lined Thick Jumpsuit Warm Romper Long Sleeve Cartoon Animal Pattern One-Piece Pajamas Newborn Infants Winter Outfit
Baby Fleece Lined Thick Jumpsuit Warm Romper Long Sleeve Cartoon Animal Pattern One-Piece Pajamas Newborn Infants Winter Outfit
like
Find Similar
Detail of baby winter onesie showing rabbit embroidery and snap buttons on waffle fabric - Size 66 / Pink Misty Sweet Rabbit
Close-up of winter baby romper featuring soft herringbone texture and animal embroidery - Size 66 / Green Field Dragon Baby
Detail view of baby warm romper with cartoon elephant print and soft waffle texture - Size 66 / Clear Blue Little Elephant
Detailed close-up of cream baby romper featuring herringbone texture and cartoon duck - Size 66 / Rice Glutinous Little Duck
+11
Baby Fleece Lined Thick Jumpsuit Warm Romper Long Sleeve Cartoon Animal Pattern One-Piece Pajamas Newborn Infants Winter Outfit
$7.49
No MOQ
Infant Baby Winter Padded Romper Cotton Quilted Thickened Warm Newborn Jumpsuit Cartoon Print Sleepwear Outdoor Clothes
Infant Baby Winter Padded Romper Cotton Quilted Thickened Warm Newborn Jumpsuit Cartoon Print Sleepwear Outdoor Clothes
like
Find Similar
Thick quilted baby winter romper with cute duck and mushroom prints in white color - Size 59 / Mushroom Duck
Thick padded baby winter romper with storybook illustrations and blue ribbed trim - Size 59 / Dreaming in Wonderland
Thick winter infant romper with blue ribbed trim and whimsical hot air balloon prints - Size 59 / Cloud Dolphin
Padded baby winter romper with panda prints and green balloon on beige background - Size 59 / Panda Paradise
+26
Infant Baby Winter Padded Romper Cotton Quilted Thickened Warm Newborn Jumpsuit Cartoon Print Sleepwear Outdoor Clothes
$10.35
No MOQ
Toddler Girls Summer Cotton Clothing Top And Shorts Heart Print Short Sleeve Casual Korean Style Kids Outfit
Toddler Girls Summer Cotton Clothing Top And Shorts Heart Print Short Sleeve Casual Korean Style Kids Outfit
like
Find Similar
Girls bright pink summer set with heart print T-shirt and matching loose shorts - 80cm / Rose Red
Girls summer pink cotton set with heart print t-shirt and loose shorts in minimalist style - 80cm / Light Purple
Mint green summer two-piece girls clothing set with heart print and comfortable shorts - 80cm / Light Blue
Pink cotton girls' summer set with heart print T-shirt and loose shorts in flat lay view - 80cm / Peach
+16
Toddler Girls Summer Cotton Clothing Top And Shorts Heart Print Short Sleeve Casual Korean Style Kids Outfit
$6.34
No MOQ
Baby Girl Elastic Lace Headband With Chiffon Flowers Floral Hair Band For Newborn Infant Toddler Photo Prop Sweet Style
Baby Girl Elastic Lace Headband With Chiffon Flowers Floral Hair Band For Newborn Infant Toddler Photo Prop Sweet Style
like
Find Similar
Elastic white lace baby headband featuring two light pink tulle flowers with yellow stamens - Pink
Elastic baby headband with lace and floral mesh decorations for infants and toddlers - Off White
Elastic baby lace headband with 3D mesh flowers in beige and grey for infant girls - Beige Grey
Elastic baby lace headband featuring 3D chiffon flowers in soft pink and grey colors - Pinkish Grey
+2
Baby Girl Elastic Lace Headband With Chiffon Flowers Floral Hair Band For Newborn Infant Toddler Photo Prop Sweet Style
$1.04
Mix MOQ : 2
 · 
11 views
Bohemian Pastoral Artificial Flower Baby Headband Soft Nylon Elastic Floral Hair Band For Newborn Infants Photography Props
Bohemian Pastoral Artificial Flower Baby Headband Soft Nylon Elastic Floral Hair Band For Newborn Infants Photography Props
like
Find Similar
Detail view of handmade mesh flower headbands with navy and white silk petals for baby girls - Navy Blue
Bohemian floral baby headband with peach peonies and soft nylon band for photography - Orange
Detail of pink and white faux flowers on a soft nylon elastic headband for baby girls - Pink
Detailed overhead view of infant floral headband with white fabric flowers and green leaves - Off White
+3
Bohemian Pastoral Artificial Flower Baby Headband Soft Nylon Elastic Floral Hair Band For Newborn Infants Photography Props
$1.87
Mix MOQ : 2
Free Shipping
Infant Baby Boy Bear Ear Hooded Bodysuit Winter Thick Fleece Romper Long Sleeve Zipper Jumpsuit Soft Warm Clothes 0-24 Months
Infant Baby Boy Bear Ear Hooded Bodysuit Winter Thick Fleece Romper Long Sleeve Zipper Jumpsuit Soft Warm Clothes 0-24 Months
like
Find Similar
Infant teddy fleece romper with bear ears hood and zipper in warm beige color - 66 / Brown
NewInfant Baby Boy Bear Ear Hooded Bodysuit Winter Thick Fleece Romper Long Sleeve Zipper Jumpsuit Soft Warm Clothes 0-24 Months
-7%
$15.91
No MOQ
Baby Girl Cotton Long Sleeve Romper Unicorn Rose Floral Printed Jumpsuit Peter Pan Collar Bow Princess Soft Outing Clothing
Baby Girl Cotton Long Sleeve Romper Unicorn Rose Floral Printed Jumpsuit Peter Pan Collar Bow Princess Soft Outing Clothing
like
Find Similar
White baby girl romper with unicorn rose print and elegant pink bow ribbon detail - Size 66 / Unicorn & Rose Floral (Autumn/Spring Romper)
Baby Girl Cotton Long Sleeve Romper Unicorn Rose Floral Printed Jumpsuit Peter Pan Collar Bow Princess Soft Outing Clothing
$7.49
No MOQ
Toddler Baby Cotton Sweatshirt And Pants Set Long Sleeve Cartoon Dog Tulip Pattern Pullover Top And Trousers Outfit For Boys Girls
Toddler Baby Cotton Sweatshirt And Pants Set Long Sleeve Cartoon Dog Tulip Pattern Pullover Top And Trousers Outfit For Boys Girls
like
Find Similar
Infant cream cartoon dog sweatshirt and green jogger pants two-piece cotton set - 73cm / Teal Dog Set
Cream sweatshirt with 3D tulip applique and pink joggers two-piece set for toddlers - 73cm / Pink Tulip
+6
Toddler Baby Cotton Sweatshirt And Pants Set Long Sleeve Cartoon Dog Tulip Pattern Pullover Top And Trousers Outfit For Boys Girls
-5%
$14.24
No MOQ
Newborn Baby Long Sleeve Romper Letter Print Color Block Jumpsuit Comfortable Autumn Winter Warm Infant Outing Clothes
Newborn Baby Long Sleeve Romper Letter Print Color Block Jumpsuit Comfortable Autumn Winter Warm Infant Outing Clothes
like
Find Similar
Detail of baby thermal romper featuring a contrast 'C' design and button-up front - 66 / Pink Purple
Detailed view of color-block baby romper with snap buttons and letter C decoration - 66 / Gray
Detail view of the letter C print and snap button closure on baby long sleeve romper - 73 / Brown
Detail of baby romper with ribbed cuffs and snap fasteners for easy changing - 73 / Blue
+14
Newborn Baby Long Sleeve Romper Letter Print Color Block Jumpsuit Comfortable Autumn Winter Warm Infant Outing Clothes
$5.48
No MOQ
Newborn Baby Cotton Romper Long Sleeve Infant Bodysuit Printed Jumpsuit Sleepwear For Boys Girls 0-12 Months
Newborn Baby Cotton Romper Long Sleeve Infant Bodysuit Printed Jumpsuit Sleepwear For Boys Girls 0-12 Months
like
Find Similar
Detail of baby cotton romper featuring cartoon rabbit print and snap button closure - 59 / Flower Rabbit
Detail of baby cotton onesie with cartoon dinosaur and fruit prints and snap closure - 59 / Dinosaur Paradise
Detail of soft cotton baby romper with cartoon bear print and snap button closure - 59 / Playing Bear
Detail of infant long sleeve romper with colorful cartoon prints and snap buttons - 59 / Happy Planet
+26
Newborn Baby Cotton Romper Long Sleeve Infant Bodysuit Printed Jumpsuit Sleepwear For Boys Girls 0-12 Months
$5.33
No MOQ
Kids Cotton Linen Striped Shorts Summer Korean Style Casual Lantern Bloomers For Toddlers Boys Girls Breathable Soft Shorts
Kids Cotton Linen Striped Shorts Summer Korean Style Casual Lantern Bloomers For Toddlers Boys Girls Breathable Soft Shorts
like
Find Similar
Close-up of grey cotton linen bloomers with elastic waistband and tapered leg cuffs - Gray Stripe / 80cm
Close-up of beige linen baby shorts showing elastic waist and fine fabric texture - Apricot Stripe / 80cm
+10
Kids Cotton Linen Striped Shorts Summer Korean Style Casual Lantern Bloomers For Toddlers Boys Girls Breathable Soft Shorts
$11.24
No MOQ
Free Shipping
Toddler Girl Summer Sleeveless Lace Collar Rabbit Top And Floral Lantern Pants Outfit Cotton Breathable Casual Clothing
Toddler Girl Summer Sleeveless Lace Collar Rabbit Top And Floral Lantern Pants Outfit Cotton Breathable Casual Clothing
like
Find Similar
Toddler girls beige sleeveless top with lace collar and cute rabbit print set - 73cm / Tops / Beige
Baby girl floral trousers in coffee brown with elastic waist and bow knots at the cuffs - 73cm / Pants / Coffee Floral
+8
Toddler Girl Summer Sleeveless Lace Collar Rabbit Top And Floral Lantern Pants Outfit Cotton Breathable Casual Clothing
$6.92-7.78
No MOQ
Free Shipping
Toddler Boys 100% Cotton Short Sleeve Shirt And Shorts Set Summer Cartoon Animal Bear Dog Print Two Piece Outfit Set
Toddler Boys 100% Cotton Short Sleeve Shirt And Shorts Set Summer Cartoon Animal Bear Dog Print Two Piece Outfit Set
like
Find Similar
Toddler boys casual short sleeve shirt and shorts set with cute puppy print patterns - 90cm / Off-white Dog + Dark Khaki
Toddler boys summer set with yellow giraffe print shirt and white shorts flat lay - 90cm / Yellow Animal + White
Fashionable boys summer two-piece set with colorful bear print shirt and khaki shorts - 90cm / White Bear Head + Dark Khaki
Detail of baby boys' summer set featuring cartoon bear print shirt and khaki shorts - 90cm / Sky Blue Bear + Light Khaki
+19
Toddler Boys 100% Cotton Short Sleeve Shirt And Shorts Set Summer Cartoon Animal Bear Dog Print Two Piece Outfit Set
-4%
$8.19
No MOQ
Baby Girls Winter Three-Piece Clothing Outfit Floral Quilted Hooded Jacket With Bear Ears Ruffle Long Sleeve Top And Pants Thickened Warm Toddler Outing Clothes
Baby Girls Winter Three-Piece Clothing Outfit Floral Quilted Hooded Jacket With Bear Ears Ruffle Long Sleeve Top And Pants Thickened Warm Toddler Outing Clothes
like
Find Similar
Infant winter hooded jacket with pink floral print, cute bear ears and bow pockets - Green Coat Only (Without Shirt and Pants) / 73cm
Beige baby cotton thermal long sleeve shirt with bunny embroidery and ruffle edges - Beige [base Layer] / 73cm
Infant girl beige padded cotton trousers with lace waist and flower embroidery detail - Beige Pants / 73cm
+12
Baby Girls Winter Three-Piece Clothing Outfit Floral Quilted Hooded Jacket With Bear Ears Ruffle Long Sleeve Top And Pants Thickened Warm Toddler Outing Clothes
$6.92-24.78
No MOQ
Girls Sweet Pink Ruffle Sweatshirt And Bow Denim Pants Set Infant Cute 3D Rabbit Autumn Long Sleeve Top Trousers Clothing
Girls Sweet Pink Ruffle Sweatshirt And Bow Denim Pants Set Infant Cute 3D Rabbit Autumn Long Sleeve Top Trousers Clothing
like
Find Similar
Pink toddler girl outfit with rabbit sweatshirt and lace-trimmed bow denim pants - 73cm / Pink
+4
NewGirls Sweet Pink Ruffle Sweatshirt And Bow Denim Pants Set Infant Cute 3D Rabbit Autumn Long Sleeve Top Trousers Clothing
$18.16
No MOQ
Free Shipping
Children Cotton Long Sleeve Shirt Jacket Korean Cargo Style Unisex Solid Color Top With Ribbed Cuffs Front Large Pockets
Children Cotton Long Sleeve Shirt Jacket Korean Cargo Style Unisex Solid Color Top With Ribbed Cuffs Front Large Pockets
like
Find Similar
Detail of breathable cotton kids shirt with large utility pockets and ribbed cuffs - Beige / 80cm
Detailed view of kids corduroy shirt with textured fabric, breast pockets and ribbed cuffs - Cream Pink / 80cm
+10
Children Cotton Long Sleeve Shirt Jacket Korean Cargo Style Unisex Solid Color Top With Ribbed Cuffs Front Large Pockets
$11.24
No MOQ
Free Shipping
Kids 100% Brushed Cotton Pajamas Set Plaid Long Sleeve Button Sleepwear For Boys Girls Soft Warm Homewear Loungewear Set
Kids 100% Brushed Cotton Pajamas Set Plaid Long Sleeve Button Sleepwear For Boys Girls Soft Warm Homewear Loungewear Set
like
Find Similar
Kids and parents light blue checkered cotton pajamas set with long sleeves and wood buttons - Boys Style / Blue / 120
Kids and parents grey checkered cotton pajama set with button-down long sleeves - Boys Style / Light Heather Grey / 120
Kids and parents grey checkered cotton pajama set with long sleeves and button-down shirt - 120cm / Girls Style / Light Heather Grey
Pink checkered cotton kids pajama set with long sleeves and a matching toy bag - Girls Style / Pink / 120
+17
Kids 100% Brushed Cotton Pajamas Set Plaid Long Sleeve Button Sleepwear For Boys Girls Soft Warm Homewear Loungewear Set
$13.83-17.29
No MOQ
Christmas Baby Headband Large Mesh Tulle Bow Stretchy Nylon Hair Band Holiday Polka Dot Infant Toddler Girls Accessory
Christmas Baby Headband Large Mesh Tulle Bow Stretchy Nylon Hair Band Holiday Polka Dot Infant Toddler Girls Accessory
like
Find Similar
Christmas baby nylon headband with red elastic band and green double mesh polka dot bow - Dark Green
Christmas Baby Headband Large Mesh Tulle Bow Stretchy Nylon Hair Band Holiday Polka Dot Infant Toddler Girls Accessory
$0.81
No MOQ
Baby Winter Hooded Cotton Jacket Fleece Lined Thick Warm Pom Pom Outerwear Infant Toddler Button Down Solid Color Padded Coat
Baby Winter Hooded Cotton Jacket Fleece Lined Thick Warm Pom Pom Outerwear Infant Toddler Button Down Solid Color Padded Coat
like
Find Similar
Pink hooded baby winter jacket with fleece lining and cute pom-pom on the hood - 66 / Pink
Detail of hooded infant winter coat with velvet lining and ribbed windproof cuffs - 66 / Gray
Detail of red hooded baby coat with white lamb wool lining and size 66 label - 66 / Red
Detail of baby hooded padded coat in caramel with soft cream sherpa lining and pom-pom - 66 / Brown
+21
NewBaby Winter Hooded Cotton Jacket Fleece Lined Thick Warm Pom Pom Outerwear Infant Toddler Button Down Solid Color Padded Coat
-4%
$9.86
Mix MOQ : 2
Baby Boy Cotton Knitted Outfit Striped Long Sleeve Cardigan And Suspender Pants Casual Infant Toddler Clothing Set
Baby Boy Cotton Knitted Outfit Striped Long Sleeve Cardigan And Suspender Pants Casual Infant Toddler Clothing Set
like
Find Similar
Newborn boy knit overalls in grey and black stripes with soft premium knitted fabric - 66
Infant boy knit striped cardigan with light gray and black stripes and round buttons - 66
+8
Baby Boy Cotton Knitted Outfit Striped Long Sleeve Cardigan And Suspender Pants Casual Infant Toddler Clothing Set
-4%
$10.13-12.02
Mix MOQ : 2
Free Shipping
Chinese Style Newborn Baby Romper 100% Cotton Seamless Soft Infant Jumpsuit Floral Bird Print Traditional Frog Button Outfit
Chinese Style Newborn Baby Romper 100% Cotton Seamless Soft Infant Jumpsuit Floral Bird Print Traditional Frog Button Outfit
like
Find Similar
Floral Chinese style newborn cotton bodysuit with headband and wooden bear teether - 66CM
NewChinese Style Newborn Baby Romper 100% Cotton Seamless Soft Infant Jumpsuit Floral Bird Print Traditional Frog Button Outfit
-4%
$6.00
No MOQ
Newborn Baby Summer Short Sleeve Romper Breathable Ribbed Regenerated Cellulose Fiber Jumpsuit Cartoon Embroidery Infant Clothing
Newborn Baby Summer Short Sleeve Romper Breathable Ribbed Regenerated Cellulose Fiber Jumpsuit Cartoon Embroidery Infant Clothing
like
Find Similar
Close-up of baby pink ribbed cotton romper featuring delicate swan embroidery detail - Size 66 / Pink Swan
Detail of short-sleeved baby bodysuit in lilac ribbed cotton with berry embroidery - Size 66 / Purple Grape
Detail of baby white ribbed cotton romper with a bright yellow cartoon lion patch - Size 66 / Pure White Lion
Detail of baby short sleeve romper with cute elephant embroidery and snap buttons - Size 66 / Pure Yellow Elephant
+16
Newborn Baby Summer Short Sleeve Romper Breathable Ribbed Regenerated Cellulose Fiber Jumpsuit Cartoon Embroidery Infant Clothing
$4.18
No MOQ
Baby Quilted Thermal Clothing Set Cotton Padded Infant Newborn Long Sleeve Top High Waist Pants Bear Embroidered Autumn Winter
Baby Quilted Thermal Clothing Set Cotton Padded Infant Newborn Long Sleeve Top High Waist Pants Bear Embroidered Autumn Winter
like
Find Similar
Quilted warm baby clothing set in cream with brown trim and small bear patch - 66CM / Brown Bear (Off-White)
Baby Quilted Thermal Clothing Set Cotton Padded Infant Newborn Long Sleeve Top High Waist Pants Bear Embroidered Autumn Winter
$8.21
No MOQ
100% Cotton Newborn Kimono Romper Long Sleeve Butterfly Style Jumpsuit For 0-6 Months Baby Soft Seamless Crawling Clothes
100% Cotton Newborn Kimono Romper Long Sleeve Butterfly Style Jumpsuit For 0-6 Months Baby Soft Seamless Crawling Clothes
like
Find Similar
Detail of newborn floral cotton romper featuring side-tie closure and snap buttons - 52 / Purple Small Flower
Detailed close-up of newborn floral cotton romper with green trim and side snap buttons - 52 / Green Small Flower
Detail of pure cotton long sleeve baby romper with purple lavender and berry floral prints - 52 / Purple Grape
Detail of floral infant romper with soft side-tie closure and fabric wash label - 52 / Colorful Leaves
+8
100% Cotton Newborn Kimono Romper Long Sleeve Butterfly Style Jumpsuit For 0-6 Months Baby Soft Seamless Crawling Clothes
$4.76
No MOQ
Toddler Boy Sweatshirt And Pants Set Cartoon Puppy Printed Long Sleeve Cotton Blend Casual Spring Outfit For Infant
Toddler Boy Sweatshirt And Pants Set Cartoon Puppy Printed Long Sleeve Cotton Blend Casual Spring Outfit For Infant
like
Find Similar
Kids' cream sweatshirt and khaki pants set featuring happy day cartoon dog print - 73 / Brown
+4
Toddler Boy Sweatshirt And Pants Set Cartoon Puppy Printed Long Sleeve Cotton Blend Casual Spring Outfit For Infant
$16.71
No MOQ
Go to

More in baby & kids

Explore more in bibs

babylayerpolyesterboysstrapbandhandmaterialkerchiefface
solid colorstylepetkidsheartwarmdesignmetalwhiteears

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access