Everful

Wholesale bedding & bathroom

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bedding & Bathroom

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

All products in bedding & bathroom

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Household Cleaning Sponge Brush With Ergonomic Handle For Bathroom Kitchen Tile Sink Scrubbing Tool
Household Cleaning Sponge Brush With Ergonomic Handle For Bathroom Kitchen Tile Sink Scrubbing Tool
like
Find Similar
Ergonomic red cleaning sponge brush with handle for kitchen and bathroom surfaces - Square Red
Blue cleaning sponge brush with ergonomic black handle for bathtub and tile scrubbing - Square Blue
Green sponge cleaning brush with ergonomic handle for kitchen sink and bathroom tiles - Square Green
Durable grey oval scrubbing pad with textured fiber for kitchen and bathroom cleaning - Grey Sponge Refill Only
Household Cleaning Sponge Brush With Ergonomic Handle For Bathroom Kitchen Tile Sink Scrubbing Tool
$0.01-0.02
Mix MOQ : 4
 · 
29 sold recently
Cute Cartoon Hanging Hand Towels Coral Fleece Thickened Absorbent Quick Dry For Bathroom Kitchen Decorative Animal Cake Shapes Soft Touch
Cute Cartoon Hanging Hand Towels Coral Fleece Thickened Absorbent Quick Dry For Bathroom Kitchen Decorative Animal Cake Shapes Soft Touch
like
Find Similar
Cartoon panda hanging hand towel made of soft absorbent coral fleece for kitchen and bathroom - Moon Panda
Cute panda cartoon coral velvet hand towel in light green and purple with hanging loop - Planet Panda
Cute panda coral fleece hand towel in mint green with yellow crown and hanging loop - Star Panda
Cute panda coral fleece hand towel with absorbent microfiber and blue trim - Flower Panda
+37
Cute Cartoon Hanging Hand Towels Coral Fleece Thickened Absorbent Quick Dry For Bathroom Kitchen Decorative Animal Cake Shapes Soft Touch
$0.90-1.68
Mix MOQ : 2
 · 
975 sold recently
Top 3% Best Sellers
in Bathroom
Pebble Embossed Coral Fleece Bathroom Rug Collection Non Slip Absorbent Toilet Mat Lid Cover U-Shaped Rug Floor Door Mat
Pebble Embossed Coral Fleece Bathroom Rug Collection Non Slip Absorbent Toilet Mat Lid Cover U-Shaped Rug Floor Door Mat
like
Find Similar
Gray 4-piece bathroom rug set with cobblestone texture on modern white tile floor - 4-Piece Set (U-40*50+Lid 38*40+Mat 40*60+Mat 50*100) / Light Gray
4-piece brown pebble embossed coral fleece bathroom rug set with non-slip backing - 4-Piece Set (U-40*50+Lid 38*40+Mat 40*60+Mat 50*100) / Coffee
4-piece navy blue cobblestone embossed coral fleece bathroom rug set with non-slip backing - 4-Piece Set (U-40*50+Lid 38*40+Mat 40*60+Mat 50*100) / Navy Blue
Black 4-piece bathroom rug set with 3D pebble texture including bath mat and toilet cover - 4-Piece Set (U-40*50+Lid 38*40+Mat 40*60+Mat 50*100) / Black
+66
Pebble Embossed Coral Fleece Bathroom Rug Collection Non Slip Absorbent Toilet Mat Lid Cover U-Shaped Rug Floor Door Mat
-4%
$0.80-5.02
No MOQ
Natural Sisal Soap Bag Foaming Net Mesh Pouch Drawstring With Wooden Bead Exfoliating Body Scrubber Shower Accessories
Natural Sisal Soap Bag Foaming Net Mesh Pouch Drawstring With Wooden Bead Exfoliating Body Scrubber Shower Accessories
like
Find Similar
Natural sisal ramie soap saver bag with drawstring for exfoliating and foaming - 9x14cm / Knotted Mesh Soap Bag
Five natural ramie sisal soap saver bags with drawstring and dark brown wooden bead - 9x14cm / Mesh Soap Bag Dark Coffee Wood Bead
Set of two cream sisal soap saver bags with wooden beads for foaming and exfoliation - 9x14cm / Mesh Soap Bag with Dark Coffee Wood Bead
Natural sisal linen soap foaming bag with drawstring and wooden bead in beige - 9x14cm / Mesh Soap Bag White Wood Bead
+13
Natural Sisal Soap Bag Foaming Net Mesh Pouch Drawstring With Wooden Bead Exfoliating Body Scrubber Shower Accessories
$0.18-0.52
Mix MOQ : 2
 · 
1K+ sold recently
Top 10% Best Sellers
in Bathroom
Mushroom House Hanging Hand Towels Soft Coral Fleece Absorbent Cartoon Cloth For Bathroom And Kitchen Decor Novelty
Mushroom House Hanging Hand Towels Soft Coral Fleece Absorbent Cartoon Cloth For Bathroom And Kitchen Decor Novelty
like
Find Similar
Detail of mushroom-shaped coral fleece hand towel with hanging loop and thick absorbent texture - Purple
Detail of mushroom-shaped coral fleece hand towel with orange hanging loop and soft texture - Orange
Detail of coral fleece mushroom hand towel with hanging loop in soft pink and grey - Pink
Detail of mushroom house shaped hand towel in purple coral fleece with hanging loop - Milky White
Mushroom House Hanging Hand Towels Soft Coral Fleece Absorbent Cartoon Cloth For Bathroom And Kitchen Decor Novelty
$1.12
Mix MOQ : 2
 · 
297 sold recently
Top 10% Best Sellers
in Bathroom
Soft Flannel Jacquard Throw Blanket For Sofa Office Embossed Plush Warm Bed Cover Multi-Functional All Seasons
Soft Flannel Jacquard Throw Blanket For Sofa Office Embossed Plush Warm Bed Cover Multi-Functional All Seasons
like
Find Similar
Folded light green jacquard flannel blanket with white gift ribbon on a beige sofa - 70*100cm (No Ribbon/Card) / Sage Green
Folded soft peach flannel jacquard blanket with elegant ribbon and brand tag - 70*100cm (No Ribbon/Card) / Off White
Light blue faux rabbit fur flannel blanket with embossed floral pattern on a beige chair - 70*100cm (No Ribbon/Card) / Sky Blue
Pink embossed leaf flannel blanket folded with ribbon on a beige sofa - 70*100cm (No Ribbon/Card) / Pink
+52
Soft Flannel Jacquard Throw Blanket For Sofa Office Embossed Plush Warm Bed Cover Multi-Functional All Seasons
-5%
$2.74-12.32
No MOQ
 · 
140 sold recently
Thick Soft Faux Rabbit Fur Blanket Ribbed Striped 3D Texture Warm Flannel Sofa Throw Nap Bedding Cover Solid Color
Thick Soft Faux Rabbit Fur Blanket Ribbed Striped 3D Texture Warm Flannel Sofa Throw Nap Bedding Cover Solid Color
like
Find Similar
Thick pink rabbit faux fur blanket with striped embossed texture for sofa use - 100*150cm / Rabbit Plush Pink
Soft emerald green faux rabbit fur blanket with luxury 3D vertical striped texture - 100*150cm / Rabbit Plush Fruit Green
Thick caramel faux rabbit fur blanket with ribbed texture held by a model - 100*150cm / Rabbit Plush Caramel
Thick beige plush blanket with vertical stripe texture held by model for cozy comfort - 100*150cm / Rabbit Plush Khaki
+56
Thick Soft Faux Rabbit Fur Blanket Ribbed Striped 3D Texture Warm Flannel Sofa Throw Nap Bedding Cover Solid Color
$2.59-8.65
No MOQ
 · 
246 sold recently
Top 10% Best Sellers
in Bedding
Faux Cashmere Bath Mat Modern Nordic Absorbent Anti Slip Letter Print Soft Floor Rug Thick Plush Carpet For Bathroom Bedroom
Faux Cashmere Bath Mat Modern Nordic Absorbent Anti Slip Letter Print Soft Floor Rug Thick Plush Carpet For Bathroom Bedroom
like
Find Similar
Pink plush bath mat with Hello Beautiful script on bathroom floor with white bathtub - 40cmx60cm (Faux Cashmere) / hello beautiful Style (Rose Pink)
Plush black and white BATH lettered bath mat on modern hexagonal tile bathroom floor - 40cmx60cm (Faux Cashmere) / BATH Style (Black/White)
Plush minimalist Get Naked bath mat with black letters on white for bathroom decor - 40cmx60cm (Faux Cashmere) / GET NAKED Style (Black/White)
Thick non-slip letter bathroom mat with colorful Wash Your Hands slogan on cream rug - 40cmx60cm (Faux Cashmere) / WASH YOUR HANDS Style (Off-White)
+28
Faux Cashmere Bath Mat Modern Nordic Absorbent Anti Slip Letter Print Soft Floor Rug Thick Plush Carpet For Bathroom Bedroom
-5%
$0.99-7.88
No MOQ
 · 
18 views
Coral Fleece Bath Towel And Face Towel High Absorbency Soft Microfiber Bathroom Supplies For Adults Gift Wrap
Coral Fleece Bath Towel And Face Towel High Absorbency Soft Microfiber Bathroom Supplies For Adults Gift Wrap
like
Find Similar
Pink coral fleece towel and bath towel set with gold ribbon gift packaging - Towel And Bath Towel / Pink
Mint green coral fleece bath towel set tied with gold ribbon and gray label - Towel And Bath Towel / Green
Light blue coral fleece bath towel set tied with a golden ribbon for gift display - Towel And Bath Towel / Blue
Plush apricot coral fleece towel and bath towel set tied with elegant gold ribbon - Towel And Bath Towel / Camel
+11
Coral Fleece Bath Towel And Face Towel High Absorbency Soft Microfiber Bathroom Supplies For Adults Gift Wrap
-11%
$0.27-1.18
Mix MOQ : 2
 · 
716 sold recently
Top 10% Best Sellers
in Bathroom
Heart Shaped Chenille Bath Mat Rug Absorbent Non Slip Machine Washable Solid Color Floor Carpet For Bathroom Bedroom
Heart Shaped Chenille Bath Mat Rug Absorbent Non Slip Machine Washable Solid Color Floor Carpet For Bathroom Bedroom
like
Find Similar
Pink heart-shaped chenille bath mat with soft microfiber texture for bathroom floor - 40*50cm Heart Shape / Pink
Red heart-shaped chenille bath mat with soft absorbent plush texture for bathroom - 40*50cm Heart Shape / Brilliant Red
Pink heart-shaped chenille bathroom mat with soft absorbent non-slip texture - 40*50cm Heart Shape / Rose Red
Brown heart-shaped chenille bath mat with soft plush texture for bathroom use - 40*50cm Heart Shape / Coffee
+33
Heart Shaped Chenille Bath Mat Rug Absorbent Non Slip Machine Washable Solid Color Floor Carpet For Bathroom Bedroom
$1.41-4.08
No MOQ
 · 
183 sold recently
Hanging Hand Towel Coral Fleece Flower Shape Thick Super Absorbent Bathroom Kitchen Soft Cartoon
Hanging Hand Towel Coral Fleece Flower Shape Thick Super Absorbent Bathroom Kitchen Soft Cartoon
like
Find Similar
Plush purple flower-shaped coral velvet hand towel with a yellow center and hanging loop - Purple
Blue coral velvet flower hand towel with yellow center and orange hanging loop - Sky Blue
Hanging flower hand towel in light green coral fleece with orange center and hook - Light Green
Pink coral velvet flower hand towel with yellow hanging loop on bathroom wall - Rose Red
+3
Hanging Hand Towel Coral Fleece Flower Shape Thick Super Absorbent Bathroom Kitchen Soft Cartoon
-5%
$1.15-1.26
No MOQ
 · 
393 sold recently
Top 10% Best Sellers
in Bathroom
Hanging Hand Towels Coral Fleece Super Absorbent Soft Quick Dry Cartoon Animal Shape For Bathroom Kitchen
Hanging Hand Towels Coral Fleece Super Absorbent Soft Quick Dry Cartoon Animal Shape For Bathroom Kitchen
like
Find Similar
Hanging sky blue coral fleece hand towel featuring a green cartoon dinosaur design - Dinosaur-Bare / Blue
Absorbent white coral fleece towel featuring a cute rabbit head with carrot embroidery - White Rabbit-Bare / White
Hanging coral fleece hand towel with navy blue fabric and a cute yellow star doll - Star-Bare / Dark Blue
Absorbent yellow coral fleece hand towel with cartoon carrot design and wave trim - Carrot-Bare / Yellow
+6
Hanging Hand Towels Coral Fleece Super Absorbent Soft Quick Dry Cartoon Animal Shape For Bathroom Kitchen
$0.39-0.42
No MOQ
 · 
1K+ sold recently
Top 10% Best Sellers
in Bathroom
Solid Color Waterproof Polyester Shower Curtain Metal Grommets Hooks Mildew Resistant Washable Modern Bathroom Decor
Solid Color Waterproof Polyester Shower Curtain Metal Grommets Hooks Mildew Resistant Washable Modern Bathroom Decor
like
Find Similar
Solid white waterproof fabric shower curtain with metal hooks for bathroom bathtub decor - 180x180cm / White
Solid black waterproof fabric shower curtain with silver metal rings and fabric texture - 90x180cm / Black
Waterproof solid gray polyester shower curtain with metal grommets hanging on a rod - 90x180cm / Gray
Detail of burgundy waterproof shower curtain fabric with elegant drape in modern bathroom - 90x180cm / Dark Red
+18
Solid Color Waterproof Polyester Shower Curtain Metal Grommets Hooks Mildew Resistant Washable Modern Bathroom Decor
-5%
$2.09-4.01
No MOQ
 · 
53 sold recently
Embossed Pebble Coral Fleece Bathroom Mat Absorbent Non-Slip Floor Rug For Shower Entryway Kitchen Home Decor
Embossed Pebble Coral Fleece Bathroom Mat Absorbent Non-Slip Floor Rug For Shower Entryway Kitchen Home Decor
like
Find Similar
Absorbent black pebble textured memory foam bath mat with non-slip backing - Batch Custom Specification / Black
Vibrant red pebble texture coral fleece floor mat with a soft plush surface detail - Batch Custom Specification / Red
Absorbent purple pebble textured bath mat made of memory foam with 3D embossed pattern - Batch Custom Specification / Sapphire Blue
Pink embossed pebble coral fleece bath mat with non-slip texture for bathroom - Batch Custom Specification / Pink
+40
Embossed Pebble Coral Fleece Bathroom Mat Absorbent Non-Slip Floor Rug For Shower Entryway Kitchen Home Decor
-5%
$0.82-2.07
No MOQ
Bath Loofah Sponge Soft PE Mesh Shower Pouf Rich Lather Exfoliating Body Scrubber With Hanging Rope Colorful
Bath Loofah Sponge Soft PE Mesh Shower Pouf Rich Lather Exfoliating Body Scrubber With Hanging Rope Colorful
like
Find Similar
Soft cream white mesh shower loofah with white hanging rope for gentle bathing - 20g / Bulk Pack / Beige
Extra soft mesh bath sponge in black and grey on a wooden tray for deep foaming - 50g / Bamboo Charcoal Type / Black and Gray
Soft black charcoal mesh bath loofah ball with a durable hanging rope for deep cleaning - 60g / Two-color Bamboo Charcoal / Black
Pink and white mesh bath sponge with hanging rope on a wooden background - 50g / Pink Turtle Shaped / Pink + White
+5
Bath Loofah Sponge Soft PE Mesh Shower Pouf Rich Lather Exfoliating Body Scrubber With Hanging Rope Colorful
$0.13-0.57
No MOQ
 · 
2K+ sold recently
Soft Flannel Fleece Blanket Warm Thick Throw For Sofa Bed Travel Cartoon Pattern Reindeer Star Cloud Plaid Skin Friendly
Soft Flannel Fleece Blanket Warm Thick Throw For Sofa Bed Travel Cartoon Pattern Reindeer Star Cloud Plaid Skin Friendly
like
Find Similar
Thick blue flannel blanket with white deer and snowflake patterns folded on a bed - Lucky Deer / 70x100cm
Soft flannel blanket with white clouds and rain patterns in dark grey blue color - Cloud Love / 70x100cm
White flannel blanket featuring red moon and burgundy star patterns in a folded display - Star Moon Myth / 100x150cm
Thick flannel blanket featuring a blue, grey, and white plaid pattern for home warmth - Grid Style / 100x150cm
+31
Soft Flannel Fleece Blanket Warm Thick Throw For Sofa Bed Travel Cartoon Pattern Reindeer Star Cloud Plaid Skin Friendly
$0.52-6.34
No MOQ
 · 
732 sold recently
Top 10% Best Sellers
in Bedding
Blanket Throw Taffeta Plush And Sherpa Fleece Double Sided Thickened Geometric Diamond Pattern Bed Sofa Nap Modern Simple
Blanket Throw Taffeta Plush And Sherpa Fleece Double Sided Thickened Geometric Diamond Pattern Bed Sofa Nap Modern Simple
like
Find Similar
Thick double-sided blanket in sage green with textured diamond pattern and white fleece - Fruit Green / 70*100CM
Thick ginger yellow plush blanket with white sherpa lining and diamond knit texture - Turmeric / 70*100CM
Brown fleece blanket with geometric diamond pattern and white sherpa lining for warmth - Coffee / 70*100CM
Thick coffee brown diamond textured fleece blanket with soft white sherpa lining - Khaki / 70*100CM
+51
Blanket Throw Taffeta Plush And Sherpa Fleece Double Sided Thickened Geometric Diamond Pattern Bed Sofa Nap Modern Simple
$2.59-13.98
No MOQ
 · 
5K+ sold recently
Waterproof Shower Curtain PEVA EVA Thickened Mildew Resistant With Hooks Solid Color 3D Pattern Bathroom Decor
Waterproof Shower Curtain PEVA EVA Thickened Mildew Resistant With Hooks Solid Color 3D Pattern Bathroom Decor
like
Find Similar
Detail showing high-quality waterproof sky blue PEVA shower curtain with natural vertical drape - 180*180CM / Cyan Blue
Close-up of translucent PEVA shower curtain with waterproof 3D pebble texture pattern - 180*180CM / 3D Pebble Pattern With Steel Eyelet Magnet
Translucent dark grey waterproof PEVA shower curtain with 3D pebble texture design - 180*180CM / Grey 3D Pebble With Steel Eyelet Magnet
Solid black waterproof PEVA shower curtain with matte texture and white plastic hooks - 180*180CM / Black
+63
Waterproof Shower Curtain PEVA EVA Thickened Mildew Resistant With Hooks Solid Color 3D Pattern Bathroom Decor
-5%
$1.26-3.72
No MOQ
 · 
193 sold recently
Waterproof Polyester Shower Curtain And Anti Slip Flannel Bathroom Mats Toilet Cover Mandala Bohemian Holiday Home Decor
Waterproof Polyester Shower Curtain And Anti Slip Flannel Bathroom Mats Toilet Cover Mandala Bohemian Holiday Home Decor
like
Find Similar
Mandala patterned 4-piece bathroom set with shower curtain and matching floor mats - Shower Curtain 90x180 / Multicolor Mandala (kq001)
Waterproof polyester bathroom set with red mandala pattern shower curtain and floor mats - Shower Curtain 90x180 / Red & Beige Mandala (kq002)
4-piece bathroom set with purple and gold mandala shower curtain and matching rugs - Shower Curtain 90x180 / Purple & Gold Mandala (kq003)
Blue and purple mandala boho shower curtain with matching non-slip bath mat four-piece set - Shower Curtain 90x180 / Blue & Purple Gradient Mandala (kq004)
+76
Waterproof Polyester Shower Curtain And Anti Slip Flannel Bathroom Mats Toilet Cover Mandala Bohemian Holiday Home Decor
$4.90-12.97
Mix MOQ : 2
 · 
41 views
Free Shipping
Modern Minimalist Bathroom Non-Slip Water Absorbent Quick Dry Tech Fleece Mat With Home Lettering And Toilet Rug Accessory Items
Modern Minimalist Bathroom Non-Slip Water Absorbent Quick Dry Tech Fleece Mat With Home Lettering And Toilet Rug Accessory Items
like
Find Similar
3-piece absorbent diatom mud bathroom mat set with HOME text in black and grey - 30x40cm / Black
Modern 3-piece absorbent diatomaceous earth bath mat set with HOME text in grey and blue - 30x40cm / Blue
Three-piece absorbent gray and beige diatom mud bathroom mat set with modern geometry - 30x40cm Small Drain Mat / Light Gray
Three-piece absorbent bathroom mat set featuring grey geometric design and HOME print - 30x40cm / Dark Gray
+36
Modern Minimalist Bathroom Non-Slip Water Absorbent Quick Dry Tech Fleece Mat With Home Lettering And Toilet Rug Accessory Items
-5%
$0.92-9.50
No MOQ
Free Shipping
Hanging Hand Towel Cartoon Animal Fruit Shape Coral Fleece High Absorbent Soft Microfiber Bathroom Kitchen Washcloth
Hanging Hand Towel Cartoon Animal Fruit Shape Coral Fleece High Absorbent Soft Microfiber Bathroom Kitchen Washcloth
like
Find Similar
Absorbent coral fleece hand towel with cute yellow carrot design and hanging loop - Carrot Style / Yellow
Blue coral velvet hanging towel with cute dinosaur plush design for bathroom - Dinosaur Style / Blue
Pink coral fleece hanging hand towel with cute watermelon design for home use - Watermelon Style / Pink
White goose hanging hand towel in soft plush coral fleece, 23x32cm for bathroom use - Goose Style / White
+19
Hanging Hand Towel Cartoon Animal Fruit Shape Coral Fleece High Absorbent Soft Microfiber Bathroom Kitchen Washcloth
$0.44-1.21
No MOQ
 · 
41 sold recently
Cute Cartoon Animal Hand Towels Coral Fleece Absorbent Hanging Loop Bathroom Kitchen Quick Dry For Kids Koala Capybara
Cute Cartoon Animal Hand Towels Coral Fleece Absorbent Hanging Loop Bathroom Kitchen Quick Dry For Kids Koala Capybara
like
Find Similar
Cute gray koala cartoon hanging hand towel made of absorbent coral velvet material - 18*23cm / Koala
Cute orange fox cartoon hand towel made of absorbent coral fleece with a hanging loop - 18*23cm / Fox
Absorbent grey elephant hand towel in coral fleece with dots and hanging loop - 18*23cm / Elephant
Dark blue coral fleece hanging hand towel with cute cartoon pig and gold crown - 26*36cm / Blue Pig
+6
Cute Cartoon Animal Hand Towels Coral Fleece Absorbent Hanging Loop Bathroom Kitchen Quick Dry For Kids Koala Capybara
-5%
$0.69-0.93
No MOQ
 · 
106 sold recently
Top 10% Best Sellers
in Bathroom
Soap Foaming Net Bag Multi-Layer PE Mesh Quick Foaming Pouch With Drawstring Bathroom Storage Macaron Colors
Soap Foaming Net Bag Multi-Layer PE Mesh Quick Foaming Pouch With Drawstring Bathroom Storage Macaron Colors
like
Find Similar
White multi-layer nylon foaming net with adjustable drawstring and toggle closure - Beige
Multi-layer thickened purple mesh foaming bag with drawstring and plastic bead closure - Violet
Blue multilayer mesh soap foaming net with a white drawstring and secure round stopper - Verdant
Pink multi-layer mesh foaming net bag for soap and cleanser with white drawstring - Pink
Soap Foaming Net Bag Multi-Layer PE Mesh Quick Foaming Pouch With Drawstring Bathroom Storage Macaron Colors
$0.20
No MOQ
 · 
972 sold recently
Natural Bamboo Wooden Soap Dish Self-Draining Slotted Soap Tray For Bathroom Shower Kitchen Eco-Friendly Minimalist
Natural Bamboo Wooden Soap Dish Self-Draining Slotted Soap Tray For Bathroom Shower Kitchen Eco-Friendly Minimalist
like
Find Similar
Bamboo soap dish in natural wood color measuring 8.8cm by 8.4cm with drainage bars - Natural Wood Style 01
Bamboo soap dish holder 11.8cm x 8.8cm in natural wood finish with drainage bars - Natural Wood Style 02
Dark brown rectangular wooden soap dish with drainage slats, size 11.8cm by 8.5cm - Dark Wood Style 03
Bamboo soap dish 11.5cm x 8cm with slatted design for quick drainage in wood color - Natural Wood Style 04
+8
Natural Bamboo Wooden Soap Dish Self-Draining Slotted Soap Tray For Bathroom Shower Kitchen Eco-Friendly Minimalist
-5%
$0.24-1.51
No MOQ
 · 
2K+ sold recently
Top 5% Best Sellers
in Bathroom
Rose Flower Shape Bath Ball Shower Sponge PE Mesh Loofah Body Cleaning Rich Lathering Soft Pouf With Hanging Ribbon
Rose Flower Shape Bath Ball Shower Sponge PE Mesh Loofah Body Cleaning Rich Lathering Soft Pouf With Hanging Ribbon
like
Find Similar
Rose-shaped red mesh shower loofah with delicate ribbon detail and elegant petal design - Ribbon Style / Burgundy
Blue rose shaped exfoliating bath sponge with hanging ribbon for rich lathering foam - Ribbon Style / Navy Blue
Rose-shaped bath sponge in beige and sea green mesh with a practical hanging strap - Ribbon Style / Light Green
Pink and cream gradient rose bath sponge with delicate PE mesh and hanging rope - Ribbon Style / Pink
+4
Rose Flower Shape Bath Ball Shower Sponge PE Mesh Loofah Body Cleaning Rich Lathering Soft Pouf With Hanging Ribbon
$0.92
No MOQ
 · 
371 sold recently
Top 5% Best Sellers
in Household Cleaning & Personal Care
Soft Bath Sponge Shower Ball PE Mesh Polyester Lace For Body Cleaning Bathroom Accessories With Hanging Rope
Soft Bath Sponge Shower Ball PE Mesh Polyester Lace For Body Cleaning Bathroom Accessories With Hanging Rope
like
Find Similar
Pink PE mesh bath sponge with gray FUJIE hanging rope, 14cm diameter exfoliating loofah - Nordic Pink
Nordic blue PE bath sponge loofah with 14cm diameter and grey hanging strap for shower - Nordic Blue
Creamy white PE mesh bath sponge with grey hanging rope and 14cm diameter size - Nordic Beige
Soft Bath Sponge Shower Ball PE Mesh Polyester Lace For Body Cleaning Bathroom Accessories With Hanging Rope
$0.86
No MOQ
 · 
217 sold recently
Lotus Flower Silicone Soap Dish Self Draining Flexible Holder Tray For Bathroom Kitchen Shower Sink Waterproof Soap Saver
Lotus Flower Silicone Soap Dish Self Draining Flexible Holder Tray For Bathroom Kitchen Shower Sink Waterproof Soap Saver
like
Find Similar
Close-up of blue lotus-shaped silicone soap dish with drainage holes on a yellow background - Navy Blue
Pink lotus flower silicone soap dish with non-slip spikes and drainage holes - Pink
Lotus shaped grey silicone soap dish with non-slip texture and drainage holes - Gray
Light blue lotus silicone soap dish with non-slip drainage holes for bathroom vanity - Sky Blue
+5
Lotus Flower Silicone Soap Dish Self Draining Flexible Holder Tray For Bathroom Kitchen Shower Sink Waterproof Soap Saver
$0.27
No MOQ
 · 
4K+ sold recently
Top 3% Best Sellers
in Bathroom
Faux Fur Throw Blanket Thickened Long Plush Bubble Texture Solid Color Warm Soft Cozy Fleece For Bed Sofa Office
Faux Fur Throw Blanket Thickened Long Plush Bubble Texture Solid Color Warm Soft Cozy Fleece For Bed Sofa Office
like
Find Similar
Detail shot of grey faux rabbit fur blanket with textured wavy patterns on a chair - Light Gray / 100×160cm
Close-up of thick coffee brown plush blanket with luxury faux rabbit fur stripe texture - Brown / 180*200cm
White faux fur blanket with 3D striped texture on a grey modern armchair in a cozy room - White / 160×200cm
Detailed texture of thick beige faux rabbit fur blanket with wavy embossed patterns - Camel / 160×200cm
+41
Faux Fur Throw Blanket Thickened Long Plush Bubble Texture Solid Color Warm Soft Cozy Fleece For Bed Sofa Office
$2.82-29.68
No MOQ
 · 
66 sold recently
Towel And Bath Towel Coral Fleece Wide Striped Super Absorbent Soft Thick Gift Wrap Bathroom Home Spa
Towel And Bath Towel Coral Fleece Wide Striped Super Absorbent Soft Thick Gift Wrap Bathroom Home Spa
like
Find Similar
Brown and white striped coral fleece towel set with gift ribbon and packaging card - Towel And Bath Towel / Coffee
Absorbent purple and white striped coral fleece towel set with decorative gold ribbon - Towel And Bath Towel / Purple
Absorbent green and white striped coral fleece bath towel set with yellow ribbon gift wrap - Towel And Bath Towel / Green
Absorbent blue and white striped coral fleece towel set with decorative gift ribbon - Towel And Bath Towel / Blue
+1
Towel And Bath Towel Coral Fleece Wide Striped Super Absorbent Soft Thick Gift Wrap Bathroom Home Spa
-4%
$1.59
No MOQ
 · 
246 sold recently
Faux Cowhide Print Flannel Blanket Western Cowboy Style Soft Warm Throw For Sofa Bed Home Decor Pastoral
Faux Cowhide Print Flannel Blanket Western Cowboy Style Soft Warm Throw For Sofa Bed Home Decor Pastoral
like
Find Similar
Faux cowhide print flannel blanket with brown and white patchwork for sofa or bed - Cowhide Patchwork-1 / 70x100cm
Fleece cow print blanket with Western cowboy motif and cactus pattern for sofa - Western Cowboy-2 / 70x100cm
Faux fur flannel blanket featuring a black and white diamond plaid pattern on a sofa - Black White Plaid-3 / 70x100cm
Faux cowhide print flannel blanket featuring bull and bear silhouette on grey sofa - Bull & Bear-4 / 70x100cm
+116
Faux Cowhide Print Flannel Blanket Western Cowboy Style Soft Warm Throw For Sofa Bed Home Decor Pastoral
$3.14-24.78
No MOQ
 · 
68 sold recently
Cartoon Animal Fruit Hanging Hand Towels Super Absorbent Coral Fleece Quick Dry Bathroom Kitchen Thick Soft
Cartoon Animal Fruit Hanging Hand Towels Super Absorbent Coral Fleece Quick Dry Bathroom Kitchen Thick Soft
like
Find Similar
Close-up of pink coral fleece hanging hand towel with floral top on white wood surface - Small / Red
Detail of light blue coral fleece hand towel with pink floral trim and hanging loop - Small / Green
Detail of hanging blue coral fleece hand towel with apple print loop on white wood background - Small / Blue
Close-up of soft coral fleece hand towel with cute cartoon print and ruffle edge - Small / Pink (Cartoon Style)
+21
Cartoon Animal Fruit Hanging Hand Towels Super Absorbent Coral Fleece Quick Dry Bathroom Kitchen Thick Soft
$0.19-0.72
No MOQ
 · 
720 sold recently
Microfiber Bath Mat Absorbent Flocking Non Slip Bathroom Rug With Slogan Lettering Soft Shaggy Foot Pad For Shower Entrance
Microfiber Bath Mat Absorbent Flocking Non Slip Bathroom Rug With Slogan Lettering Soft Shaggy Foot Pad For Shower Entrance
like
Find Similar
Pink absorbent flocked bath mat with red Get Naked text for bathroom anti-slip use - 40*60cm / GET NAKED-Pink Base Red Letter
Absorbent rectangular bathroom mat in black featuring white Get Naked flocked lettering - 40*60cm / GET NAKED-Black Base White Letter
White rectangular bathroom mat with black Get Naked lettering in soft cotton fabric - 50*80cm / GET NAKED-White Base Black Letter
Absorbent black bathroom mat with colorful Get Naked text and soft tufted texture - 50*80cm / GET NAKED-Black Base Colorful Letter
+6
Microfiber Bath Mat Absorbent Flocking Non Slip Bathroom Rug With Slogan Lettering Soft Shaggy Foot Pad For Shower Entrance
-5%
$4.11-9.64
No MOQ
 · 
20 sold recently
Chenille Bathroom Rug Non Slip Absorbent Floor Mat Soft Microfiber Shaggy Carpet For Bath Room Bedroom Entryway
Chenille Bathroom Rug Non Slip Absorbent Floor Mat Soft Microfiber Shaggy Carpet For Bath Room Bedroom Entryway
like
Find Similar
Absorbent grey chenille bathroom mat with non-slip texture and high water absorption - 50*140CM / Dark Gray
Absorbent grey chenille bath mat with soft granular texture on a tiled floor - 50*140CM / Light Gray
Top view of a blue rectangular chenille bath mat with soft texture in a modern bathroom - 50*120CM / Dark Blue
Beige chenille bathroom mat with soft absorbent microfibers on white tile floor - 50*120CM / Camel
+24
Chenille Bathroom Rug Non Slip Absorbent Floor Mat Soft Microfiber Shaggy Carpet For Bath Room Bedroom Entryway
$4.07-11.53
No MOQ
 · 
45 sold recently
Striped Coral Velvet Bathroom Towel And Face Wash Cloth Soft Absorbent Thickened Home Essentials
Striped Coral Velvet Bathroom Towel And Face Wash Cloth Soft Absorbent Thickened Home Essentials
like
Find Similar
Absorbent green and white striped towel set featuring thick cotton textured fabric - 35*75cm Towel / Green
Absorbent blue and white striped plush towels set with reinforced white edges - 35*75cm Towel / Blue
Thick grey and white striped absorbent microfiber face towel set with hemmed edges - 35*75cm Towel / Gray
Thick purple and white striped coral fleece towel set with soft absorbent texture - 35*75cm Towel / Purple
+14
Striped Coral Velvet Bathroom Towel And Face Wash Cloth Soft Absorbent Thickened Home Essentials
$0.49-2.07
No MOQ
 · 
307 sold recently
Modern Striped Soft Plush Bath Mat Absorbent Anti-Slip Flocking Bathroom Rug Machine Washable Home Floor Mat Shower Rug
Modern Striped Soft Plush Bath Mat Absorbent Anti-Slip Flocking Bathroom Rug Machine Washable Home Floor Mat Shower Rug
like
Find Similar
Plush striped gray and white non-slip bath mat next to a bathtub for home bathroom - Small Style / Simple Life-Gray
Plush non-slip bathroom rug with black, grey and white stripes next to a white bathtub - Small Style / Simple Life-Black
Absorbent pink and white striped plush bath mat with a soft non-slip surface for bathrooms - Small Style / Simple Life-Pink Striped
Striped blue and grey plush absorbent bathroom mat on white marble floor by bathtub - Small Style / Simple Life-Blue Striped
+8
Modern Striped Soft Plush Bath Mat Absorbent Anti-Slip Flocking Bathroom Rug Machine Washable Home Floor Mat Shower Rug
-4%
$3.81-8.77
No MOQ
Checkerboard Waffle Pattern Soft Plush Blanket Thickened Flannel Sofa Throw For Couch Bed Warm Decorative Cozy Bedspread
Checkerboard Waffle Pattern Soft Plush Blanket Thickened Flannel Sofa Throw For Couch Bed Warm Decorative Cozy Bedspread
like
Find Similar
Soft light beige waffle weave plush blanket folded neatly on a cozy lamb wool sofa - Off White / 70*100CM
Folded gray waffle texture checkered fleece blanket on cozy soft cream sofa background - Lake Blue / 70*100CM
Thick dark grey checkerboard waffle blanket made of soft plush coral fleece - Dark Gray / 70*100CM
Thickened mustard yellow checkered plush blanket with soft fleece texture on sofa - Yellow / 70*100CM
+59
Checkerboard Waffle Pattern Soft Plush Blanket Thickened Flannel Sofa Throw For Couch Bed Warm Decorative Cozy Bedspread
-5%
$2.68-10.95
No MOQ
 · 
465 sold recently
Honeycomb Sponge Bath Ball Soft Cheese Shape Shower Loofah For Exfoliating Body Cleaning With Hanging Rope
Honeycomb Sponge Bath Ball Soft Cheese Shape Shower Loofah For Exfoliating Body Cleaning With Hanging Rope
like
Find Similar
Purple teardrop honeycomb bath sponge with hanging rope on stone pedestal - Purple
Bright green honeycomb bath sponge with soft porous texture and white hanging rope - Matcha Green
Blue honeycomb bath sponge with soft texture and white hanging cord on stone surface - Ocean Blue
Yellow honeycomb bath sponge with white hanging rope on a natural stone surface - Yellow
+3
Honeycomb Sponge Bath Ball Soft Cheese Shape Shower Loofah For Exfoliating Body Cleaning With Hanging Rope
-5%
$0.56
Mix MOQ : 2
 · 
413 sold recently
Highland Cow Printed Flannel Blanket Polyester Warm Throw Blanket For Couch Sofa Bed Home Decor Digital Print Blanket
Highland Cow Printed Flannel Blanket Polyester Warm Throw Blanket For Couch Sofa Bed Home Decor Digital Print Blanket
like
Find Similar
Highland cow flannel blanket with floral art print draped on a pink armchair - 100x150cm
Highland Cow Printed Flannel Blanket Polyester Warm Throw Blanket For Couch Sofa Bed Home Decor Digital Print Blanket
-5%
$4.52
No MOQ
 · 
32 sold recently
Soft PE Mesh Bath Ball Double Color Stitching Shower Sponge With Lanyard For Deep Cleaning Body Scrubber
Soft PE Mesh Bath Ball Double Color Stitching Shower Sponge With Lanyard For Deep Cleaning Body Scrubber
like
Find Similar
Dual-tone soft bath sponge in white and pink PE mesh with a thick hanging cord - 50 g / Pink + Beige
Soft PE Mesh Bath Ball Double Color Stitching Shower Sponge With Lanyard For Deep Cleaning Body Scrubber
$0.43
Mix MOQ : 2
 · 
67 sold recently
Coral Fleece Blanket Wheat Grain Pattern Thickened Soft Flannel Throw For Sofa Bed Couch Air Conditioning Nap Travel Cozy
Coral Fleece Blanket Wheat Grain Pattern Thickened Soft Flannel Throw For Sofa Bed Couch Air Conditioning Nap Travel Cozy
like
Find Similar
Navy blue coral fleece blanket with herringbone texture neatly folded with a ribbon - Gray Blue / 70*100cm Bare Blanket
Folded lavender coral fleece blanket with wheat ear pattern and grey gift packaging - Lotus Root Pink / 70*100cm Bare Blanket
Yellow thick coral fleece blanket with herringbone pattern folded on a gold chair - Bright Yellow / 70*100cm Bare Blanket
Dark blue coral fleece blanket with herringbone texture tied in a grey gift ribbon - Deep Blue / 70*100cm Bare Blanket
+76
Coral Fleece Blanket Wheat Grain Pattern Thickened Soft Flannel Throw For Sofa Bed Couch Air Conditioning Nap Travel Cozy
-16%
$1.04-11.53
No MOQ
 · 
4K+ sold recently
Top 1% Best Sellers
in Bedding
Soft Memory Foam Bath Mat Coral Velvet Absorbent Non-Slip Washable Rug For Bathroom Entryway Bedroom Kitchen Solid Color Floor Mat
Soft Memory Foam Bath Mat Coral Velvet Absorbent Non-Slip Washable Rug For Bathroom Entryway Bedroom Kitchen Solid Color Floor Mat
like
Find Similar
Absorbent white memory foam bath mat on modern bathroom floor near the bathtub - Beige / 40*60cm
Plush burgundy memory foam bath mat with rounded edges shown in a modern bathroom setup - Burgundy / 40*60cm
Absorbent memory foam bath mat in dark brown coral velvet for bathroom and home - Coffee / 40*60cm
Detail of cream memory foam bath mat with soft texture on grey stone floor decor - Camel / 40*60cm
+35
Soft Memory Foam Bath Mat Coral Velvet Absorbent Non-Slip Washable Rug For Bathroom Entryway Bedroom Kitchen Solid Color Floor Mat
-4%
$0.79-1.78
No MOQ
Thailand Natural Latex Cooling Mat With Bio Based Satin Fabric Breathable Washable Summer Bedding Cover And Pillowcases
Thailand Natural Latex Cooling Mat With Bio Based Satin Fabric Breathable Washable Summer Bedding Cover And Pillowcases
like
Find Similar
Premium pine green Thai ice silk latex cooling mat 3-piece set with textured pattern - 150cmx200cm / Turquoise Y-Pattern
Premium light pink ice silk latex bedding mat set with Rainbow Sailing pattern - 150cmx200cm / Rainbow Sailing (Light Pink)
Ice silk latex cooling mat three-piece set with light blue rainbow sailing patterns - 150cmx200cm / Rainbow Sailing (Light Blue)
Premium ice silk latex cooling mat 3-piece bedding set with floral pattern in blue - 180cmx200cm / Shangri-La
+124
Thailand Natural Latex Cooling Mat With Bio Based Satin Fabric Breathable Washable Summer Bedding Cover And Pillowcases
$56.20-79.25
No MOQ
 · 
30 views
Bathtub Shaped Soap Dish Creative ABS Plastic Soap Holder With Pink Bow And Silver Edge Decorative Bathroom Accessory
Bathtub Shaped Soap Dish Creative ABS Plastic Soap Holder With Pink Bow And Silver Edge Decorative Bathroom Accessory
like
Find Similar
Cream bathtub-shaped soap dish with pink bow and drain holes for bathroom counters - Plain Style / Beige
Creamy yellow bathtub soap dish with pink bow accent and silver trim drainage holder - Luxury Silver Plated Style / Beige
Bathtub Shaped Soap Dish Creative ABS Plastic Soap Holder With Pink Bow And Silver Edge Decorative Bathroom Accessory
$1.30-1.44
No MOQ
 · 
118 sold recently
Soft Throw Blanket Solid Color 3D Jacquard Diamond Pattern Flannel Fleece For Sofa Bed All Seasons Warm Cozy Plush Cover
Soft Throw Blanket Solid Color 3D Jacquard Diamond Pattern Flannel Fleece For Sofa Bed All Seasons Warm Cozy Plush Cover
like
Find Similar
Solid cream white cable knit throw blanket with thick textured pattern on grey armchair - Off-white / 70*100CM
Soft cream-white 3D jacquard flannel blanket with elegant textured knit pattern - Khaki / 100*120CM
Dark gray flannel blanket with 3D embossed weave texture draped over a velvet chair - Blue Gray / 70*100CM
Solid color 3D jacquard flannel blanket in dark grey with cable knit texture on chair - Dark Gray / 70*100CM
+68
Soft Throw Blanket Solid Color 3D Jacquard Diamond Pattern Flannel Fleece For Sofa Bed All Seasons Warm Cozy Plush Cover
-5%
$2.05-9.59
No MOQ
 · 
71% reordered
Top 3% Best Sellers
in Bedding
Checkerboard Plush Blanket Panda Velvet Soft Thick Double Sided Warm Throw For Sofa Bed Office Couch Plaid Pattern
Checkerboard Plush Blanket Panda Velvet Soft Thick Double Sided Warm Throw For Sofa Bed Office Couch Plaid Pattern
like
Find Similar
Pink and white rhombic pattern plush blanket with ultra-soft faux fur texture - Pink Plaid / 70x100cm
Plush black and white checkered sherpa blanket and pillowcase set for bedroom - Black and White Plaid / 70x100cm
Soft yellow and white checkered plush blanket with matching pillowcases in a cozy bedroom - Yellow White Plaid / 70x100cm
Brown and white checkerboard plush blanket made of soft shumei fleece material - Coffee and White Grid / 70x100cm
+32
Checkerboard Plush Blanket Panda Velvet Soft Thick Double Sided Warm Throw For Sofa Bed Office Couch Plaid Pattern
$2.54-11.76
No MOQ
 · 
437 sold recently
Modern Minimalist Imitation Cashmere Wave Shape Non-Slip Bath Mat Absorbent Bedroom Living Room Rug Decorative Floor Carpet
Modern Minimalist Imitation Cashmere Wave Shape Non-Slip Bath Mat Absorbent Bedroom Living Room Rug Decorative Floor Carpet
like
Find Similar
Modern wavy faux cashmere bath mat with brown and beige color blocking on gray tile - 40*60cm / Brown And Beige Wave Style(LTG001)
Modern minimalist faux cashmere wave-shaped bath mat with plush orange and brown layers - 40*60cm / Orange And Beige Bone Shape Style(LTG002)
Modern minimalist green wavy faux cashmere rug for bedroom and bathroom decor - 40*60cm / Green And White Wave Style(LTG003)
Modern wavy faux cashmere rug in dark coffee and beige colors for cozy home decor - 40*60cm / Deep Coffee And Beige Wave Style(LTG004)
+76
Modern Minimalist Imitation Cashmere Wave Shape Non-Slip Bath Mat Absorbent Bedroom Living Room Rug Decorative Floor Carpet
-5%
$1.51-37.78
No MOQ
Free Shipping
Bathroom Bath Mat Water Absorbent Non Slip Microfiber Rug Plush Textured Wave Design Machine Washable Fast Drying Home Shower
Bathroom Bath Mat Water Absorbent Non Slip Microfiber Rug Plush Textured Wave Design Machine Washable Fast Drying Home Shower
like
Find Similar
Absorbent grey bathroom rug with wave texture on modern tiled floor near shower - 40*60cm / Dark Grey (Stuart Series)
Grey wave-textured absorbent bath mat for bathroom use on a modern tile floor - 40*60cm / Light Grey (Stuart Series)
Absorbent beige rectangular bath mat with wave texture on a gray bathroom tile floor - 40*60cm / Khaki (Stuart Series)
Absorbent blue plush bathroom mat with wave pattern on modern grey tile floor - 50*80cm / Blue (Stuart Series)
+54
Bathroom Bath Mat Water Absorbent Non Slip Microfiber Rug Plush Textured Wave Design Machine Washable Fast Drying Home Shower
$7.46-21.87
Mix MOQ : 3
 · 
25 views
Waterproof Polyester Shower Curtain And Non Slip Bathroom Rugs With Toilet Lid Cover Marble Floral Print Bathroom Decor
Waterproof Polyester Shower Curtain And Non Slip Bathroom Rugs With Toilet Lid Cover Marble Floral Print Bathroom Decor
like
Find Similar
Detailed view of waterproof bathroom curtain featuring realistic green grass and dew print - 150*180cm / YS-B Green Grass Dew
Waterproof white marble pattern shower curtain hanging in a modern gray bathroom - 150*180cm / YS-A White Marble
Detail view of 3D shower curtain featuring heart beach pattern and pink rose floral print - 150*180cm / YS-E Beach Hearts
Modern 3D shower curtain featuring vivid blue roses on a dark grey brick wall background - 150*180cm / YS-D Blue Rose Brick
+26
Waterproof Polyester Shower Curtain And Non Slip Bathroom Rugs With Toilet Lid Cover Marble Floral Print Bathroom Decor
-4%
$6.17-9.73
No MOQ
Soft Mesh Bath Shower Ball Exfoliating Body Sponge With Hanging Rope Charcoal PE Net For Deep Cleaning
Soft Mesh Bath Shower Ball Exfoliating Body Sponge With Hanging Rope Charcoal PE Net For Deep Cleaning
like
Find Similar
Soft cream white mesh shower loofah with white hanging rope for gentle bathing - 20g / Beige
Soft black charcoal mesh bath loofah ball with a durable hanging rope for deep cleaning - 60g / Dual Color Black (Charcoal)
Large black and white dual-tone charcoal bath sponge on a wooden tray for soft skin exfoliation - 50 g / Dual Color Black (Charcoal)
Soft pink charcoal mesh bath sponge with white hanging rope on a wooden surface - 20g / Pink
+1
Soft Mesh Bath Shower Ball Exfoliating Body Sponge With Hanging Rope Charcoal PE Net For Deep Cleaning
$0.13-0.40
No MOQ
 · 
1K+ sold recently
Embossed Microfiber Bath Towel Cartoon Bear Pattern Soft Absorbent Quick Dry For Kids Adults Home
Embossed Microfiber Bath Towel Cartoon Bear Pattern Soft Absorbent Quick Dry For Kids Adults Home
like
Find Similar
Detail of soft microfiber bath towel with embossed bear pattern in various colors - 100g 70*140cm / Blue
Detailed view of embossed bear and heart patterns on thick microfiber bath towels - 150g 70*140cm / Mixed Color
Pink microfiber bath towel with embossed bear design and soft textured finish - 100g 70*140cm / Pink
Absorbent light green microfiber bath towel with embossed cartoon bear and flower design - 100g 70*140cm / Green
+51
Embossed Microfiber Bath Towel Cartoon Bear Pattern Soft Absorbent Quick Dry For Kids Adults Home
$0.52-2.74
No MOQ
 · 
118 sold recently
Cute Cartoon Animal Flower Bath Mat Faux Cashmere Non-Slip Absorbent Entrance Rug For Bathroom Kitchen Doorway Home Decor
Cute Cartoon Animal Flower Bath Mat Faux Cashmere Non-Slip Absorbent Entrance Rug For Bathroom Kitchen Doorway Home Decor
like
Find Similar
Detail of soft plush cat paw bath mat on marble floor with 3D microfiber texture - Small / Imitation Cashmere / Grass Green Cat Paw (MJXKT325-1)
Close-up of fluffy blue bathroom mat with cute cartoon cat paw prints and soft texture - Small / Imitation Cashmere / Bright Blue Cat Paw (MJXKT325-2)
Pink faux cashmere bathroom mat with cute cat paw patterns on white marble floor - Small / Imitation Cashmere / Pink Cat Paw (MJXKT325-3)
Detail of grey bathroom mat with cute white cat paw prints on marble floor - Small / Imitation Cashmere / Gray Cat Paw (MJXKT325-4)
+132
Cute Cartoon Animal Flower Bath Mat Faux Cashmere Non-Slip Absorbent Entrance Rug For Bathroom Kitchen Doorway Home Decor
-4%
$0.79-6.06
No MOQ
Coral Fleece Facial Towel Thickened Soft Absorbent Breathable Bathroom Household Hand Towels
Coral Fleece Facial Towel Thickened Soft Absorbent Breathable Bathroom Household Hand Towels
like
Find Similar
Pink coral fleece towel rolled in a wooden tray on a white marble background surface - 35*75cm / Dusty Pink
Close-up of rolled beige coral fleece towel with cloud label on a wooden tray - 35*75cm / Coffee
White coral fleece towel rolled in premium paper wrap on a wooden tray decor - 35*75cm / White
Light pink coral fleece towel folded with paper sleeve on wooden tray for home use - 35*75cm / Pink
+5
Coral Fleece Facial Towel Thickened Soft Absorbent Breathable Bathroom Household Hand Towels
-4%
$0.65
Mix MOQ : 2
 · 
152 sold recently
Top 10% Best Sellers
in Bathroom
Solid Color Fitted Sheet Mattress Cover Brushed Microfiber Deep Pocket Elastic Band Breathable Soft Bedding Protector
Solid Color Fitted Sheet Mattress Cover Brushed Microfiber Deep Pocket Elastic Band Breathable Soft Bedding Protector
like
Find Similar
Clean white fitted sheet and matching pillowcases set for a modern bedroom interior - Pure White / Pillowcases 48*74cm
Soft pink solid color fitted bed sheet with matching pillowcases in minimalist bedroom - Jade Color / Single Fitted Sheet 180*200+27cm
Single dark grey fitted sheet and matching pillowcase in soft cotton fabric - Dark Gray / Single Fitted Sheet 180*200+27cm
Navy blue fitted sheet and matching pillowcase set on bed in a cozy bedroom - Navy Blue / Single Fitted Sheet 90*200+27cm
+96
Solid Color Fitted Sheet Mattress Cover Brushed Microfiber Deep Pocket Elastic Band Breathable Soft Bedding Protector
$2.16-6.05
No MOQ
 · 
30 sold recently
Cartoon Bear Hand Towel Coral Fleece Super Absorbent Hanging Loop Kitchen Bathroom Soft Plush Animal Shape
Cartoon Bear Hand Towel Coral Fleece Super Absorbent Hanging Loop Kitchen Bathroom Soft Plush Animal Shape
like
Find Similar
Detailed view of plush Kapibara hand towel featuring soft coral fleece and hanging loop - Touching Legs Style
Cute brown Capybara hanging hand towel made of soft coral fleece for kitchen and bathroom - Touching Face Style
Close-up of soft brown capybara hanging towel made of thick coral fleece fabric - Touching Belly Style
Cartoon Bear Hand Towel Coral Fleece Super Absorbent Hanging Loop Kitchen Bathroom Soft Plush Animal Shape
$0.75
Mix MOQ : 2
 · 
138 sold recently
Mysterious Purple Butterfly Digital Printed Flannel Blanket Soft Starry Night Throw Blanket For Sofa Bed Home Decor Blanket
Mysterious Purple Butterfly Digital Printed Flannel Blanket Soft Starry Night Throw Blanket For Sofa Bed Home Decor Blanket
like
Find Similar
Purple mystical butterfly flannel throw blanket draped over a cozy cream armchair - 100x150cm
Mysterious Purple Butterfly Digital Printed Flannel Blanket Soft Starry Night Throw Blanket For Sofa Bed Home Decor Blanket
-5%
$4.52
No MOQ
 · 
12 sold recently
Microfiber Beauty Salon SPA Bath Wrap Dress And Towels Soft Absorbent Wearable Bathrobe For Women Salon Supplies
Microfiber Beauty Salon SPA Bath Wrap Dress And Towels Soft Absorbent Wearable Bathrobe For Women Salon Supplies
like
Find Similar
White microfiber spa towel set with wearable bath wrap and three folding towels - Head Wrap 20*70cm / White
Grey microfiber wearable bath wrap dress with matching towels for spa beauty salons - Head Wrap 20*70cm / Dark Gray
5-piece purple microfiber spa towel set with velcro wrap, bath towel and face cloths - Head Wrap 20*70cm / Medium Purple
Pink microfiber spa bathrobe set with wrap dress and three matching towels for women - Head Wrap 20*70cm / Pink
+28
Microfiber Beauty Salon SPA Bath Wrap Dress And Towels Soft Absorbent Wearable Bathrobe For Women Salon Supplies
$0.81-12.45
Mix MOQ : 2
 · 
201 sold recently
Cute Cat Shaped Hanging Hand Towel Coral Velvet Absorbent Fast Drying With Bow Tie For Kitchen Bathroom
Cute Cat Shaped Hanging Hand Towel Coral Velvet Absorbent Fast Drying With Bow Tie For Kitchen Bathroom
like
Find Similar
Absorbent calico cat hand towel with embroidery and 3D bow for kitchen or bathroom - 19*25cm / Off White
Cute grey cat hanging hand towel made of soft absorbent microfiber with white bow tie - 19*25cm / Gray
White cute cat-shaped hanging hand towel made of soft microfiber with a teal bow tie - 19*25cm / White
Cute beige cat-shaped hanging hand towel made of soft absorbent microfiber cloth - 19*25cm / Light Coffee
Cute Cat Shaped Hanging Hand Towel Coral Velvet Absorbent Fast Drying With Bow Tie For Kitchen Bathroom
-4%
$2.00
No MOQ
 · 
43 sold recently
Abstract Art Faux Cashmere Bathroom Mat Non-slip Water Absorbent Floor Rug Modern Botanical Maple Ginkgo Leaf Entryway Bath Mat
Abstract Art Faux Cashmere Bathroom Mat Non-slip Water Absorbent Floor Rug Modern Botanical Maple Ginkgo Leaf Entryway Bath Mat
like
Find Similar
Abstract maple leaf bath mat with soft faux cashmere texture and non-slip backing - Imitation Cashmere / 40x60cm / Red Maple Leaf (Abstract-1)
Abstract ginkgo leaf cashmere-feel bathroom mat with non-slip backing for home decor - Imitation Cashmere / 40x60cm / Golden Ginkgo (Abstract-2)
Abstract faux cashmere bathroom mat with colorful plant patterns and non-slip backing - Imitation Cashmere / 40x60cm / Artistic Sun (Abstract-3)
Abstract botanical bath mat with thick cashmere-like texture and non-slip backing - Imitation Cashmere / 40x60cm / Botanical Patchwork (Abstract-4)
+28
Abstract Art Faux Cashmere Bathroom Mat Non-slip Water Absorbent Floor Rug Modern Botanical Maple Ginkgo Leaf Entryway Bath Mat
-5%
$0.99-7.88
No MOQ
Halloween Hand Towel Hanging Coral Fleece Soft Absorbent Cartoon Skull Ghost Bat For Bathroom Kitchen
Halloween Hand Towel Hanging Coral Fleece Soft Absorbent Cartoon Skull Ghost Bat For Bathroom Kitchen
like
Find Similar
Hanging coral fleece hand towel with cute Halloween skeleton design and black lanyard - Black Ghost
Ghost coral fleece hand towel with embroidery and hanging loop for Halloween - White Ghost
Skull and crossbones coral fleece hand towel with black hanging loop for Halloween - Pirate Skull
Halloween skull hand towel in white coral fleece with black hanging loop for kitchen decor - White Skull
+4
Halloween Hand Towel Hanging Coral Fleece Soft Absorbent Cartoon Skull Ghost Bat For Bathroom Kitchen
$1.30
No MOQ
 · 
140 sold recently
Marble Geometric Bathroom Shower Curtain Mat U-Shaped Rug And Toilet Lid Cover Waterproof Polyester Fabric Modern Decor
Marble Geometric Bathroom Shower Curtain Mat U-Shaped Rug And Toilet Lid Cover Waterproof Polyester Fabric Modern Decor
like
Find Similar
4-piece bathroom set with black gold marble hexagon patterns and anti-slip mats - 3-Piece Bath Mat Set / Black Gold Hexagon Marble(24-1)
Modern grey marble shower curtain set with gold geometric lines and non-slip rugs - 3-Piece Bath Mat Set / Grey Gold Geometric Marble(24-2)
Detailed 4-piece bathroom set with marble print shower curtain and matching non-slip mats - 3-Piece Bath Mat Set / Blue Green Gold Hexagon Marble(22SDYL4C)
Detail of 4-piece bathroom set with black marble pattern and gold leaf design - 3-Piece Bath Mat Set / Black Gold Hexagon Gold Leaf Marble(24-4)
+24
Marble Geometric Bathroom Shower Curtain Mat U-Shaped Rug And Toilet Lid Cover Waterproof Polyester Fabric Modern Decor
-4%
$6.17-12.33
No MOQ
Go to

More in home & kitchen

Explore more in bedding & bathroom

homecolorplasticstoragestylepolyesterdoublelayerdailyfoot
handholdertravelshapecleaningsimplekidswhiteheadbody

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access