Everful

Wholesale bedding & bathroom

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bedding & Bathroom

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

All products in bedding & bathroom

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Cute Cartoon Elephant Toilet Sticker Waterproof PVC Bathroom Decal For Toilet Lid Tank Home Beautification Decoration
Cute Cartoon Elephant Toilet Sticker Waterproof PVC Bathroom Decal For Toilet Lid Tank Home Beautification Decoration
like
Find Similar
Detailed size chart for MG-M019 cartoon elephant wall sticker measuring 25cm by 29cm - Cartoon Elephant Water Play Style (MG-M019)
Cute Cartoon Elephant Toilet Sticker Waterproof PVC Bathroom Decal For Toilet Lid Tank Home Beautification Decoration
$0.72
No MOQ
Spring Linen Throw Pillow Covers Happy Bloom Floral Buffalo Plaid Pattern Square Decorative Cushion Covers For Home Sofa
Spring Linen Throw Pillow Covers Happy Bloom Floral Buffalo Plaid Pattern Square Decorative Cushion Covers For Home Sofa
like
Find Similar
Linen pillow cover with Happy Bloom print and black-white checkered border on sofa - 45*45cm Linen Single-Sided No Insert / Happy Bloom (SPP004-1)
Linen decorative pillow cover with Bloom & Grow floral print on a white sofa - 45*45cm Linen Single-Sided No Insert / Bloom & Grow (SPP004-2)
Feel Spring linen throw pillow with black and white plaid border on a white sofa - 45*45cm Linen Single-Sided No Insert / Feel Spring (SPP004-3)
Linen pillow cover with 'Welcome Spring' truck print on a white sofa in a cozy home setting - 45*45cm Linen Single-Sided No Insert / Welcome Spring (SPP004-4)
Spring Linen Throw Pillow Covers Happy Bloom Floral Buffalo Plaid Pattern Square Decorative Cushion Covers For Home Sofa
$1.30
Mix MOQ : 2
Modern PVC Red Heart Vine Wall Stickers Removable Self Adhesive Bathroom Mirror Decor DIY Heart Line Decal Home Decoration
Modern PVC Red Heart Vine Wall Stickers Removable Self Adhesive Bathroom Mirror Decor DIY Heart Line Decal Home Decoration
like
Find Similar
Detail view of red heart vine wall sticker showing sheet size and finish dimensions - 12x29cm (fun-f1008)
Modern PVC Red Heart Vine Wall Stickers Removable Self Adhesive Bathroom Mirror Decor DIY Heart Line Decal Home Decoration
$0.72
No MOQ
2025 Happy New Year Cushion Cover Soft Plush Decorative Square Pillow Case For Sofa Home Fashion Print Celebration
2025 Happy New Year Cushion Cover Soft Plush Decorative Square Pillow Case For Sofa Home Fashion Print Celebration
like
Find Similar
Square Happy New Year cushion cover with floral and champagne graphic design - 45x45cm Short Plush No Core / New Year Champagne High Heels (crd05-1)
Elegant 2025 New Year pink floral and black striped cushion cover for home sofa decor - 45x45cm Short Plush No Core / Striped Table Roses (crd05-2)
Modern 2025 New Year decorative pillow cover in white with pink balloon and champagne motif - 45x45cm Short Plush No Core / 2025 Balloons Champagne (crd05-3)
Modern grey and pink fashion pillow cover featuring a chic handbag and makeup illustration - 45x45cm Short Plush No Core / Fashion Bags Cosmetics (crd05-4)
2025 Happy New Year Cushion Cover Soft Plush Decorative Square Pillow Case For Sofa Home Fashion Print Celebration
$1.30
Mix MOQ : 2
Halloween Toilet Sticker PVC Waterproof Skeleton Pumpkin Bat Witch Decal Festive Bathroom Decor Wall Art Home Decoration
Halloween Toilet Sticker PVC Waterproof Skeleton Pumpkin Bat Witch Decal Festive Bathroom Decor Wall Art Home Decoration
like
Find Similar
Detail of 30cm waterproof Halloween toilet sticker with skulls, pumpkins and bats - Skeleton Pumpkin Style (KSW34A)
Macro shot of 30x30cm Halloween toilet sticker with skull, pumpkin and bat illustrations - Graveyard Skeleton Style (KSW34B)
Halloween wall sticker with skeleton, pumpkin, and bats, sized 30x30cm for bathroom decor - Witch Moon Style (KSW34C)
30x30cm Halloween waterproof sticker with skull, bats, and pumpkins for wall and toilet - Purple Starry Skeleton Style (KSW34D)
+8
Halloween Toilet Sticker PVC Waterproof Skeleton Pumpkin Bat Witch Decal Festive Bathroom Decor Wall Art Home Decoration
$0.58
No MOQ
Happy Easter Rabbit Flower Butterfly Toilet Sticker Waterproof Self Adhesive PVC Bathroom Decal Holiday Home Decor
Happy Easter Rabbit Flower Butterfly Toilet Sticker Waterproof Self Adhesive PVC Bathroom Decal Holiday Home Decor
like
Find Similar
Easter wall stickers with bunnies, eggs, and flowers measuring 30x25cm for bathroom decor - Pink Eggshell Rabbit Style (MS4363-ZC) / 25*30cm
Close-up of Easter wall sticker featuring watercolor rabbit, eggs and butterflies, 30x30cm - Rabbit Holding Red Egg Style (MS4364-ZC) / 30*30cm
NewHappy Easter Rabbit Flower Butterfly Toilet Sticker Waterproof Self Adhesive PVC Bathroom Decal Holiday Home Decor
$0.78
Mix MOQ : 2
Cartoon Smile Face Toilet Sticker Waterproof PVC Removable Decal For Bathroom Lid Decor Funny Wall Mural Home Ornament
Cartoon Smile Face Toilet Sticker Waterproof PVC Removable Decal For Bathroom Lid Decor Funny Wall Mural Home Ornament
like
Find Similar
Cartoon smiling face toilet sticker DIY removable PVC wall decal 29.5x29.5cm - 10Y-A151 / Black
Cartoon Smile Face Toilet Sticker Waterproof PVC Removable Decal For Bathroom Lid Decor Funny Wall Mural Home Ornament
$0.75
No MOQ
Romantic Heart Balloons Toilet Lid Sticker Self-Adhesive Waterproof PVC Decal For Bathroom Decor Valentine's Day Gift
Romantic Heart Balloons Toilet Lid Sticker Self-Adhesive Waterproof PVC Decal For Bathroom Decor Valentine's Day Gift
like
Find Similar
Detail view of Valentine heart balloon stickers with actual size dimensions for home decor - Heart Balloons (HY-M530) / 24.5*24.5cm
Romantic Heart Balloons Toilet Lid Sticker Self-Adhesive Waterproof PVC Decal For Bathroom Decor Valentine's Day Gift
$0.58
No MOQ
Red Poppy Floral Printed Pillowcase Modern Soft Short Velvet Decorative Cushion Cover For Couch Home Living Room Decor
Red Poppy Floral Printed Pillowcase Modern Soft Short Velvet Decorative Cushion Cover For Couch Home Living Room Decor
like
Find Similar
Rectangular brick red cushion cover featuring white line art poppy flower patterns - Line Art Floral Style (CDR331-1) / 30*50cm
Rectangular red poppy print cushion cover with modern floral pattern on white background - Overlapping Artistic Floral Style (CDR331-2) / 30*50cm
Detailed view of red poppy floral print on rectangular lumbar pillowcase cover - Translucent Art Floral (CDR331-3) / 30*50cm
Detail of red poppy flower print on patchwork cotton linen rectangular cushion cover - Hand-painted Botanical Floral (CDR331-4) / 30*50cm
+20
Red Poppy Floral Printed Pillowcase Modern Soft Short Velvet Decorative Cushion Cover For Couch Home Living Room Decor
$1.30
Mix MOQ : 2
3D Cute Jack Russell Terrier Retro Camera Toilet Stickers Waterproof PVC Removable Animal Wall Decal For Bathroom Home Decor
3D Cute Jack Russell Terrier Retro Camera Toilet Stickers Waterproof PVC Removable Animal Wall Decal For Bathroom Home Decor
like
Find Similar
Detail showing cute puppy with vintage SLR camera wall sticker measuring 29cm x 15cm - Lying Puppy (HY-M116) / 15*29CM
Detailed size specifications for the cute Jack Russell Terrier puppy camera wall sticker - Standing Puppy (HY-M117) / 22*29cm
3D Cute Jack Russell Terrier Retro Camera Toilet Stickers Waterproof PVC Removable Animal Wall Decal For Bathroom Home Decor
$0.86
No MOQ
Valentine Day Gnome Rose Toilet Sticker Waterproof PVC Cartoon Gnome On Scooter Floral Wall Decal For Bathroom Home Decor
Valentine Day Gnome Rose Toilet Sticker Waterproof PVC Cartoon Gnome On Scooter Floral Wall Decal For Bathroom Home Decor
like
Find Similar
Detailed sheet size of Valentine gnome riding scooter with roses wall sticker, 29x25cm - Gnome On Scooter With Roses Style (fun-m2)
Valentine Day Gnome Rose Toilet Sticker Waterproof PVC Cartoon Gnome On Scooter Floral Wall Decal For Bathroom Home Decor
$0.72
No MOQ
Toilet Brush And Plunger With Holder Wall Mounted Bathroom Deep Cleaning Essentials Grey White Crevice Brush Plastic Durable
Toilet Brush And Plunger With Holder Wall Mounted Bathroom Deep Cleaning Essentials Grey White Crevice Brush Plastic Durable
like
Find Similar
Grey 3-in-1 wall-mounted toilet brush and plunger set with long crevice cleaning tool - 3-in-1 Cleaning Set / Off-White Grey
Toilet Brush And Plunger With Holder Wall Mounted Bathroom Deep Cleaning Essentials Grey White Crevice Brush Plastic Durable
$5.19
No MOQ
 · 
28 views
Watercolor Purple Flower Butterfly Toilet Sticker Waterproof PVC Bathroom Wall Decal Self-Adhesive Home Decor Mural
Watercolor Purple Flower Butterfly Toilet Sticker Waterproof PVC Bathroom Wall Decal Self-Adhesive Home Decor Mural
like
Find Similar
Detail showing colorful floral butterfly toilet sticker dimensions and watercolor design - 25*30cm
Watercolor Purple Flower Butterfly Toilet Sticker Waterproof PVC Bathroom Wall Decal Self-Adhesive Home Decor Mural
$0.85
No MOQ
Christmas Snowman Toilet Seat Cover And Rug And Tank Cover Home Bathroom Holiday Atmosphere Decoration Accessories
Christmas Snowman Toilet Seat Cover And Rug And Tank Cover Home Bathroom Holiday Atmosphere Decoration Accessories
like
Find Similar
Christmas snowman bathroom set including toilet cover, rug, and tissue box decoration - Snowman Style
Christmas Snowman Toilet Seat Cover And Rug And Tank Cover Home Bathroom Holiday Atmosphere Decoration Accessories
$4.18
No MOQ
Easter Bunny Colored Eggs In Wooden Bucket Toilet Sticker Removable PVC Bathroom Wall Decal Self Adhesive Home Decor Mural
Easter Bunny Colored Eggs In Wooden Bucket Toilet Sticker Removable PVC Bathroom Wall Decal Self Adhesive Home Decor Mural
like
Find Similar
Detail showing Easter bunny and tulip wall sticker sizes with product measurements - 29x29cm (HY-M332)
Easter Bunny Colored Eggs In Wooden Bucket Toilet Sticker Removable PVC Bathroom Wall Decal Self Adhesive Home Decor Mural
$0.86
No MOQ
Wall Mounted Toilet Paper Holder With Shelf Aluminum Alloy Waterproof Bathroom Storage Phone Stand No Drill Matte
Wall Mounted Toilet Paper Holder With Shelf Aluminum Alloy Waterproof Bathroom Storage Phone Stand No Drill Matte
like
Find Similar
Gunmetal grey space aluminum toilet roll holder with a convenient top storage shelf - Single Tissue Holder (No Lid) / Gunmetal
Gunmetal grey space aluminum toilet roll holder with storage shelf for bathroom - Single Tissue Holder (With Lid) / Gunmetal
Grey dual-layer space aluminum bathroom tissue holder, wall-mounted waterproof paper rack - Double Layer Tissue Box / Style Gun Gray
Wall-mounted black bathroom tissue holder with phone storage tray and dual paper outlets - Tissue Box (Dual Paper Outlet) / Textured Black
+5
Wall Mounted Toilet Paper Holder With Shelf Aluminum Alloy Waterproof Bathroom Storage Phone Stand No Drill Matte
$5.76-8.65
No MOQ
 · 
17 views
Green Plant Leaves Toilet Sticker PVC Waterproof Self Adhesive Watercolor White Flower Bathroom Wall Decal Restroom Decor
Green Plant Leaves Toilet Sticker PVC Waterproof Self Adhesive Watercolor White Flower Bathroom Wall Decal Restroom Decor
like
Find Similar
Self-adhesive green eucalyptus leaves and white flowers toilet wall sticker 35x25cm - Eucalyptus Leaves and White Flowers (MS2301-KQ) / 25*35cm
Green Plant Leaves Toilet Sticker PVC Waterproof Self Adhesive Watercolor White Flower Bathroom Wall Decal Restroom Decor
$0.86
Mix MOQ : 2
Cartoon Animal Toilet Lid Stickers PVC Waterproof Bathroom Decals Dinosaur Ballet Girl Unicorn For Kids Room Decor
Cartoon Animal Toilet Lid Stickers PVC Waterproof Bathroom Decals Dinosaur Ballet Girl Unicorn For Kids Room Decor
like
Find Similar
Detail view of ballet girl and swan wall decals with specific dimension measurements - Ballet Girl (MS627-YW)
Detailed view of sleeping fox and floral wall sticker with 30x25cm size dimensions - Fox & Flower (MS628-YW)
Detailed dimension guide for rainbow elephant wall sticker showing 30x25cm product size - Elephant Rainbow & Slogan (MS629-YW)
Detail showing unicorn and flower watercolor wall sticker size specifications 30x25cm - Unicorn Garland (MS630-YW)
+3
Cartoon Animal Toilet Lid Stickers PVC Waterproof Bathroom Decals Dinosaur Ballet Girl Unicorn For Kids Room Decor
$0.86
Mix MOQ : 2
Silicone Bath Brush With Soft Sponge Double Sided Body Scrubber Massage Exfoliating Shower Tool Hanging Rope
Silicone Bath Brush With Soft Sponge Double Sided Body Scrubber Massage Exfoliating Shower Tool Hanging Rope
like
Find Similar
Mint green silicone bath brush with soft bristles and inner foam sponge - Bag Packaging / Green
Pink silicone exfoliating bath brush with soft bristles and convenient hanging loop - Bag Packaging / Pink
Blue silicone shower brush with massage bristles and hanging rope for exfoliating - Bag Packaging / Blue
Purple silicone body massage brush with soft bristles and hanging rope for exfoliation - Bag Packaging / Purple
Silicone Bath Brush With Soft Sponge Double Sided Body Scrubber Massage Exfoliating Shower Tool Hanging Rope
$0.36
No MOQ
 · 
42 views
Nordic Christmas Cushion Cover Polyester Printed Santa Claus Snowflake Reindeer Patterns Festive Sofa Pillowcase Home Decor
Nordic Christmas Cushion Cover Polyester Printed Santa Claus Snowflake Reindeer Patterns Festive Sofa Pillowcase Home Decor
like
Find Similar
Red festive Christmas linen pillowcase featuring white Merry Christmas text and green tree - 45x45cm / Santa Claus Pattern (YMD168-1)
Linen Christmas pillow case featuring Santa Claus print and Merry Christmas text design - 45x45cm / Snowflake Greetings Pattern (YMD168-2)
Red linen Christmas pillowcase with white snowflake print for holiday home decor - 45x45cm / Christmas Tree Pattern (YMD168-3)
Christmas linen pillowcase with red reindeer silhouettes and snowflakes on beige fabric - 45x45cm / Reindeer Silhouette Pattern (YMD168-4)
Nordic Christmas Cushion Cover Polyester Printed Santa Claus Snowflake Reindeer Patterns Festive Sofa Pillowcase Home Decor
$1.38
Mix MOQ : 2
Christmas Gnome Toilet Seat Cover Rug And Tank Box Cover Santa Plaid Bathroom Decor Xmas Home Decorative Accessories
Christmas Gnome Toilet Seat Cover Rug And Tank Box Cover Santa Plaid Bathroom Decor Xmas Home Decorative Accessories
like
Find Similar
3-Piece Santa Claus toilet cover set with grey and red gnome theme for Christmas decor - Christmas Style
Christmas Gnome Toilet Seat Cover Rug And Tank Box Cover Santa Plaid Bathroom Decor Xmas Home Decorative Accessories
$5.19
No MOQ
Ocean World Seaweed Fish Toilet Lid Sticker Waterproof PVC Bathroom Decoration Decal Cartoon Undersea Marine Animals
Ocean World Seaweed Fish Toilet Lid Sticker Waterproof PVC Bathroom Decoration Decal Cartoon Undersea Marine Animals
like
Find Similar
Detail showing underwater world sea grass and fish wall stickers set with dimensions - 25*35cm
Ocean World Seaweed Fish Toilet Lid Sticker Waterproof PVC Bathroom Decoration Decal Cartoon Undersea Marine Animals
$0.86
Mix MOQ : 2
Vintage Pop Art Woman Sarcastic Quote Printed Linen Pillowcase Retro American Comic Style Sofa Cushion Cover Decorative Pillow Cover Home Decor
Vintage Pop Art Woman Sarcastic Quote Printed Linen Pillowcase Retro American Comic Style Sofa Cushion Cover Decorative Pillow Cover Home Decor
like
Find Similar
Retro girl illustration pillow cover with Can't Adult Today quote for home decor - Pink Pajama Girl Style (DYM388-1) / 45x45CM Single Sided Linen
Retro girl illustration pillowcase with funny quote on beige linen cushion cover - Vintage Woman Putting On Lipstick Style (DYM388-2) / 45x45CM Single Sided Linen
Retro girl print cushion cover with I See Stupid People quote on beige linen fabric - Vintage Woman With Binoculars Style (DYM388-3) / 45x45CM Single Sided Linen
Detail of linen texture pillowcase with vintage pop art girl and eye roll quote - Vintage Woman Eye Roll Style (DYM388-4) / 45x45CM Single Sided Linen
+6
NewVintage Pop Art Woman Sarcastic Quote Printed Linen Pillowcase Retro American Comic Style Sofa Cushion Cover Decorative Pillow Cover Home Decor
$1.30
Mix MOQ : 2
Cartoon Dolphin Watercolor Ocean Bathroom Wall Sticker PVC Waterproof Removable Mermaid Tail Bathtub Decor For Kids Room
Cartoon Dolphin Watercolor Ocean Bathroom Wall Sticker PVC Waterproof Removable Mermaid Tail Bathtub Decor For Kids Room
like
Find Similar
Cartoon ocean dolphins and mermaid wall decals in watercolor pink and blue for bathroom decor - ZC352/40*60*1 Sheet
NewCartoon Dolphin Watercolor Ocean Bathroom Wall Sticker PVC Waterproof Removable Mermaid Tail Bathtub Decor For Kids Room
$1.27
Mix MOQ : 3
Creative Fairy Pixie With Colorful Gemstones Wall Sticker Waterproof PVC Decal For Toilet Laptop Switch Home Decor
Creative Fairy Pixie With Colorful Gemstones Wall Sticker Waterproof PVC Decal For Toilet Laptop Switch Home Decor
like
Find Similar
Creative fairy with colorful wings wall sticker for living room decoration 15x15cm - Fairy with Gemstones (15x15cm) / 15*15cm*1PCS
Creative Fairy Pixie With Colorful Gemstones Wall Sticker Waterproof PVC Decal For Toilet Laptop Switch Home Decor
$0.49
Mix MOQ : 2
Red Christmas Lumbar Pillowcase Santa Claus Reindeer Snowflakes Printed Polyester Cushion Cover Holiday Home Decor
Red Christmas Lumbar Pillowcase Santa Claus Reindeer Snowflakes Printed Polyester Cushion Cover Holiday Home Decor
like
Find Similar
Christmas peach skin waist pillowcase with red Santa Claus and snowflakes decoration - Sunglasses Santa Claus (DRD417-1)
Red Merry Christmas peach skin throw pillowcase with Santa reindeer and snowflakes - Penguin Polar Bear Reindeer (DRD417-2)
Red Christmas pillowcase with cartoon Santa Claus and Merry Christmas print - Santa Claus Christmas Tree (DRD417-3)
Red Christmas pillowcase featuring Santa Claus holding a gift box with white snowflakes - Santa Holding Gift Box (DRD417-4)
+12
Red Christmas Lumbar Pillowcase Santa Claus Reindeer Snowflakes Printed Polyester Cushion Cover Holiday Home Decor
$1.27
Mix MOQ : 2
Portable Hair Washing Basin Transparent PET Ergonomic Neck Support Bedside Shampoo Bowl For Elderly Pregnant Women Patients
Portable Hair Washing Basin Transparent PET Ergonomic Neck Support Bedside Shampoo Bowl For Elderly Pregnant Women Patients
like
Find Similar
Light blue transparent bed shampoo basin made of PET with 74cm drainage pipe - Transparent Blue + Hook
Transparent PET hair washing basin with a 74cm retractable drain pipe for home care - Transparent + Hook
Translucent smoky gray PET bed shampoo basin with a 74cm drainage hose for home care - Transparent Grey + Hook
Portable blue hair washing basin with drain hose for elderly, 48x35x14cm size - Transparent Blue
+20
Portable Hair Washing Basin Transparent PET Ergonomic Neck Support Bedside Shampoo Bowl For Elderly Pregnant Women Patients
$4.35-7.63
No MOQ
Cartoon Cat Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Have A Nice Day Slogan Home Decor Toilet Tank Sticker
Cartoon Cat Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Have A Nice Day Slogan Home Decor Toilet Tank Sticker
like
Find Similar
1 option
Cartoon Cat Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Have A Nice Day Slogan Home Decor Toilet Tank Sticker
$0.81
No MOQ
Ocean Animal Wall Stickers Watercolor Dolphin Jellyfish Bathtub Decals PVC Waterproof Bathroom Decor For Kids Bedroom
Ocean Animal Wall Stickers Watercolor Dolphin Jellyfish Bathtub Decals PVC Waterproof Bathroom Decor For Kids Bedroom
like
Find Similar
Marine life wall decals with dolphins and jellyfish showing layout and paste effect size - ZC607 / 30*90cm * 2 Sheets / Blue
Ocean Animal Wall Stickers Watercolor Dolphin Jellyfish Bathtub Decals PVC Waterproof Bathroom Decor For Kids Bedroom
$1.87
Mix MOQ : 4
Halloween Polyester Cushion Cover Nordic Style Pumpkin Bat Printed Decorative Throw Pillowcase For Living Room Sofa
Halloween Polyester Cushion Cover Nordic Style Pumpkin Bat Printed Decorative Throw Pillowcase For Living Room Sofa
like
Find Similar
Halloween linen pillowcase with retro orange pickup truck and pumpkin graphic print - Pumpkin Truck Style (YMD363-1)
Halloween Trick or Treat linen pillowcase featuring a spooky castle and orange moon design - Castle Bat Style (YMD363-2)
Halloween linen pillow cover with orange Boo! design, black cat and bat decorations - BOO Lettering Style (YMD363-3)
Halloween orange linen throw pillow cover with Trick or Treat pumpkin and bat design - Trick Or Treat Style (YMD363-4)
Halloween Polyester Cushion Cover Nordic Style Pumpkin Bat Printed Decorative Throw Pillowcase For Living Room Sofa
$1.38
Mix MOQ : 2
Cartoon Whale Jellyfish Undersea World Wall Stickers Waterproof PVC Bathtub Decor Removable Ocean Marine Life DIY Adhesive Decals
Cartoon Whale Jellyfish Undersea World Wall Stickers Waterproof PVC Bathtub Decor Removable Ocean Marine Life DIY Adhesive Decals
like
Find Similar
Cartoon whale and jellyfish ocean world wall decal set with hand-drawn sea animal illustrations - 30x90cm
Cartoon Whale Jellyfish Undersea World Wall Stickers Waterproof PVC Bathtub Decor Removable Ocean Marine Life DIY Adhesive Decals
$2.02
Mix MOQ : 4
Nordic Minimalist Teddy Velvet Abstract Face Line Art Embroidered Cushion Cover Square Decorative Pillowcase For Sofa Home
Nordic Minimalist Teddy Velvet Abstract Face Line Art Embroidered Cushion Cover Square Decorative Pillowcase For Sofa Home
like
Find Similar
Minimalist white teddy fleece cushion cover with black abstract face line embroidery - 45x45cm / Beauty Mark (Case Only)
Minimalist teddy velvet cushion cover with abstract embroidered face lines in cream white - 45x45cm / Bright-eyed Beauty (Case Only)
+4
NewNordic Minimalist Teddy Velvet Abstract Face Line Art Embroidered Cushion Cover Square Decorative Pillowcase For Sofa Home
-5%
$3.01-5.61
Mix MOQ : 2
The Best Seat In The House Toilet Seat Sticker PVC Waterproof Decal With Crown Star Pattern Bathroom Wall Art Decoration
The Best Seat In The House Toilet Seat Sticker PVC Waterproof Decal With Crown Star Pattern Bathroom Wall Art Decoration
like
Find Similar
Minimalist toilet decal with crown and 'The Best Seat in the House' text for bathroom - Creative Slogan Style (M-2-2)
The Best Seat In The House Toilet Seat Sticker PVC Waterproof Decal With Crown Star Pattern Bathroom Wall Art Decoration
$0.58
Mix MOQ : 2
Transparent PET Plastic Washbasin Thicken Multi Purpose Laundry Basin With Dual Handles For Home Dormitory Bathroom
Transparent PET Plastic Washbasin Thicken Multi Purpose Laundry Basin With Dual Handles For Home Dormitory Bathroom
like
Find Similar
White transparent washbasin with dual handles and dimensions shown 29.5x10.5cm - Square Small Transparent
Medium size transparent white plastic washbasin with handles and 32.4cm outer diameter - Square Medium Transparent
Large transparent plastic washbasin with side handles and precise dimensions - Square Large Transparent
Transparent light blue plastic wash basin with handles, small size, 29.5cm outer diameter - Square Small Blue
+14
Transparent PET Plastic Washbasin Thicken Multi Purpose Laundry Basin With Dual Handles For Home Dormitory Bathroom
$1.57-3.37
No MOQ
Ocean World Sea Creatures Coral Seahorse Turtle PVC Wall Stickers For Bathroom Kids Room Home Decoration DIY Decals
Ocean World Sea Creatures Coral Seahorse Turtle PVC Wall Stickers For Bathroom Kids Room Home Decoration DIY Decals
like
Find Similar
Detail of coral and sea turtle wall stickers showing dimensions 60cm x 30cm for kids rooms - 30*60cm Layout
Ocean World Sea Creatures Coral Seahorse Turtle PVC Wall Stickers For Bathroom Kids Room Home Decoration DIY Decals
$1.12
No MOQ
3D Koi Fish And Lotus Flower Wall Stickers Waterproof Self Adhesive PVC Decal For Bathroom Bathtub Wall Decoration Home Art
3D Koi Fish And Lotus Flower Wall Stickers Waterproof Self Adhesive PVC Decal For Bathroom Bathtub Wall Decoration Home Art
like
Find Similar
3D koi fish and peony flower wall stickers with layout dimensions for home decor - 50*70cm*1pc / Yellow
3D Koi Fish And Lotus Flower Wall Stickers Waterproof Self Adhesive PVC Decal For Bathroom Bathtub Wall Decoration Home Art
$1.67
No MOQ
Glow In The Dark Toilet Sign Wall Stickers Fluorescent Male Female Bathroom Door Decals Waterproof Creative Home Decor
Glow In The Dark Toilet Sign Wall Stickers Fluorescent Male Female Bathroom Door Decals Waterproof Creative Home Decor
like
Find Similar
Glow in the dark bathroom door stickers with luminous male and female icons - Green
Luminous blue LED bathroom sign with male and female icons on dark hexagonal wall decor - Blue
NewGlow In The Dark Toilet Sign Wall Stickers Fluorescent Male Female Bathroom Door Decals Waterproof Creative Home Decor
-13%
$0.73-0.96
No MOQ
Free Shipping
Christmas Santa Claus Toilet Seat Cover And Bathroom Rug And Tank Cover Red Polyester Holiday Bathroom Decoration
Christmas Santa Claus Toilet Seat Cover And Bathroom Rug And Tank Cover Red Polyester Holiday Bathroom Decoration
like
Find Similar
Christmas gnome toilet cover set in bright red plush with a Santa belt and holly design - Toilet Lid Cover And Rug And Tank Cover / Christmas Red
Christmas Santa Claus Toilet Seat Cover And Bathroom Rug And Tank Cover Red Polyester Holiday Bathroom Decoration
$8.50
Mix MOQ : 2
Humorous HAVE A Nice POOP Bathroom Decal Waterproof PVC Vinyl Toilet Tank Decoration Self Adhesive Fun Wall Sticker
Humorous HAVE A Nice POOP Bathroom Decal Waterproof PVC Vinyl Toilet Tank Decoration Self Adhesive Fun Wall Sticker
like
Find Similar
Funny 'Have a Nice Poop' PVC toilet wall sticker with toilet paper roll illustration - HAVE A Nice POOP Style (D90)
Funny bathroom toilet decal featuring humorous phrase and toilet roll illustration - ROLL WITH IT Style (D91)
Humorous HAVE A Nice POOP Bathroom Decal Waterproof PVC Vinyl Toilet Tank Decoration Self Adhesive Fun Wall Sticker
$0.72
Mix MOQ : 4
Creative Cartoon Penguin Toilet Sticker PVC Waterproof Removable Wall Decal For Bathroom Home Decor Black DIY Art Toilet Sign
Creative Cartoon Penguin Toilet Sticker PVC Waterproof Removable Wall Decal For Bathroom Home Decor Black DIY Art Toilet Sign
like
Find Similar
Detail showing 28.5x13cm penguin toilet sticker dimensions with FX39 model code - Little Penguin Toilet Sticker (FX39印) / 13x28.5cm
Creative Cartoon Penguin Toilet Sticker PVC Waterproof Removable Wall Decal For Bathroom Home Decor Black DIY Art Toilet Sign
-4%
$0.41
No MOQ
Cute Cartoon Panda Holding Heart Toilet Sticker Waterproof PVC Removable Bathroom Decal Home Decor Wall Art
Cute Cartoon Panda Holding Heart Toilet Sticker Waterproof PVC Removable Bathroom Decal Home Decor Wall Art
like
Find Similar
Detail view of cartoon panda wall sticker with dimensions 29cm x 25cm and heart detail - 25*29cm/fun-m7
Cute Cartoon Panda Holding Heart Toilet Sticker Waterproof PVC Removable Bathroom Decal Home Decor Wall Art
$0.72
No MOQ
Toilet Lid Sticker Floral PVC Self-Adhesive Waterproof Bathroom Background Wall Decal Flower Bouquet Decoration
Toilet Lid Sticker Floral PVC Self-Adhesive Waterproof Bathroom Background Wall Decal Flower Bouquet Decoration
like
Find Similar
Self-adhesive floral wall sticker with colorful watercolor wildflowers, 30x30cm size - MS6420-ZY (30*30cm)
Toilet Lid Sticker Floral PVC Self-Adhesive Waterproof Bathroom Background Wall Decal Flower Bouquet Decoration
$0.86
Mix MOQ : 2
Underwater World Sea Turtle Bathtub Sticker Waterproof PVC Ocean Life Decal For Bathroom Kid Room Wall Home Decoration
Underwater World Sea Turtle Bathtub Sticker Waterproof PVC Ocean Life Decal For Bathroom Kid Room Wall Home Decoration
like
Find Similar
Marine life wall decals with sea turtles and coral for bathroom and kids room decor - Underwater World Sea Turtle (MS538-YW)
Underwater World Sea Turtle Bathtub Sticker Waterproof PVC Ocean Life Decal For Bathroom Kid Room Wall Home Decoration
$1.15
Mix MOQ : 2
Cartoon Owl Toilet Lid Sticker Waterproof PVC Big Eyes Bird Decal For Bathroom Restroom Decoration Modern Home Wall Sticker
Cartoon Owl Toilet Lid Sticker Waterproof PVC Big Eyes Bird Decal For Bathroom Restroom Decoration Modern Home Wall Sticker
like
Find Similar
Size chart showing original sheet and finished dimensions for cartoon owl wall sticker - 25x29cm
Cartoon Owl Toilet Lid Sticker Waterproof PVC Big Eyes Bird Decal For Bathroom Restroom Decoration Modern Home Wall Sticker
$0.86
No MOQ
Removable PVC Cartoon Sloth Toilet Seat Sticker With I Love You More Than Naps Phrase Heart Diamond Decorative Bathroom Wall Decal
Removable PVC Cartoon Sloth Toilet Seat Sticker With I Love You More Than Naps Phrase Heart Diamond Decorative Bathroom Wall Decal
like
Find Similar
Cute cartoon sloth wall sticker with I love you more than naps quote for bathroom - 30*30cm / Brown
Removable PVC Cartoon Sloth Toilet Seat Sticker With I Love You More Than Naps Phrase Heart Diamond Decorative Bathroom Wall Decal
$0.52
Mix MOQ : 4
3D Realistic Polar Bear Broken Wall Sticker Waterproof PVC Toilet Lid Decal Creative Animal Home Bathroom Wall Decor Sticker
3D Realistic Polar Bear Broken Wall Sticker Waterproof PVC Toilet Lid Decal Creative Animal Home Bathroom Wall Decor Sticker
like
Find Similar
Detailed view of 3D polar bear wall sticker showing 29cm x 29cm dimensions and fun-f85 code - 29x29cm (fun-f85)
3D Realistic Polar Bear Broken Wall Sticker Waterproof PVC Toilet Lid Decal Creative Animal Home Bathroom Wall Decor Sticker
$0.72
No MOQ
Humorous Bathroom Wall Stickers Removable PVC Toilet Decor Decal Funny Quotes For Washroom Restroom Home Wall Decoration
Humorous Bathroom Wall Stickers Removable PVC Toilet Decor Decal Funny Quotes For Washroom Restroom Home Wall Decoration
like
Find Similar
4 options
Humorous Bathroom Wall Stickers Removable PVC Toilet Decor Decal Funny Quotes For Washroom Restroom Home Wall Decoration
$0.92
Mix MOQ : 4
Black White Baroque Scroll Floral Wall Border Sticker Waterproof PVC Waistline Decal For Bathroom Kitchen Living Room Decor
Black White Baroque Scroll Floral Wall Border Sticker Waterproof PVC Waistline Decal For Bathroom Kitchen Living Room Decor
like
Find Similar
Detailed view of self-adhesive wall border sticker with white scroll pattern on black base - 10*200cm (BYX007)
Black White Baroque Scroll Floral Wall Border Sticker Waterproof PVC Waistline Decal For Bathroom Kitchen Living Room Decor
$1.44
No MOQ
Halloween Pumpkin Black Cat Pillow Case Polyester Decorative Throw Cushion Cover For Sofa Home Decor Holiday Party Cover Only
Halloween Pumpkin Black Cat Pillow Case Polyester Decorative Throw Cushion Cover For Sofa Home Decor Holiday Party Cover Only
like
Find Similar
Halloween pillow cover with black cat on orange pumpkin and festive glowing face pattern - 45x45cm / Black Cat On Pumpkin (YMD365-1)
Halloween black cat and pumpkin linen pillowcase cover for festive home sofa decoration - 45x45cm / Black Cat Silhouette With Pumpkin (YMD365-2)
Halloween pumpkin orange moon black cat linen throw pillow cover for festive home decor - 45x45cm / Black Cat Silhouette On Moon (YMD365-3)
Halloween pumpkin lantern and black cat decorative linen pillow case with stars - 45x45cm / Pumpkin Black Cat Skeleton (YMD365-4)
Halloween Pumpkin Black Cat Pillow Case Polyester Decorative Throw Cushion Cover For Sofa Home Decor Holiday Party Cover Only
$1.38
Mix MOQ : 2
Nordic Modern Short Plush Pillowcase Artistic Female Portrait Sofa Cushion Cover Abstract Hand Painted Home Office Decor
Nordic Modern Short Plush Pillowcase Artistic Female Portrait Sofa Cushion Cover Abstract Hand Painted Home Office Decor
like
Find Similar
12 options
Nordic Modern Short Plush Pillowcase Artistic Female Portrait Sofa Cushion Cover Abstract Hand Painted Home Office Decor
$1.30
Mix MOQ : 2
Easter Linen Throw Pillow Case Bunny Egg Print Decorative Cushion Cover For Home Living Room Sofa Easter Party Decor
Easter Linen Throw Pillow Case Bunny Egg Print Decorative Cushion Cover For Home Living Room Sofa Easter Party Decor
like
Find Similar
Olive green Easter pillow cover with polka dots and bird print featuring Be Kind text - Single Sided Printing Without Insert / Olive Green Polka Dot Bird (DYM217-1)
Easter throw pillow cover with watercolor rabbit and floral print on linen texture - Single Sided Printing Without Insert / Double Rabbit Floral (DYM217-2)
Square Easter pillow cover with bunny ears and 'BE HOPPY' text on green plaid pattern - Single Sided Printing Without Insert / Plaid Rabbit Ears (DYM217-3)
Easter bunny ears and floral print square cushion cover in beige cotton linen fabric - Single Sided Printing Without Insert / Watercolor Rabbit Ears Floral (DYM217-4)
+1
Easter Linen Throw Pillow Case Bunny Egg Print Decorative Cushion Cover For Home Living Room Sofa Easter Party Decor
$1.30-5.19
Mix MOQ : 2
Humorous Creative Snail With Red Wheels Toilet Sticker Realistic 3D Animal Wall Decal Waterproof PVC Bathroom Home Decoration Decal
Humorous Creative Snail With Red Wheels Toilet Sticker Realistic 3D Animal Wall Decal Waterproof PVC Bathroom Home Decoration Decal
like
Find Similar
Detail view of cartoon snail wall decal with dimensions 29x22cm for bathroom decor - 22*29cm (HY-M078)
Humorous Creative Snail With Red Wheels Toilet Sticker Realistic 3D Animal Wall Decal Waterproof PVC Bathroom Home Decoration Decal
$0.84
No MOQ
Ethnic Geometric Cushion Cover Bohemian Black White Printed Square Pillowcase Polyester Cotton Blend Decorative Pillowcase
Ethnic Geometric Cushion Cover Bohemian Black White Printed Square Pillowcase Polyester Cotton Blend Decorative Pillowcase
like
Find Similar
Ethnic black and white geometric cushion on wooden chair with natural light - 45x45 Pillow Cover Only / Black and White Geometric Badge Pattern
NewEthnic Geometric Cushion Cover Bohemian Black White Printed Square Pillowcase Polyester Cotton Blend Decorative Pillowcase
$2.88-4.32
No MOQ
Foldable Washbasin Transparent Portable Plastic Tub For Laundry Travel Bathroom Space Saving With Hanging Hole Minimalist
Foldable Washbasin Transparent Portable Plastic Tub For Laundry Travel Bathroom Space Saving With Hanging Hole Minimalist
like
Find Similar
Medium matcha green foldable transparent washbasin with silicone portable design - Medium / Matcha Green
Mini sakura pink foldable washbasin made of transparent PET and soft TPE silicone - Mini Small / Sakura Pink
Medium foldable cherry pink transparent washbasin space-saving design for bathroom - Medium / Sakura Pink
Pink foldable washbasin made of transparent plastic and silicone for space-saving storage - Large / Sakura Pink
+4
Foldable Washbasin Transparent Portable Plastic Tub For Laundry Travel Bathroom Space Saving With Hanging Hole Minimalist
-5%
$0.71-2.41
No MOQ
 · 
13 views
Ramadan Eid Mubarak Decorative Pillow Case Moon Mosque Watercolor Polyester Plush Throw Cushion Cover For Sofa Home Decor
Ramadan Eid Mubarak Decorative Pillow Case Moon Mosque Watercolor Polyester Plush Throw Cushion Cover For Sofa Home Decor
like
Find Similar
Colorful watercolor crescent moon and mosque print square pillow cover for home decor - 45*45cm Short Plush Single Sided Without Core / Moon and Mosque Pattern (CDR441-1)
Ethnic moon cushion cover with watercolor hanging lanterns and Islamic arch pattern design - 45*45cm Short Plush Single Sided Without Core / Three Lanterns Pattern (CDR441-2)
Ethnic moon pillowcase with watercolor teapot and dates for home sofa decor - 45*45cm Short Plush Single Sided Without Core / Ethnic Teapot and Dates Pattern (CDR441-3)
Ethnic colorful moon and lantern print square pillowcase for festive home decor - 45*45cm Short Plush Single Sided Without Core / Crescent and Lanterns Pattern (CDR441-4)
Ramadan Eid Mubarak Decorative Pillow Case Moon Mosque Watercolor Polyester Plush Throw Cushion Cover For Sofa Home Decor
$1.30
Mix MOQ : 2
Sunflower Gnome Decorative Pillowcase Soft Short Plush Square Cushion Cover For Sofa Couch Living Room Home Decor No Insert
Sunflower Gnome Decorative Pillowcase Soft Short Plush Square Cushion Cover For Sofa Couch Living Room Home Decor No Insert
like
Find Similar
Sunflower Gnome decorative pillow cover on white background for garden home decor - 45x45cm / Gnome Gardening Style (CDR21-1)
Gnome throw pillow cover featuring sunflower straw hat and watering can on white fabric - 45x45cm / Gnome Watering Style (CDR21-2)
White pillow cover with sunflower gnome playing guitar pattern for home sofa decor - 45x45cm / Gnome Playing Guitar Style (CDR21-3)
Sunflower gnome and blue vintage truck print on a white square decorative pillowcase - 45x45cm / Gnome Blue Truck Style (CDR21-4)
+14
Sunflower Gnome Decorative Pillowcase Soft Short Plush Square Cushion Cover For Sofa Couch Living Room Home Decor No Insert
$1.30
Mix MOQ : 2
Bird On Tree Branch Flower Wall Sticker Removable Self-Adhesive PVC Toilet Seat Decal For Bathroom Home Decor Art Mural
Bird On Tree Branch Flower Wall Sticker Removable Self-Adhesive PVC Toilet Seat Decal For Bathroom Home Decor Art Mural
like
Find Similar
Self-adhesive branch with two birds wall sticker for bathroom and home decor - Colorful Birds and Branches (HMY6-2279) / 30x26cm
Bird On Tree Branch Flower Wall Sticker Removable Self-Adhesive PVC Toilet Seat Decal For Bathroom Home Decor Art Mural
$0.43
Mix MOQ : 4
Floral Butterfly Toilet Lid Sticker Waterproof PVC Self-Adhesive Removable Bathroom Decal Home Decoration Pink Flowers
Floral Butterfly Toilet Lid Sticker Waterproof PVC Self-Adhesive Removable Bathroom Decal Home Decoration Pink Flowers
like
Find Similar
Pink watercolor flower and butterfly self-adhesive toilet wall sticker 30x35cm size - 30*35cm*1 Sheet (MS7665)
Floral Butterfly Toilet Lid Sticker Waterproof PVC Self-Adhesive Removable Bathroom Decal Home Decoration Pink Flowers
$1.01
Mix MOQ : 2
3D Cartoon Koala Tree Branch Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Home Decorative Removable Animal Poster
3D Cartoon Koala Tree Branch Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Home Decorative Removable Animal Poster
like
Find Similar
Detailed view of Koala tree stickers with 25cm by 29cm size measurements for bathroom decor - 25x29cm (fun-m73)
New3D Cartoon Koala Tree Branch Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Home Decorative Removable Animal Poster
$0.72
No MOQ
Black And White American Vintage Pillowcase Geometric Pattern Polyester Cushion Cover For Home Sofa Office Throw Pillow Case
Black And White American Vintage Pillowcase Geometric Pattern Polyester Cushion Cover For Home Sofa Office Throw Pillow Case
like
Find Similar
European vintage luxury square pillow case with black flower print on white background - Beige Five-Petal Flower (CRD59-1)
Modern black and white geometric square pillowcase with life quotes on white background - Black and White Geometric (CRD59-2)
Retro black and white geometric pillowcase with botanical patterns and Lucky label - Black and White Botanical (CRD59-3)
European vintage square throw pillow cover with floral plant pattern and text on white background - Beige Plant Branches (CRD59-4)
+12
Black And White American Vintage Pillowcase Geometric Pattern Polyester Cushion Cover For Home Sofa Office Throw Pillow Case
$1.38
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in bedding & bathroom

homecolorholderstoragestylepolyesterdoubleheaddesignheart
hangingplastictravelshapecleaningsimplekidslayerwhitedaily

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access