Everful

Wholesale bedding & bathroom

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bedding & Bathroom

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

All products in bedding & bathroom

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Cartoon Animal Peach Skin Throw Pillowcase Square Decorative Cushion Cover For Children Room Sofa Home Decor Modern Style
Cartoon Animal Peach Skin Throw Pillowcase Square Decorative Cushion Cover For Children Room Sofa Home Decor Modern Style
like
Find Similar
Detail of white square pillow case with a cute yellow cartoon giraffe and blue clouds - Giraffe Style (DRD234-1)
Detail of square pillowcase featuring a cartoon polar bear design and LOVE text - Love Polar Bear Style (DRD234-2)
Detail showing cartoon elephant pattern with pink bow on white square cushion cover - Ballet Elephant Style (DRD234-3)
Close-up of square blue pillow cover featuring a cute cartoon elephant with a large bow - Bowknot Elephant Style (DRD234-4)
+36
Cartoon Animal Peach Skin Throw Pillowcase Square Decorative Cushion Cover For Children Room Sofa Home Decor Modern Style
-5%
$1.23
Mix MOQ : 2
Creative Watercolor Shelf Vase Bathroom Wall Sticker PVC Waterproof Removable Botanical Floral Decor Home Mural Art Decal
Creative Watercolor Shelf Vase Bathroom Wall Sticker PVC Waterproof Removable Botanical Floral Decor Home Mural Art Decal
like
Find Similar
Detailed dimensions of watercolor flower shelf wall decal showing 50cm by 40cm size - 40cmx50cm
Creative Watercolor Shelf Vase Bathroom Wall Sticker PVC Waterproof Removable Botanical Floral Decor Home Mural Art Decal
$1.30
No MOQ
Peony Flower Butterfly Toilet Sticker Waterproof PVC Decal For Bathroom Water Tank And Lid Cover Decoration Home Ornament
Peony Flower Butterfly Toilet Sticker Waterproof PVC Decal For Bathroom Water Tank And Lid Cover Decoration Home Ornament
like
Find Similar
Detailed sheet size and finish size guide for watercolor peony flower wall stickers - Peony Butterfly Style (fun-m391)
Peony Flower Butterfly Toilet Sticker Waterproof PVC Decal For Bathroom Water Tank And Lid Cover Decoration Home Ornament
$1.21
No MOQ
Cartoon Rabbit Reading Book Easter Egg Butterfly Toilet Sticker PVC Watercolor Floral Wall Decal For Bathroom Decor
Cartoon Rabbit Reading Book Easter Egg Butterfly Toilet Sticker PVC Watercolor Floral Wall Decal For Bathroom Decor
like
Find Similar
Layout and finish dimensions of cartoon rabbit and Easter eggs wall sticker 29x27cm - Cartoon Rabbit & Easter Egg (fun-m346) / 27x29cm
Cartoon Rabbit Reading Book Easter Egg Butterfly Toilet Sticker PVC Watercolor Floral Wall Decal For Bathroom Decor
$0.86
No MOQ
Pink Cherry Blossom Toilet Lid Sticker Gold Outline Floral Wall Decal For Bathroom Home Decor Self-Adhesive PVC Art Mural
Pink Cherry Blossom Toilet Lid Sticker Gold Outline Floral Wall Decal For Bathroom Home Decor Self-Adhesive PVC Art Mural
like
Find Similar
Detail showing dimensions of pink watercolor floral wall stickers with golden edges - Pink Floral (HY-M381) / 25x29cm
Pink Cherry Blossom Toilet Lid Sticker Gold Outline Floral Wall Decal For Bathroom Home Decor Self-Adhesive PVC Art Mural
$0.86
No MOQ
Watercolor Sea Turtle Wall Stickers PVC Waterproof Bathroom Decals Underwater Marine Animals Bubbles Home Decor For Living Room Bathroom
Watercolor Sea Turtle Wall Stickers PVC Waterproof Bathroom Decals Underwater Marine Animals Bubbles Home Decor For Living Room Bathroom
like
Find Similar
Detail view of turtle wall stickers with dimensions for creative home decor layout - 30x25cm
Watercolor Sea Turtle Wall Stickers PVC Waterproof Bathroom Decals Underwater Marine Animals Bubbles Home Decor For Living Room Bathroom
$1.24
Mix MOQ : 2
Abstract Morandi Geometric Plant Pattern Pillowcase Soft Short Plush Decorative Square Cushion Cover For Sofa Couch Home Decor
Abstract Morandi Geometric Plant Pattern Pillowcase Soft Short Plush Decorative Square Cushion Cover For Sofa Couch Home Decor
like
Find Similar
Modern Morandi geometric throw pillow cover with abstract leaves and colorful shapes - 18x18 Inch / Abstract Botanical Geometric Style 1 (CRD12-1)
Modern Morandi geometric cushion cover with navy and yellow abstract leaf patterns - 18x18 Inch / Abstract Botanical Geometric Style 2 (CRD12-2)
Modern Morandi geometric throw pillow cover featuring abstract monstera leaves on white fabric - 18x18 Inch / Abstract Botanical Geometric Style 3 (CRD12-3)
Modern abstract Morandi geometric cushion cover with botanical silhouettes on white background - 18x18 Inch / Abstract Botanical Geometric Style 4 (CRD12-4)
Abstract Morandi Geometric Plant Pattern Pillowcase Soft Short Plush Decorative Square Cushion Cover For Sofa Couch Home Decor
$1.41
Mix MOQ : 2
Waterproof PVC Flower Basket Purple Bow Toilet Lid Sticker Bathroom Wall Decal Floral Peony Decorative Home Art Sticker
Waterproof PVC Flower Basket Purple Bow Toilet Lid Sticker Bathroom Wall Decal Floral Peony Decorative Home Art Sticker
like
Find Similar
Detail showing sheet size and finish size for flower basket bathroom wall stickers - 29x29cm (fun-m323)
Waterproof PVC Flower Basket Purple Bow Toilet Lid Sticker Bathroom Wall Decal Floral Peony Decorative Home Art Sticker
$0.86
No MOQ
Red Rose Butterflies Toilet Lid Sticker Waterproof PVC Floral Wall Decal With White Fence For Bathroom Romantic Flower Art
Red Rose Butterflies Toilet Lid Sticker Waterproof PVC Floral Wall Decal With White Fence For Bathroom Romantic Flower Art
like
Find Similar
Detail view of red rose and butterfly wall stickers with size layout specifications - 29x29cm
Red Rose Butterflies Toilet Lid Sticker Waterproof PVC Floral Wall Decal With White Fence For Bathroom Romantic Flower Art
$0.86
No MOQ
Hummingbird Floral Print Throw Pillow Case Soft Short Plush Square Cushion Cover For Sofa Living Room Home Decor
Hummingbird Floral Print Throw Pillow Case Soft Short Plush Square Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
White vintage square pillowcase featuring a watercolor gold-plated hummingbird print - 45x45cm Single Side No Core / Hummingbird Floral Style 1 (CDR13-1)
White square throw pillow featuring a colorful hummingbird print and artistic geometric details - 45x45cm Single Side No Core / Hummingbird Starlight Style 2 (CDR13-2)
Square white pillowcase featuring colorful artistic hummingbird digital print pattern - 45x45cm Single Side No Core / Colorful Hummingbird Style 3 (CDR13-3)
Vintage floral hummingbird print throw pillow cover in white fabric for home decor - 45x45cm Single Side No Core / Hummingbird Feeding Style 4 (CDR13-4)
+12
Hummingbird Floral Print Throw Pillow Case Soft Short Plush Square Cushion Cover For Sofa Living Room Home Decor
$1.30
Mix MOQ : 2
Purple Heart Rose Floral Bathroom Wall Sticker Waterproof PVC Toilet Decal Removable Romantic Flower Sticker For Home Decor
Purple Heart Rose Floral Bathroom Wall Sticker Waterproof PVC Toilet Decal Removable Romantic Flower Sticker For Home Decor
like
Find Similar
1 option
Purple Heart Rose Floral Bathroom Wall Sticker Waterproof PVC Toilet Decal Removable Romantic Flower Sticker For Home Decor
$0.92
Mix MOQ : 4
Get Naked Bathroom Quote Wall Sticker Waterproof Vinyl Art Lettering Heart Pattern Decal For Mirror Glass Wall Decor
Get Naked Bathroom Quote Wall Sticker Waterproof Vinyl Art Lettering Heart Pattern Decal For Mirror Glass Wall Decor
like
Find Similar
Black 'get naked' scripted wall decal for bathroom mirrors with size dimensions - 28*91cm / Black
Get Naked Bathroom Quote Wall Sticker Waterproof Vinyl Art Lettering Heart Pattern Decal For Mirror Glass Wall Decor
$1.38
Mix MOQ : 2
Wearable Hooded Blanket Cloak Soft Double Layer Flannel Lamb Wool Warm Nap Cape Cute Rabbit Ears For Women Girls
Wearable Hooded Blanket Cloak Soft Double Layer Flannel Lamb Wool Warm Nap Cape Cute Rabbit Ears For Women Girls
like
Find Similar
Pink rabbit-ear hooded shawl in plush lamb wool fabric for cozy winter home comfort - 130cmX120cm / Pink
Oversized wearable blanket with rabbit ears and soft plush lining for women at home - 95cmX80cm / Gray
Wearable Hooded Blanket Cloak Soft Double Layer Flannel Lamb Wool Warm Nap Cape Cute Rabbit Ears For Women Girls
$10.37-12.39
No MOQ
 · 
62 views
Modern Luxury Polyester Jacquard Embroidered Pillowcase Geometric Metallic Line Decorative Throw Pillow Cover For Living Room Bedroom
Modern Luxury Polyester Jacquard Embroidered Pillowcase Geometric Metallic Line Decorative Throw Pillow Cover For Living Room Bedroom
like
Find Similar
Modern black square pillow cover with silver geometric stripes on a stylish metal chair - 45x45 with 400g Core / Agate Black
Brick red square throw pillow cover with golden geometric stripes on a modern chair - 45x45 with 400g Core / Luxury Orange
Gray high-precision jacquard pillow cover with champagne gold geometric embroidery - 45x45 with 400g Core / Serene Gray
+15
Modern Luxury Polyester Jacquard Embroidered Pillowcase Geometric Metallic Line Decorative Throw Pillow Cover For Living Room Bedroom
-5%
$2.60-5.21
Mix MOQ : 2
Cartoon Undersea World Wall Stickers Sea Turtle Shark Coral PVC Waterproof Bathroom Decor For Toilet Smooth Wall
Cartoon Undersea World Wall Stickers Sea Turtle Shark Coral PVC Waterproof Bathroom Decor For Toilet Smooth Wall
like
Find Similar
Detailed sheet showing 30x90cm dimensions and layout of ocean world wall stickers - 30x90cm x 2pcs (fun-c19)
Cartoon Undersea World Wall Stickers Sea Turtle Shark Coral PVC Waterproof Bathroom Decor For Toilet Smooth Wall
$2.02
No MOQ
Toilet Rules Bathroom Wall Sticker Removable PVC Decorative Engraved Sign Waterproof Creative Home Art Decal For Washroom Restroom
Toilet Rules Bathroom Wall Sticker Removable PVC Decorative Engraved Sign Waterproof Creative Home Art Decal For Washroom Restroom
like
Find Similar
Detailed dimension layout for Toilet Rules wall decal, measuring 35cm by 42cm black print - 42*33CM
Toilet Rules Bathroom Wall Sticker Removable PVC Decorative Engraved Sign Waterproof Creative Home Art Decal For Washroom Restroom
-4%
$1.37
No MOQ
Floral Printed Throw Pillow Cover Decorative Watercolor Flower Cushion Case For Sofa Couch Home Decor Living Room Office
Floral Printed Throw Pillow Cover Decorative Watercolor Flower Cushion Case For Sofa Couch Home Decor Living Room Office
like
Find Similar
Bohemian pillow cover with pink flowers, feathers and Bless OUR HOME artistic text print - 45x45cm (No Insert) / Bless Our Home Style (YMD267-1)
Pink floral spring square throw pillow cover with bird house and fresh flower market print - 45x45cm (No Insert) / Fresh Flower Market Style (YMD267-2)
Pink floral rain boots print throw pillow cover with HOME sweet HOME artistic text design - 45x45cm (No Insert) / Home Sweet Home Style (YMD267-3)
Floral print pillow cover featuring pink flowers and Welcome To Our Home text design - 45x45cm (No Insert) / Welcome Style (YMD267-4)
NewFloral Printed Throw Pillow Cover Decorative Watercolor Flower Cushion Case For Sofa Couch Home Decor Living Room Office
-5%
$1.31
Mix MOQ : 2
Vintage Bathroom Door Sign Wall Sticker Black PVC Bathroom Removable Lettering Filigree Wall Decal For Bathroom Home Decor
Vintage Bathroom Door Sign Wall Sticker Black PVC Bathroom Removable Lettering Filigree Wall Decal For Bathroom Home Decor
like
Find Similar
Detailed view of black vinyl bathroom wall decal with size 29x18cm and floral scroll - 18*29cm/HY-F246
Vintage Bathroom Door Sign Wall Sticker Black PVC Bathroom Removable Lettering Filigree Wall Decal For Bathroom Home Decor
$0.72
No MOQ
Watercolor Flower Toilet Seat Sticker Waterproof PVC Floral Wall Decal For Bathroom Home Decoration Removable Art Decal
Watercolor Flower Toilet Seat Sticker Waterproof PVC Floral Wall Decal For Bathroom Home Decoration Removable Art Decal
like
Find Similar
Waterproof floral toilet seat sticker with warm orange peony and rose design - Four Seasons Flowers (MT23024)
Waterproof vintage watercolor flower toilet sticker with orange peonies, 22.6x24.5cm - Retro Peony Watercolor Style (MT23023)
Watercolor Flower Toilet Seat Sticker Waterproof PVC Floral Wall Decal For Bathroom Home Decoration Removable Art Decal
-4%
$0.41
No MOQ
Romantic Red Rose Bathroom Toilet Sticker Removable Waterproof PVC Floral Wall Decal Washroom Home Decoration Art Sticker
Romantic Red Rose Bathroom Toilet Sticker Removable Waterproof PVC Floral Wall Decal Washroom Home Decoration Art Sticker
like
Find Similar
Detailed guide showing sheet and finish sizes for red rose floral toilet wall stickers - 24*24CM (fun-m535)
Romantic Red Rose Bathroom Toilet Sticker Removable Waterproof PVC Floral Wall Decal Washroom Home Decoration Art Sticker
$0.86
No MOQ
Tropical Sunset Beach Palm Tree Toilet Lid Sticker Waterproof PVC Bathroom Decorative Decal For Toilet Cover Home Decoration
Tropical Sunset Beach Palm Tree Toilet Lid Sticker Waterproof PVC Bathroom Decorative Decal For Toilet Cover Home Decoration
like
Find Similar
Detailed sheet size 29x29cm of sunset beach palm tree watercolor bathroom wall sticker - 29*29cm
Tropical Sunset Beach Palm Tree Toilet Lid Sticker Waterproof PVC Bathroom Decorative Decal For Toilet Cover Home Decoration
$0.86
No MOQ
Cartoon Animals Panda Duck Frog Bathroom Wall Stickers Waterproof Removable PVC DIY Home Decor For Kids Room Bathroom
Cartoon Animals Panda Duck Frog Bathroom Wall Stickers Waterproof Removable PVC DIY Home Decor For Kids Room Bathroom
like
Find Similar
Detailed sheet of self-adhesive cartoon bathroom wall decals with panda and duck 60x40cm - 40*60cm
NewCartoon Animals Panda Duck Frog Bathroom Wall Stickers Waterproof Removable PVC DIY Home Decor For Kids Room Bathroom
$1.21
No MOQ
Mother's Day Linen Pillowcase Pink Rose Bicycle Pattern Decorative Cushion Cover For Sofa Living Room Home Decor Gift
Mother's Day Linen Pillowcase Pink Rose Bicycle Pattern Decorative Cushion Cover For Sofa Living Room Home Decor Gift
like
Find Similar
Square linen throw pillow cover with pink gingham and flower bicycle print for home decor - Rose Bicycle (DYM317-1)
Linen Mother's Day pillowcase with pink stripes and watercolor floral envelope - Rose Envelope Striped (DYM317-2)
Pink square velvet throw pillow cover with white I Love Mom print for Mother Day gift - I Love Mom Heart (DYM317-3)
Pink linen Mother's Day pillow cover with Happy Mother's Day print for home sofa decor - Happy Mother's Day (DYM317-4)
NewMother's Day Linen Pillowcase Pink Rose Bicycle Pattern Decorative Cushion Cover For Sofa Living Room Home Decor Gift
$1.30
Mix MOQ : 2
Spring Striped Printed Polyester Pillowcase Modern Gnome Floral Decorative Throw Cushion Cover For Home Living Room Decor
Spring Striped Printed Polyester Pillowcase Modern Gnome Floral Decorative Throw Cushion Cover For Home Living Room Decor
like
Find Similar
Square cotton linen throw pillow cover featuring a cute colorful gnome with spring flowers - 45*45cm (No Insert) / Gnome Pattern 1 (YMD257-1)
Colorful striped Hello Spring pillowcase with pastel tones and floral sketch design - 45*45cm (No Insert) / Gnome Pattern 2 (YMD257-2)
Spring gnome flower print decorative throw pillow cover in striped cream linen fabric - 45*45cm (No Insert) / Gnome Pattern 3 (YMD257-3)
Colorful striped square throw pillow cover with Bloom with Grace text on white background - 45*45cm (No Insert) / Gnome Pattern 4 (YMD257-4)
Spring Striped Printed Polyester Pillowcase Modern Gnome Floral Decorative Throw Cushion Cover For Home Living Room Decor
-5%
$1.31
Mix MOQ : 2
Flower Basket Toilet Sticker PVC Removable Bathroom Decor Wall Decal Botanical Pattern For Washroom Lid Decoration Home Art
Flower Basket Toilet Sticker PVC Removable Bathroom Decor Wall Decal Botanical Pattern For Washroom Lid Decoration Home Art
like
Find Similar
Floral basket wall sticker dimensions showing 29x29cm sheet and 27x27cm finished size - Colorful Flower Basket Style (fun-m322) / Standard Spec
Flower Basket Toilet Sticker PVC Removable Bathroom Decor Wall Decal Botanical Pattern For Washroom Lid Decoration Home Art
$0.86
No MOQ
Nordic Style Geometric Abstract Pattern Polyester Pillow Case Square Sofa Cushion Cover For Living Room Home Decorative Throw Pillowcase
Nordic Style Geometric Abstract Pattern Polyester Pillow Case Square Sofa Cushion Cover For Living Room Home Decorative Throw Pillowcase
like
Find Similar
Nordic minimalist square pillow case with vintage green floral geometric pattern on beige - 45x45cm / Cream Geometric Petal (CDR282-1)
Nordic geometric pillow cover featuring green and blue wave patterns on cream fabric - 45x45cm / Blue Green Wave (CDR282-2)
Modern Nordic square cushion cover featuring blue and green geometric concentric circles - 45x45cm / Blue Green Concentric Circles (CDR282-3)
Nordic geometric pillow cover featuring light blue and green abstract water drop patterns - 45x45cm / Blue Green Teardrop Pattern (CDR282-4)
+50
Nordic Style Geometric Abstract Pattern Polyester Pillow Case Square Sofa Cushion Cover For Living Room Home Decorative Throw Pillowcase
$1.21
Mix MOQ : 2
Cute Cartoon Big Eyed Cat Toilet Lid Sticker Waterproof PVC Animal Wall Decal For Bathroom Home Washroom Decor Removable Art
Cute Cartoon Big Eyed Cat Toilet Lid Sticker Waterproof PVC Animal Wall Decal For Bathroom Home Washroom Decor Removable Art
like
Find Similar
Cartoon kitten wall sticker dimensions 24x29cm for bathroom and toilet decoration - Cute Kitten (MG-M032) / 24*29cm
Cute Cartoon Big Eyed Cat Toilet Lid Sticker Waterproof PVC Animal Wall Decal For Bathroom Home Washroom Decor Removable Art
$0.72
No MOQ
Black White Swan Couple Toilet Lid Sticker Removable PVC Waterproof Bathroom Decal Modern Home Decoration Wall Sticker
Black White Swan Couple Toilet Lid Sticker Removable PVC Waterproof Bathroom Decal Modern Home Decoration Wall Sticker
like
Find Similar
Detail showing dimensions of black and white swan wall stickers for bathroom decor - 24.5*24.5cm/HY-M535
Black White Swan Couple Toilet Lid Sticker Removable PVC Waterproof Bathroom Decal Modern Home Decoration Wall Sticker
$0.58
No MOQ
Watercolor Bird And Flower Branch Waterproof Bathroom Toilet Sticker PVC Self-Adhesive Wall Decal For Home Decoration Art Style
Watercolor Bird And Flower Branch Waterproof Bathroom Toilet Sticker PVC Self-Adhesive Wall Decal For Home Decoration Art Style
like
Find Similar
Detail view of M-298 waterproof toilet sticker with 29cm bird and cherry blossom pattern - 29*29cm
Watercolor Bird And Flower Branch Waterproof Bathroom Toilet Sticker PVC Self-Adhesive Wall Decal For Home Decoration Art Style
$0.72
No MOQ
Sunflower Wreath WC Sign Wall Sticker PVC Waterproof Butterfly Floral Decal For Bathroom Toilet Door Decor
Sunflower Wreath WC Sign Wall Sticker PVC Waterproof Butterfly Floral Decal For Bathroom Toilet Door Decor
like
Find Similar
WC wall sticker featuring yellow sunflowers and pink butterflies in 29x29cm size - Sunflower WC Sign (PH-QT9076)
Sunflower Wreath WC Sign Wall Sticker PVC Waterproof Butterfly Floral Decal For Bathroom Toilet Door Decor
$0.86
No MOQ
Nordic Modern Minimalist Plush Pillow Case Soft Macaron Color Alphabet Flower Printed Throw Pillow Cover Decorative Cushion Case For Sofa Home Living Room
Nordic Modern Minimalist Plush Pillow Case Soft Macaron Color Alphabet Flower Printed Throw Pillow Cover Decorative Cushion Case For Sofa Home Living Room
like
Find Similar
Modern pink plush pillowcase with white geometric V-shape patterns for sofa decor - Pink Chevron (CDR37-1)
Pink square plush pillowcase featuring artistic Home Sweet Home lettering and hearts - Pink Home Letter (CDR37-2)
Modern white square cushion cover featuring pink floral pattern in minimalist Nordic style - White Pink Floral (CDR37-3)
Modern white plush pillowcase with pink geometric patterns including waves and dots - White Pink Geometric (CDR37-4)
+24
Nordic Modern Minimalist Plush Pillow Case Soft Macaron Color Alphabet Flower Printed Throw Pillow Cover Decorative Cushion Case For Sofa Home Living Room
$1.30
Mix MOQ : 2
Tie-Dye Plush Decorative Throw Pillow Case Soft Rainbow Square Cushion Cover For Sofa Living Room Bedroom Decor
Tie-Dye Plush Decorative Throw Pillow Case Soft Rainbow Square Cushion Cover For Sofa Living Room Bedroom Decor
like
Find Similar
Plush faux fur square pillow cover featuring vibrant rainbow tie-dye candy color patterns - 45*45cm (With 500g Brushed Fabric High Elastic Core) / Metallic Pink
Tie-dye plush pillow cover in purple and pink tones with soft faux rabbit fur texture - 45*45cm (With 500g Brushed Fabric High Elastic Core) / Dreamy Purple
+4
Tie-Dye Plush Decorative Throw Pillow Case Soft Rainbow Square Cushion Cover For Sofa Living Room Bedroom Decor
$2.31-5.04
Mix MOQ : 2
Removable PVC Underwater World Whale Girl Toilet Sticker Waterproof Fantasy Ocean Wall Decal For Bathroom Home Decor
Removable PVC Underwater World Whale Girl Toilet Sticker Waterproof Fantasy Ocean Wall Decal For Bathroom Home Decor
like
Find Similar
Detail of nautical wall stickers set with blue whale and stars, size 30x30 cm - 30*30CM In Bag
Removable PVC Underwater World Whale Girl Toilet Sticker Waterproof Fantasy Ocean Wall Decal For Bathroom Home Decor
$0.86
No MOQ
Cartoon Ocean World Toilet Lid Sticker Waterproof PVC Marine Life Fish Pattern Bathroom Decal For Home Decor
Cartoon Ocean World Toilet Lid Sticker Waterproof PVC Marine Life Fish Pattern Bathroom Decal For Home Decor
like
Find Similar
Cartoon ocean world wall stickers with colorful tropical fish and sea plants for home decor - M-32 Style / 29x36cm
Cartoon ocean world toilet lid stickers with colorful fish octopus and seaweed bathroom decor - M-33 Style / 29x36cm
Cartoon ocean world toilet stickers with colorful fish, seahorse, and sea plants decor - M-34 Style / 29x36cm
Cartoon Ocean World Toilet Lid Sticker Waterproof PVC Marine Life Fish Pattern Bathroom Decal For Home Decor
$1.01
No MOQ
Realistic Rose Flower Butterfly Toilet Lid Sticker Waterproof PVC Removable Bathroom Decorative Wall Decal For Home Decor
Realistic Rose Flower Butterfly Toilet Lid Sticker Waterproof PVC Removable Bathroom Decorative Wall Decal For Home Decor
like
Find Similar
Floral toilet seat lid decal featuring pink roses and butterflies in a home bathroom - Rose Butterfly Style (PH_QTB176)
Realistic Rose Flower Butterfly Toilet Lid Sticker Waterproof PVC Removable Bathroom Decorative Wall Decal For Home Decor
$0.63
No MOQ
Tropical Green Plant Leaves Toilet Sticker Waterproof PVC Monstera Palm Wall Decal For Bathroom Lid Decor Wall Sticker
Tropical Green Plant Leaves Toilet Sticker Waterproof PVC Monstera Palm Wall Decal For Bathroom Lid Decor Wall Sticker
like
Find Similar
Detailed dimension sheet of tropical leaf wall sticker M-308 showing 29cm by 22cm size - 22x29cm
Tropical Green Plant Leaves Toilet Sticker Waterproof PVC Monstera Palm Wall Decal For Bathroom Lid Decor Wall Sticker
$0.63
No MOQ
Soft Polyester Flannel Blanket Elephant And Rose Printed Sofa Throw Blanket Warm Decorative Nap Blanket For Home Office
Soft Polyester Flannel Blanket Elephant And Rose Printed Sofa Throw Blanket Warm Decorative Nap Blanket For Home Office
like
Find Similar
French elephant flannel blanket with pink roses on deep blue background draped over a chair - 100x150cm
Soft Polyester Flannel Blanket Elephant And Rose Printed Sofa Throw Blanket Warm Decorative Nap Blanket For Home Office
-5%
$4.52
No MOQ
European Baroque Floral Toilet Lid Sticker Vintage Gold Green PVC Self Adhesive Waterproof Bathroom Decorative Wall Decal Home Decor
European Baroque Floral Toilet Lid Sticker Vintage Gold Green PVC Self Adhesive Waterproof Bathroom Decorative Wall Decal Home Decor
like
Find Similar
Detail of European retro relief wall sticker with gold scroll and dark green floral pattern - 25*29cm / Gold Green Vintage Pattern (M-344)
European Baroque Floral Toilet Lid Sticker Vintage Gold Green PVC Self Adhesive Waterproof Bathroom Decorative Wall Decal Home Decor
$0.72
No MOQ
Romantic Watercolor Bird And Flower Toilet Sticker PVC Waterproof Removable Bathroom Decal Home Decor Adhesive Toilet Wall Sticker
Romantic Watercolor Bird And Flower Toilet Sticker PVC Waterproof Removable Bathroom Decal Home Decor Adhesive Toilet Wall Sticker
like
Find Similar
Floral wall sticker with birds on pink cherry blossom branches, size 29cm M-298 - 29*29cm Layout/M-298
Romantic Watercolor Bird And Flower Toilet Sticker PVC Waterproof Removable Bathroom Decal Home Decor Adhesive Toilet Wall Sticker
$0.58
No MOQ
Cute Cartoon Cat In Teacup Toilet Sticker PVC Waterproof Wall Decal With Flower And Butterfly For Bathroom Home Decor
Cute Cartoon Cat In Teacup Toilet Sticker PVC Waterproof Wall Decal With Flower And Butterfly For Bathroom Home Decor
like
Find Similar
Cute orange cat in coffee cup wall sticker with flowers and butterflies, 29x29cm size - Little Cat Toilet Sticker (PH_QTA173)
Cute Cartoon Cat In Teacup Toilet Sticker PVC Waterproof Wall Decal With Flower And Butterfly For Bathroom Home Decor
-11%
$0.76
No MOQ
Gold Magnolia Floral Toilet Lid Sticker Elegant White Flower PVC Removable Wall Decal For Bathroom Home Decoration Mural
Gold Magnolia Floral Toilet Lid Sticker Elegant White Flower PVC Removable Wall Decal For Bathroom Home Decoration Mural
like
Find Similar
Detailed sheet of golden floral magnolia wall stickers with size and layout dimensions - Magnolia Style (HY-M377)
Detailed sheet size 29x29cm and finish size 27x27cm for golden floral wall stickers - Magnolia Style (HY-M378)
Detail view showing sheet and finish sizes of golden flower wall stickers for bathroom decor - Magnolia Style (HY-M379)
Gold Magnolia Floral Toilet Lid Sticker Elegant White Flower PVC Removable Wall Decal For Bathroom Home Decoration Mural
$0.63-0.86
No MOQ
Cherry Blossom Toilet Sticker Waterproof PVC Floral Wall Decal For Bathroom Home Decor Modern Minimalist Beautification Mural
Cherry Blossom Toilet Sticker Waterproof PVC Floral Wall Decal For Bathroom Home Decor Modern Minimalist Beautification Mural
like
Find Similar
Detail view of pink plum blossom wall sticker layout with size 29cm x 19cm dimensions - Pink Cherry Blossom Branch Style (19*29CM/fun-m42)
Cherry Blossom Toilet Sticker Waterproof PVC Floral Wall Decal For Bathroom Home Decor Modern Minimalist Beautification Mural
$0.72
No MOQ
Luxury Metallic High Precision Jacquard Cushion Cover Modern Geometric Floral Relief Pillowcase Retro Decorative Pillow Cover For Sofa
Luxury Metallic High Precision Jacquard Cushion Cover Modern Geometric Floral Relief Pillowcase Retro Decorative Pillow Cover For Sofa
like
Find Similar
Dark bronze decorative cushion cover with embossed floral texture on pink velvet sofa - 45x45cm With 500g Inner Core / Vintage Gold Floral (2)
Modern square pillow cover with black and white speckled texture on a velvet sofa - 45x45cm With 500g Inner Core / Black White Starry (4)
Modern black throw pillow cover with silver geometric patterns on a luxury sofa - 45x45cm With 500g Inner Core / Black Silver Geometric Line (1)
Modern minimalist dark silver cushion cover with 3D geometric pattern on a velvet sofa - 45x45cm With 500g Inner Core / 3D Geometric Triangle (3)
+8
Luxury Metallic High Precision Jacquard Cushion Cover Modern Geometric Floral Relief Pillowcase Retro Decorative Pillow Cover For Sofa
$3.17-5.91
Mix MOQ : 2
Nordic Minimalist Plush Double Sided Spotted Throw Pillow Cover Dalmatian Pattern Decorative Cushion Case For Sofa Home Decor
Nordic Minimalist Plush Double Sided Spotted Throw Pillow Cover Dalmatian Pattern Decorative Cushion Case For Sofa Home Decor
like
Find Similar
Modern Nordic plush throw pillow with black and white spotted faux fur on a sofa - 45*45cm (No Core) / White
Plush black and white spotted throw pillow on a minimalist sofa with a green cactus background - 45*45cm (No Core) / Black
+10
NewNordic Minimalist Plush Double Sided Spotted Throw Pillow Cover Dalmatian Pattern Decorative Cushion Case For Sofa Home Decor
-5%
$1.92-5.75
Mix MOQ : 2
Watercolor Eucalyptus Leaves Toilet Sticker PVC Waterproof Green Plant Wall Decal For Bathroom Home Decor Modern Mural
Watercolor Eucalyptus Leaves Toilet Sticker PVC Waterproof Green Plant Wall Decal For Bathroom Home Decor Modern Mural
like
Find Similar
Detail view of watercolor eucalyptus wall sticker with dimensions 29cm x 27cm - Eucalyptus Style (M-204)
Watercolor Eucalyptus Leaves Toilet Sticker PVC Waterproof Green Plant Wall Decal For Bathroom Home Decor Modern Mural
$0.52
No MOQ
Cartoon Cat Printed Flannel Fleece Blanket Soft Warm Polyester Throw For Sofa Couch Bed Nap Home Decor Fleece Blanket
Cartoon Cat Printed Flannel Fleece Blanket Soft Warm Polyester Throw For Sofa Couch Bed Nap Home Decor Fleece Blanket
like
Find Similar
Cartoon cat flannel blanket featuring life is better with cats slogan on gray sofa - 100x150cm
Cartoon Cat Printed Flannel Fleece Blanket Soft Warm Polyester Throw For Sofa Couch Bed Nap Home Decor Fleece Blanket
-5%
$4.52
No MOQ
Golden Butterfly Flower Baroque Wall Sticker PVC Waterproof Removable Toilet Decal Vintage Luxurious Home Decor Background Mural
Golden Butterfly Flower Baroque Wall Sticker PVC Waterproof Removable Toilet Decal Vintage Luxurious Home Decor Background Mural
like
Find Similar
Golden floral butterfly wall sticker with detailed damask patterns for home decoration - TA217-Gold Pattern-30-30 (No Bag)
Golden Butterfly Flower Baroque Wall Sticker PVC Waterproof Removable Toilet Decal Vintage Luxurious Home Decor Background Mural
$0.92
Mix MOQ : 4
Watercolor Tulip Flower PVC Toilet Lid Sticker Removable Self Adhesive Bathroom Decor Floral Wall Decal For Home Decor
Watercolor Tulip Flower PVC Toilet Lid Sticker Removable Self Adhesive Bathroom Decor Floral Wall Decal For Home Decor
like
Find Similar
Waterproof PVC tulip stickers for toilet lid decoration featuring realistic orange flowers - Tulip Pattern(PH-QT1047)
Watercolor Tulip Flower PVC Toilet Lid Sticker Removable Self Adhesive Bathroom Decor Floral Wall Decal For Home Decor
$0.72
No MOQ
Minimalist Black White Camellia Polyester Pillowcase Modern Geometric Print Cushion Cover For Sofa Living Room Home Decor
Minimalist Black White Camellia Polyester Pillowcase Modern Geometric Print Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Minimalist black and off-white camellia pattern throw pillow cover with abstract art - 45X45 Double Sided Velvet (No Insert) / Camellia Line Style (crs801)
Minimalist black and white camellia pillow cover with elegant oval chain frame design - 45X45 Double Sided Velvet (No Insert) / Oval Letter Layout Style (crs80-2)
Minimalist black and white camellia flower pillow cover with grid pattern for home sofa - 45X45 Double Sided Velvet (No Insert) / Large Camellia Grid Style (crs80-3)
Detail of minimalist camellia cushion cover with black frame and slogan border - 45X45 Double Sided Velvet (No Insert) / Letter Border Camellia Style (crs80-4)
+2
Minimalist Black White Camellia Polyester Pillowcase Modern Geometric Print Cushion Cover For Sofa Living Room Home Decor
$1.67
No MOQ
Pink Rose Gold Letter Floral Cushion Cover Polyester Square Pillow Case For Sofa Home Living Room Decor Decorative Pillowcase
Pink Rose Gold Letter Floral Cushion Cover Polyester Square Pillow Case For Sofa Home Living Room Decor Decorative Pillowcase
like
Find Similar
Pink rose gold cushion cover with golden letter A and watercolor floral print - 18x18 Inch / Letter A (DRD152-A)
Pink and rose gold letter B decorative pillowcase with elegant floral design - 18x18 Inch / Letter B (DRD152-B)
Pink decorative pillowcase with a floral watercolor letter C in rose gold print - 18x18 Inch / Letter C (DRD152-C)
Pink and rose gold square pillowcase featuring a floral letter D design for home decor - 18x18 Inch / Letter D (DRD152-D)
+23
Pink Rose Gold Letter Floral Cushion Cover Polyester Square Pillow Case For Sofa Home Living Room Decor Decorative Pillowcase
-5%
$1.20
Mix MOQ : 2
Pink Peony Flower And Dragonfly Toilet Sticker Waterproof PVC Self Adhesive Bathroom Beautification Wall Decal For Toilet Tank Decor
Pink Peony Flower And Dragonfly Toilet Sticker Waterproof PVC Self Adhesive Bathroom Beautification Wall Decal For Toilet Tank Decor
like
Find Similar
Detail of pink peony flowers and blue dragonfly sticker showing 29cm dimensions - Pink Peony Flower And Dragonfly Style (M-245) / 29cmx29cm
Pink Peony Flower And Dragonfly Toilet Sticker Waterproof PVC Self Adhesive Bathroom Beautification Wall Decal For Toilet Tank Decor
$0.72
No MOQ
Tropical Jungle Tiger Printed Pillow Case Polyester American Minimalist Leaf Geometric Decorative Cushion Cover For Sofa Bed
Tropical Jungle Tiger Printed Pillow Case Polyester American Minimalist Leaf Geometric Decorative Cushion Cover For Sofa Bed
like
Find Similar
Modern black and white tiger print throw pillow cover in soft peach skin fabric - Black And White Zebra Print (DRD402-1)
Modern emerald cushion cover with elegant white lilies and hummingbirds print - Dark Green Hummingbird Lily (DRD402-2)
Tropical tiger and palm leaf pattern square cushion cover for home sofa decor - Tropical Tiger with Greenery (DRD402-3)
Tropical jungle tiger print square pillowcase featuring green leaves and wild animal motif - Tiger with Cub (DRD402-4)
+7
Tropical Jungle Tiger Printed Pillow Case Polyester American Minimalist Leaf Geometric Decorative Cushion Cover For Sofa Bed
$1.27
Mix MOQ : 2
3D Realistic Cat Toilet Lid Sticker Waterproof PVC Bathroom Decal Funny Animal Wall Art For Toilet Seat Cover Home Decor
3D Realistic Cat Toilet Lid Sticker Waterproof PVC Bathroom Decal Funny Animal Wall Art For Toilet Seat Cover Home Decor
like
Find Similar
Detailed dimension guide for 3D cartoon cat wall sticker showing 25cm by 29cm measurements - Brown Longhair Cat (fun-m121)
Detailed dimensions of 3D cat toilet sticker showing 29cm height and 25cm width layout - Brown Peeking Cat (fun-m122)
3D cartoon tabby cat wall sticker detail showing product size 25cm by 29cm for bathroom decor - Tabby Cat from Hole (fun-m123)
Detail showing 3D cat wall sticker with dimensions 29x25cm for bathroom decor - Brown Black Striped Kitten (fun-m124)
+5
3D Realistic Cat Toilet Lid Sticker Waterproof PVC Bathroom Decal Funny Animal Wall Art For Toilet Seat Cover Home Decor
$0.72
No MOQ
Blue Butterfly Floral Print Lumbar Pillowcase Soft Short Plush Decorative Cushion Cover For Sofa Living Room Home Decor
Blue Butterfly Floral Print Lumbar Pillowcase Soft Short Plush Decorative Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Rectangular pillowcase featuring blue floral prints, butterflies, and a white center blank - Blue Hydrangea Butterfly Style (CDR348-5) / 30*50cm Short Plush Single Sided Without Core
Rectangular pillowcase featuring blue watercolor floral pattern on a white fabric background - Blue Watercolor Floral Wreath Style (CDR348-6) / 30*50cm Short Plush Single Sided Without Core
Blue butterfly floral lumbar pillow cover with watercolor hydrangea on white background - Blue Hydrangea Herbal Style (CDR348-1) / 30*50cm Short Plush Single Sided Without Core
Blue butterfly floral print lumbar pillowcase in white watercolor art style - Blue Floral Cluster Butterfly Style (CDR348-2) / 30*50cm Short Plush Single Sided Without Core
+2
NewBlue Butterfly Floral Print Lumbar Pillowcase Soft Short Plush Decorative Cushion Cover For Sofa Living Room Home Decor
$1.30
Mix MOQ : 2
Cute Cartoon Bear Snowman Love Heart Toilet Lid Sticker PVC Removable Self Adhesive Bathroom Wall Decal Home Decoration
Cute Cartoon Bear Snowman Love Heart Toilet Lid Sticker PVC Removable Self Adhesive Bathroom Wall Decal Home Decoration
like
Find Similar
Detailed size chart showing teddy bear and snowman wall sticker dimensions in cm and inches - Cartoon Bear Snowman Style (HY-M300)
Cute Cartoon Bear Snowman Love Heart Toilet Lid Sticker PVC Removable Self Adhesive Bathroom Wall Decal Home Decoration
$0.86
No MOQ
Tropical Flamingo Leaves Toilet Sticker Waterproof PVC Bathroom Decal Pink Flamingo Monstera Leaf Home Decoration Sticker
Tropical Flamingo Leaves Toilet Sticker Waterproof PVC Bathroom Decal Pink Flamingo Monstera Leaf Home Decoration Sticker
like
Find Similar
Detail view showing tropical flamingo and monstera leaf wall sticker sizing at 29x29cm - Flamingo Style (fun-m161)
Tropical Flamingo Leaves Toilet Sticker Waterproof PVC Bathroom Decal Pink Flamingo Monstera Leaf Home Decoration Sticker
$0.72
No MOQ
Mermaid Silhouette Wall Sticker Waterproof PVC Decal For Bathroom Living Room Bedroom Home Decorative Mermaid Wall Art Bubbles Mural
Mermaid Silhouette Wall Sticker Waterproof PVC Decal For Bathroom Living Room Bedroom Home Decorative Mermaid Wall Art Bubbles Mural
like
Find Similar
5 options
Mermaid Silhouette Wall Sticker Waterproof PVC Decal For Bathroom Living Room Bedroom Home Decorative Mermaid Wall Art Bubbles Mural
-5%
$1.23
No MOQ
Cartoon Cat Butterfly Toilet Sticker Waterproof PVC Decorative Wall Decal For Bathroom Home Decoration Sticker
Cartoon Cat Butterfly Toilet Sticker Waterproof PVC Decorative Wall Decal For Bathroom Home Decoration Sticker
like
Find Similar
Cartoon cat and butterfly wall sticker fun-m160 showing product size 29cm x 29cm - Cartoon Cat Butterfly (fun-m160)
Cartoon Cat Butterfly Toilet Sticker Waterproof PVC Decorative Wall Decal For Bathroom Home Decoration Sticker
$0.72
No MOQ
Watercolor Dolphin Flower Butterfly Toilet Sticker Waterproof PVC Wall Decal For Bathroom Home Decor Removable Lid Sticker
Watercolor Dolphin Flower Butterfly Toilet Sticker Waterproof PVC Wall Decal For Bathroom Home Decor Removable Lid Sticker
like
Find Similar
Detailed dimensions of cartoon dolphin and flower wall stickers measuring 29cm x 27cm - 27x29cm
Watercolor Dolphin Flower Butterfly Toilet Sticker Waterproof PVC Wall Decal For Bathroom Home Decor Removable Lid Sticker
$0.72
No MOQ
Floral WC Bathroom Door Sticker PVC Waterproof Self Adhesive Toilet Sign Wall Decal Romantic Rose Wreath Home Decor
Floral WC Bathroom Door Sticker PVC Waterproof Self Adhesive Toilet Sign Wall Decal Romantic Rose Wreath Home Decor
like
Find Similar
Detail showing dimensions of floral WC wall sticker with red roses and gold ring - 24*24cm (HY-M511)
NewFloral WC Bathroom Door Sticker PVC Waterproof Self Adhesive Toilet Sign Wall Decal Romantic Rose Wreath Home Decor
$0.58
No MOQ
Go to

More in home & kitchen

Explore more in bedding & bathroom

homecolorholderstoragestylepolyesterdoubleheaddesignheart
hangingplastictravelshapecleaningsimplekidslayerwhitedaily

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access