Everful

Wholesale bedding & bathroom

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bedding & Bathroom

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Silicone Scalp Massage Brush Soft Bristle Shampoo Scrubber For Hair Washing Manual Wet Dry Use Non Slip Handle
Silicone Scalp Massage Brush Soft Bristle Shampoo Scrubber For Hair Washing Manual Wet Dry Use Non Slip Handle
like
Find Similar
Pink silicone scalp massage hair brush with ergonomic handle and soft conical bristles - Pink
Light blue silicone scalp massager brush with ergonomic handle for hair washing - Blue
Ergonomic matte black silicone scalp massager brush for hair washing and head massage - Black
Ergonomic deep purple silicone scalp massager brush for wet and dry hair washing - Purple
+10
Silicone Scalp Massage Brush Soft Bristle Shampoo Scrubber For Hair Washing Manual Wet Dry Use Non Slip Handle
$0.81
Mix MOQ : 3
 · 
17 sold recently
Bra Laundry Wash Bag Mesh Underwear Protector Cylinder Polyester Floral Print Zippered Anti-Deformation Washing Machine
Bra Laundry Wash Bag Mesh Underwear Protector Cylinder Polyester Floral Print Zippered Anti-Deformation Washing Machine
like
Find Similar
Pink and white cylindrical mesh laundry bag with fine mesh and resin zipper protection - Graphic Print
Bra Laundry Wash Bag Mesh Underwear Protector Cylinder Polyester Floral Print Zippered Anti-Deformation Washing Machine
$0.35
Mix MOQ : 4
 · 
10 sold recently
Minimalist Tissue Box Holder Rectangular Plastic With Gray Lid Vertical Stripe Desktop Dispenser For Home Office
Minimalist Tissue Box Holder Rectangular Plastic With Gray Lid Vertical Stripe Desktop Dispenser For Home Office
like
Find Similar
Minimalist white tissue box with grey lid and vertical stripe texture 20x12.5cm - Grey and White
Minimalist Tissue Box Holder Rectangular Plastic With Gray Lid Vertical Stripe Desktop Dispenser For Home Office
-4%
$3.21
No MOQ
 · 
37 sold recently
Portable Toothbrush Case Plastic 3D Flower Embossed Travel Toothbrush Holder Cup With Lid Dustproof Storage
Portable Toothbrush Case Plastic 3D Flower Embossed Travel Toothbrush Holder Cup With Lid Dustproof Storage
like
Find Similar
Lavender portable toothbrush travel case with embossed flower pattern and cream lid - Flower Relief / Purple
Light blue floral embossed portable travel toothbrush case with beige lid and textured finish - Flower Relief / Blue
Portable blue toothbrush case with textured weave design and white lid for travel use - Butterfly Relief / Butterfly Blue
Portable beige toothbrush case featuring diamond texture and butterfly emblem - Butterfly Relief / Butterfly Beige
+4
Portable Toothbrush Case Plastic 3D Flower Embossed Travel Toothbrush Holder Cup With Lid Dustproof Storage
$0.53-0.65
Mix MOQ : 3
 · 
27 sold recently
Portable Retainer Case Plastic Denture Storage Box Breathable Orthodontic Mouth Guard Container For Travel And Daily Use
Portable Retainer Case Plastic Denture Storage Box Breathable Orthodontic Mouth Guard Container For Travel And Daily Use
like
Find Similar
Glossy black portable dental retainer case with sturdy hinge for aligner storage - Black
White plastic orthodontic retainer case with a side-opening flip lid and portable hole - White
Professional rose red dental retainer box for clear aligners and orthodontic storage - Pink
Cyan blue orthodontic retainer box with ventilated holes and secure snap closure - Light Blue
+6
Portable Retainer Case Plastic Denture Storage Box Breathable Orthodontic Mouth Guard Container For Travel And Daily Use
-9%
$0.20
Mix MOQ : 3
 · 
2K+ sold recently
Non-Slip Plastic Washboard With Soap Holder Drainage Grids Manual Laundry Scrub Board For Household Clothes Washing
Non-Slip Plastic Washboard With Soap Holder Drainage Grids Manual Laundry Scrub Board For Household Clothes Washing
like
Find Similar
Thickened blue plastic washboard with non-slip ridges for hand laundry, 37x17.5cm - Small / Blue
Small pink plastic washboard with non-slip wave texture for home laundry - Small / Pink
Small gray non-slip plastic washboard with soap slot for hand washing small clothes - Small / Gray
Small white plastic washboard with non-slip wavy surface and hanging hole for home use - Small / White
+4
Non-Slip Plastic Washboard With Soap Holder Drainage Grids Manual Laundry Scrub Board For Household Clothes Washing
-5%
$1.42-2.07
No MOQ
 · 
1 reviews
Reed Diffuser Home Fragrance Glass Jar With Fiber Reeds And Dried Flowers Floating Flora Long Lasting Room Decor
Reed Diffuser Home Fragrance Glass Jar With Fiber Reeds And Dried Flowers Floating Flora Long Lasting Room Decor
like
Find Similar
100ml glass reed diffuser with red dried flowers and pine cones in golden ring bottle - Perfume Lover [100ml]
100ml square bottle reed diffuser with dried orange slices and cinnamon sticks - Citrus [100ml]
100ml square glass diffuser bottle with yellow dried flowers and white fiber sticks - Shangri-La [100ml]
100ml square bottle reed diffuser with yellow liquid and dried flowers inside - Freesia [100ml]
+1
Reed Diffuser Home Fragrance Glass Jar With Fiber Reeds And Dried Flowers Floating Flora Long Lasting Room Decor
$1.73
No MOQ
 · 
63 views
Electrostatic Dust Removal Flat Mop Swivel Head Iron Pole Floor Cleaning Tool For Disposable Paper Minimalist White
Electrostatic Dust Removal Flat Mop Swivel Head Iron Pole Floor Cleaning Tool For Disposable Paper Minimalist White
like
Find Similar
Japanese style flat mop cleaning kit with grey storage box and 10 electrostatic dust sheets - Boxed Set + 10 Dust Sheets
Detailed view of the 180 degree rotating joint and non-slip textured mop cloth cleaning head - Bulk/Loose Packaging
Japanese-style mini mop head for electrostatic dust removal paper, SKU variant view - Upgraded Version
Electrostatic Dust Removal Flat Mop Swivel Head Iron Pole Floor Cleaning Tool For Disposable Paper Minimalist White
-5%
$2.41-3.29
No MOQ
 · 
20 views
Cotton Braided Candle Wick With Sustainer Tabs And Centering Tool For DIY Candle Making Natural Low Smoke
Cotton Braided Candle Wick With Sustainer Tabs And Centering Tool For DIY Candle Making Natural Low Smoke
like
Find Similar
Close-up of 24-ply braided cotton candle wick with a round metal sustain tab base - 15m
Detailed view of 11.3cm wooden candle wick centering tool with a central hole for DIY - 5pcs Wooden Wick Holders
Bulk stack of 24-ply cotton candle wick stickers with white foam adhesive pads - Wick Stickers (20pcs/Sheet)
Three-hole stainless steel candle wick centering tool for handmade DIY candle making - Metal Wick Holder
+6
Cotton Braided Candle Wick With Sustainer Tabs And Centering Tool For DIY Candle Making Natural Low Smoke
-8%
$0.10-1.51
Mix MOQ : 2
 · 
642 sold recently
Decorative Deer Head Antler Wall Hook Self Adhesive No Drill Geometric ABS Plastic Hanger For Keys Jewelry Towels
Decorative Deer Head Antler Wall Hook Self Adhesive No Drill Geometric ABS Plastic Hanger For Keys Jewelry Towels
like
Find Similar
White minimalist antler wall hook with adhesive backing for no-drill home organization - Plain Style / White (Moose Style)
Glossy black deer head adhesive wall hook with antlers for punch-free home organization - Plain Style / Black (Moose Style)
Grey antler-shaped decorative wall hook with strong adhesive backing for home storage - Plain Style / Grey (Moose Style)
Creative black antler wall hook with gold tips and adhesive back, size 11.5x6x17cm - Geometric Gold Antler / Black (Upgrade Style)
+2
Decorative Deer Head Antler Wall Hook Self Adhesive No Drill Geometric ABS Plastic Hanger For Keys Jewelry Towels
-4%
$0.77-1.53
No MOQ
 · 
33 views
Men Wearable Bath Towel Skirt Coral Fleece Thickened Absorbent Quick Dry Elastic Waist With Pocket Buttons Embroidery
Men Wearable Bath Towel Skirt Coral Fleece Thickened Absorbent Quick Dry Elastic Waist With Pocket Buttons Embroidery
like
Find Similar
Men's navy coral fleece wearable bath towel wrap with button and pocket detail - Men's Bath Skirt / Blue
Men's dark grey coral fleece wearable bath towel with waist snaps and embroidery - Men's Bath Skirt / Gray
Men khaki coral fleece wearable bath towel wrap with pocket and white embroidery - Men's Bath Skirt / Camel
Blue coral fleece men's bathrobe set with absorbent towel and embroidered pocket - Men's Bath Skirt And Towel Set / Blue
+2
Men Wearable Bath Towel Skirt Coral Fleece Thickened Absorbent Quick Dry Elastic Waist With Pocket Buttons Embroidery
$3.46-4.18
Mix MOQ : 2
 · 
18 views
Bath Brush Body Scrubber Natural Boar Bristles Loofah Wood Handle Double Sided For Back Cleaning Shower Massage
Bath Brush Body Scrubber Natural Boar Bristles Loofah Wood Handle Double Sided For Back Cleaning Shower Massage
like
Find Similar
Dual-pack long handle loofah bath brushes with natural fiber and wooden handles - 37cm Long Handle 10cm Loofah Brush With OPP Packaging
Natural loofah bath brush with a round wooden handle and a convenient hanging hemp rope - 37cm Long Handle 10cm Loofah Brush Bulk
Natural boar bristle bath brush with massage nodes and round wooden base handle - 11cm Round Hemlock Brush With Nodes
Dual-sided body massage brush with natural bristles and smooth wooden handle strap - Handheld Varnished Massage Brush With Nodes 12.5x6.5cm
+13
Bath Brush Body Scrubber Natural Boar Bristles Loofah Wood Handle Double Sided For Back Cleaning Shower Massage
$0.84-2.45
No MOQ
 · 
1K+ sold recently
Top 3% Best Sellers
in Bathroom
Disposable Kitchen Sink Filter Mesh Bags Fine Hole Drain Strainer Clogging Prevention Elastic Polyester Net Waste Filter
Disposable Kitchen Sink Filter Mesh Bags Fine Hole Drain Strainer Clogging Prevention Elastic Polyester Net Waste Filter
like
Find Similar
White fine mesh kitchen sink strainer bag for filtering food waste and residues - Fine Mesh 30PCS
Close-up of a stainless steel mesh sink strainer filtering green vegetable residue effectively - Coarse Mesh 100PCS
Pack of 100 white elastic mesh kitchen sink strainers in clear hanging bag - Fine Mesh 100PCS (Premium Bag)
Disposable Kitchen Sink Filter Mesh Bags Fine Hole Drain Strainer Clogging Prevention Elastic Polyester Net Waste Filter
-3%
$0.19-0.49
Mix MOQ : 4
 · 
17 views
Flower Scented Candle Peony Shaped Paraffin Wax Aromatherapy Home Decor In Textured Glass Bowl Romantic Atmosphere
Flower Scented Candle Peony Shaped Paraffin Wax Aromatherapy Home Decor In Textured Glass Bowl Romantic Atmosphere
like
Find Similar
Purple peony scented candle in striped glass bowl with luxury pearl aesthetic decor - Vertical Stripe Glass Purple (Lavender)
Peony scented candle in a 296g fluted glass bowl with mint green flower design - Vertical Stripe Glass Green (Jasmine Green Tea)
Pale pink peony flower scented candle in 296g ribbed glass bowl for home decor - Vertical Stripe Glass Flesh Pink (White Peach Oolong)
Ivory peony scented candle in textured glass bowl, 296g weight and 9cm diameter size - Wave Texture Glass White (Tuberose)
+10
Flower Scented Candle Peony Shaped Paraffin Wax Aromatherapy Home Decor In Textured Glass Bowl Romantic Atmosphere
$2.25
No MOQ
 · 
17 sold recently
Handmade Scented Candle Soy Wax Aromatherapy Marble Pattern Gypsum Cup Wood Wick Angel Decor Relaxation Home Decor Packaging
Handmade Scented Candle Soy Wax Aromatherapy Marble Pattern Gypsum Cup Wood Wick Angel Decor Relaxation Home Decor Packaging
like
Find Similar
Handmade soy candle with gray marble octagon jar and purple watercolor gift box - English Pear & Freesia
Handmade soy wax scented candle with marble pattern holder and watercolor gift box - Bluebell
Artistic marble pattern soy candle in hexagonal container with wood wick and gift box - Lavender
Handmade Scented Candle Soy Wax Aromatherapy Marble Pattern Gypsum Cup Wood Wick Angel Decor Relaxation Home Decor Packaging
-11%
$1.48
Mix MOQ : 2
 · 
10 sold recently
Halloween Wall Stickers PVC Bloody Handprints Footprints Window Decals Glow In Dark Scary Home Decor Party Supplies Removable
Halloween Wall Stickers PVC Bloody Handprints Footprints Window Decals Glow In Dark Scary Home Decor Party Supplies Removable
like
Find Similar
Halloween pumpkin and bat wall sticker set including 4 sheets of 21x29cm decals - MS4047-ZC (Pumpkin Ghost Scene/Set of 4)
Set of 4 Halloween bloody handprint wall stickers with size dimensions and specifications - MS4048-ZC (Witch Werewolf Scene/Set of 4)
Three-piece set of Halloween cartoon monster pumpkin face self-adhesive wall stickers - BM2037-KQ (Monster Face/Set of 3)
Detail view of Halloween wall stickers with blood prints, reaper, and size specs - CTX4017-ZC (Death Scythe/30*40cm)
+27
Halloween Wall Stickers PVC Bloody Handprints Footprints Window Decals Glow In Dark Scary Home Decor Party Supplies Removable
$0.78-4.32
Mix MOQ : 2
Free Shipping
Mini Round Metal Tin Boxes With Lids Tinplate Portable Ointment Balm Cosmetic Sample Container Storage Jars For Travel
Mini Round Metal Tin Boxes With Lids Tinplate Portable Ointment Balm Cosmetic Sample Container Storage Jars For Travel
like
Find Similar
Macro detail of a 20g white round tin container with open lid showing metal interior - D50*18mm / Glossy White
Detail of a round matte black metal container showing its lid and inner silver lining - D50*18mm / Matte Grey
Empty silver metal tin 50mm diameter 18mm height for cosmetic cream and lip balm - D50*18mm / Silver
Mini Round Metal Tin Boxes With Lids Tinplate Portable Ointment Balm Cosmetic Sample Container Storage Jars For Travel
$0.36
No MOQ
 · 
61 sold recently
Hanging Mesh Storage Bag Breathable Polyester Wall Mounted Reusable Kitchen Organizer For Garlic Onion Vegetable Fruit
Hanging Mesh Storage Bag Breathable Polyester Wall Mounted Reusable Kitchen Organizer For Garlic Onion Vegetable Fruit
like
Find Similar
Wall-mounted off-white mesh storage bag for ginger and garlic, 30x40cm breathable polyester - Small Single Layer (30*40cm) / Off White
Wall-mounted off-white mesh storage bag for ginger and garlic in a breathable design - No Label Version / White
Hanging white mesh storage bag for ginger and garlic with a brown decorative label - Large Double Layer (40*50cm) / Off White
Gray mesh storage bag with green handles for kitchen ginger and garlic wall hanging - Large Single Layer (40*50cm) / Grey Green
+1
Hanging Mesh Storage Bag Breathable Polyester Wall Mounted Reusable Kitchen Organizer For Garlic Onion Vegetable Fruit
$0.35-0.63
Mix MOQ : 5
 · 
20 sold recently
Diamond Embossed Glass Storage Jar With Lid Decorative Crystal Jewelry Candy Organizer Desktop Cosmetic Container Jar
Diamond Embossed Glass Storage Jar With Lid Decorative Crystal Jewelry Candy Organizer Desktop Cosmetic Container Jar
like
Find Similar
European crystal glass storage jar with pink crystals and diamond-cut texture surface - Transparent 300ml
Diamond Embossed Glass Storage Jar With Lid Decorative Crystal Jewelry Candy Organizer Desktop Cosmetic Container Jar
-5%
$1.23
No MOQ
 · 
41 sold recently
Multi Functional Cleaning Tool Telescopic Aluminum Alloy Pole Replaceable Broom Squeegee Mop Brush Heads For Floor Home
Multi Functional Cleaning Tool Telescopic Aluminum Alloy Pole Replaceable Broom Squeegee Mop Brush Heads For Floor Home
like
Find Similar
White plastic Y-shaped clothes pole replacement head with hanging hook and U-shaped slots - Clothes Fork Head (White)
Multipurpose magic broom head with rotatable joint and high-elastic foam squeegee - Squeegee Head (White)
Multipurpose double-layer sponge brush head replacement for bathroom cleaning tool - Sponge Brush Head (White)
Multifunctional grey floor brush head with stiff synthetic bristles and swivel joint - Boat Shape Brush Head (Grey)
+6
Multi Functional Cleaning Tool Telescopic Aluminum Alloy Pole Replaceable Broom Squeegee Mop Brush Heads For Floor Home
-4%
$0.41-3.44
No MOQ
 · 
72 views
Multipurpose Cleaning Brush Soft Bristle Household Scrubbing Brush For Shoes Clothes Long Handle Ergonomic Hanging Hole PP
Multipurpose Cleaning Brush Soft Bristle Household Scrubbing Brush For Shoes Clothes Long Handle Ergonomic Hanging Hole PP
like
Find Similar
Long-handle cleaning brush in yellow finish with dense grey bristles and hanging hole - Long Handle Shoe Brush / Yellow
Long handle cleaning brush for shoes in mint green with dense black bristles - Long Handle Shoe Brush / Green
Handheld yellow and blue cleaning brush with soft synthetic bristles for shoes and clothes - Laundry Brush / Yellow
Handheld laundry cleaning brush with soft black bristles and a light green plastic body - Laundry Brush / Green
+4
Multipurpose Cleaning Brush Soft Bristle Household Scrubbing Brush For Shoes Clothes Long Handle Ergonomic Hanging Hole PP
$0.52-0.81
Mix MOQ : 2
 · 
30 sold recently
Green Plant Wall Stickers Potted Leaves PVC Removable Self Adhesive Decals For Living Room Bedroom Kitchen Aesthetic Decor
Green Plant Wall Stickers Potted Leaves PVC Removable Self Adhesive Decals For Living Room Bedroom Kitchen Aesthetic Decor
like
Find Similar
Detail showing the 90x30cm sheet size of green potted plant wall stickers in layout view - Green Plant Hanging Basket / 30*90cm
Green Plant Wall Stickers Potted Leaves PVC Removable Self Adhesive Decals For Living Room Bedroom Kitchen Aesthetic Decor
$1.44
No MOQ
 · 
12 views
Natural Crystal Gravel Crushed Stones Irregular Polished Decorative For Fish Tank Planter Meditation DIY Home Decor
Natural Crystal Gravel Crushed Stones Irregular Polished Decorative For Fish Tank Planter Meditation DIY Home Decor
like
Find Similar
Handful of vibrant yellow citrine crystal gravel stones for home and garden decoration - Colored Citrine Chips 7-9mm / 100 g
Polished natural citrine quartz chips displayed in a white ceramic bowl for home decor - Added Lemon Yellow Gravel 3-5mm / 100 g
Polished colorful mixed crystal crushed stones for fish tank or home decoration - Colorful Mixed Stones 3-5mm / 100 g
Vibrant blue crystal gravel in a white bowl for home decoration and meditation - Added Blue Crystal Chips 3-5mm / 100 g
+44
Natural Crystal Gravel Crushed Stones Irregular Polished Decorative For Fish Tank Planter Meditation DIY Home Decor
-9%
$0.20-2.73
No MOQ
 · 
25 sold recently
Cat Shaped Over Door Hooks Punch-Free Metal Hanger Rack For Clothes Bags Hats Keys Silent Wrought Iron Organizer
Cat Shaped Over Door Hooks Punch-Free Metal Hanger Rack For Clothes Bags Hats Keys Silent Wrought Iron Organizer
like
Find Similar
Creamy white cat shaped door hook in thickened steel for cabinet door organization - Model A Cat / Cream
Creamy white cat-shaped over-the-door double hook made of thickened carbon steel - Model B Cat / Cream
Over-the-door cat-shaped metal hook in creamy white finish for cabinets and rooms - Model C Cat / Cream
Cream-white cat-shaped over-door hook organizer made of thickened steel for cabinets - Model D Cat / Cream
+2
Cat Shaped Over Door Hooks Punch-Free Metal Hanger Rack For Clothes Bags Hats Keys Silent Wrought Iron Organizer
-5%
$0.82-0.93
No MOQ
 · 
81 sold recently
Double Sided Kitchen Cleaning Sponge Scouring Pads High Density Stain Removal For Washing Dishes Pots Household Heavy Duty
Double Sided Kitchen Cleaning Sponge Scouring Pads High Density Stain Removal For Washing Dishes Pots Household Heavy Duty
like
Find Similar
5-piece set of colorful high-density sponges in red, green, pink, beige, and gray - Thickened Contrast Color 5PCS Set
Double Sided Kitchen Cleaning Sponge Scouring Pads High Density Stain Removal For Washing Dishes Pots Household Heavy Duty
$0.86
No MOQ
 · 
23 sold recently
Glass Oil Dispenser Bottle Kitchen Gravity Automatic Flip Lid Leak-Proof Drip-Free Spout Vinegar Cruet Soy Sauce Jar
Glass Oil Dispenser Bottle Kitchen Gravity Automatic Flip Lid Leak-Proof Drip-Free Spout Vinegar Cruet Soy Sauce Jar
like
Find Similar
Warm gray glass oil dispenser bottle with non-slip sleeve and labeled stickers - 500ml / Warm Gray
Blue glass oil dispenser bottle with leak-proof lid and labels for kitchen storage - 500ml / Blue
Dark gray glass oil dispenser bottle with leak-proof lid and labels for home kitchen - 500ml / Dark Gray
Glass oil dispenser bottle with yellow anti-slip grip and precision pour spout - 500ml / Bright Yellow
+6
Glass Oil Dispenser Bottle Kitchen Gravity Automatic Flip Lid Leak-Proof Drip-Free Spout Vinegar Cruet Soy Sauce Jar
$0.98-5.42
No MOQ
 · 
51 sold recently
Scalp Massage Brush Silicone Shampoo Brush Soft Teeth Hair Washing Comb Ergonomic Handle Head Cleansing Multi-Functional
Scalp Massage Brush Silicone Shampoo Brush Soft Teeth Hair Washing Comb Ergonomic Handle Head Cleansing Multi-Functional
like
Find Similar
Ergonomic silicone scalp massager brush in two-tone purple for hair washing - Two-tone Purple
Deep teal and mint green silicone scalp massager brush with ergonomic ring handle - Two-tone Green
Blue silicone scalp massager shampoo brush with ergonomic handle and soft bristles - Blue
Ergonomic matte black silicone scalp massager brush with soft tapered massage bristles - Black
+6
Scalp Massage Brush Silicone Shampoo Brush Soft Teeth Hair Washing Comb Ergonomic Handle Head Cleansing Multi-Functional
-5%
$0.95
No MOQ
 · 
13 views
Dish Scrubbing Brush With Soap Dispenser Handheld Kitchen Cleaning Tool Long Handle Replaceable Sponge Bristle Heads
Dish Scrubbing Brush With Soap Dispenser Handheld Kitchen Cleaning Tool Long Handle Replaceable Sponge Bristle Heads
like
Find Similar
Hydraulic dish soap dispenser brush with long gray handle and retail packaging box - 1 Handle + 1 Brush (Boxed)
Gray and white liquid-dispensing kitchen dish brush with sponge head replacement - Individual Sponge Replacement Head
Gray liquid soap dispensing dish brush with dense white bristles for kitchen cleaning - Individual Brush Replacement Head
Hydraulic kitchen dish brush set with interchangeable sponge and nylon heads - 1 Handle + 1 Brush + 1 Sponge (Boxed)
+3
Dish Scrubbing Brush With Soap Dispenser Handheld Kitchen Cleaning Tool Long Handle Replaceable Sponge Bristle Heads
$0.14-1.59
Mix MOQ : 2
 · 
20 sold recently
Portable Travel Toothbrush Holder Wash Cup Plastic Semi Transparent Case For Camping Business Trip Cartoon Bear Dog Design
Portable Travel Toothbrush Holder Wash Cup Plastic Semi Transparent Case For Camping Business Trip Cartoon Bear Dog Design
like
Find Similar
Portable yellow travel wash set with 19.5cm height and cartoon dog character - Silly Dog / Transparent Yellow
Portable light green travel toothbrush cup with cute bear design and striped texture - Hug Bear / Transparent Green
Portable Travel Toothbrush Holder Wash Cup Plastic Semi Transparent Case For Camping Business Trip Cartoon Bear Dog Design
-6%
$1.22
No MOQ
 · 
19 views
Shoe Washing Bag Mesh Laundry Machine Washable Protector Durable Polyester Sandwich Mesh Cylindrical Semicircle Storage
Shoe Washing Bag Mesh Laundry Machine Washable Protector Durable Polyester Sandwich Mesh Cylindrical Semicircle Storage
like
Find Similar
White sandwich mesh wash bag for shoes with black zipper and hanging loop for laundry - Semicircle Single Pack / White
Large cylindrical mesh laundry bag for washing sneakers with a grey zipper and shoes inside - Cylindrical 2-Piece Set (One Small & One Large) / White
Shoe Washing Bag Mesh Laundry Machine Washable Protector Durable Polyester Sandwich Mesh Cylindrical Semicircle Storage
-5%
$2.19-3.50
Mix MOQ : 2
Reed Diffuser Glass Bottle With Sola Flowers For Room Fragrance Indoor Essential Oil Aroma Diffuser Long Lasting Deodorizing
Reed Diffuser Glass Bottle With Sola Flowers For Room Fragrance Indoor Essential Oil Aroma Diffuser Long Lasting Deodorizing
like
Find Similar
Gardenia reed diffuser set with glass bottle, white flowers and elegant gift box - Shangri-La
+9
Reed Diffuser Glass Bottle With Sola Flowers For Room Fragrance Indoor Essential Oil Aroma Diffuser Long Lasting Deodorizing
$1.43
No MOQ
 · 
116 sold recently
Dish Brush With Long Handle Liquid Soap Dispenser Kitchen Cleaning Sponge Scouring Pad Scrubber For Pot Pan Sink
Dish Brush With Long Handle Liquid Soap Dispenser Kitchen Cleaning Sponge Scouring Pad Scrubber For Pot Pan Sink
like
Find Similar
Refillable kitchen dish brush featuring a clear handle and yellow/green sponge head - Long Handle Liquid Dispenser Type / Yellow
Dish Brush With Long Handle Liquid Soap Dispenser Kitchen Cleaning Sponge Scouring Pad Scrubber For Pot Pan Sink
-4%
$0.58
Mix MOQ : 3
 · 
18 views
Glove Drying Rack Plastic Foldable Kitchen Storage Stand With Drainage Base Detachable Dishcloth Holder Finger Shape
Glove Drying Rack Plastic Foldable Kitchen Storage Stand With Drainage Base Detachable Dishcloth Holder Finger Shape
like
Find Similar
Foldable plastic drying rack with drain tray for household gloves and rags on countertop - Blue
Pink plastic drying rack with double pillars and stable base for gloves or kitchen rags - Pink
Glove Drying Rack Plastic Foldable Kitchen Storage Stand With Drainage Base Detachable Dishcloth Holder Finger Shape
$2.05
No MOQ
 · 
11 sold recently
Rotating Makeup Brush Holder Transparent Plastic Cosmetic Organizer Gold Trim Partitioned Desktop Storage For Brushes
Rotating Makeup Brush Holder Transparent Plastic Cosmetic Organizer Gold Trim Partitioned Desktop Storage For Brushes
like
Find Similar
Rotating makeup brush organizer with lid and white pearl base, 17cm tall vanity storage - Plain Style / Clear
Green translucent rotating makeup brush organizer with vertical stripes and tray - Plain Style / Luxury Green
Rotating makeup brush holder in clear acrylic with gold trim and 17x11cm dimensions - Gold Stamping Style / Clear
Amber rotating makeup brush holder with Smile logo and dimensions 17x11cm - Gold Stamping Style / Amber Orange
+2
Rotating Makeup Brush Holder Transparent Plastic Cosmetic Organizer Gold Trim Partitioned Desktop Storage For Brushes
$1.04-1.12
Mix MOQ : 2
 · 
55 views
Airtight Food Storage Container Kitchen Organization Clear Plastic Jar Square Stackable Canister For Grains Cereal Flour
Airtight Food Storage Container Kitchen Organization Clear Plastic Jar Square Stackable Canister For Grains Cereal Flour
like
Find Similar
Airtight 950ML transparent grain jar with black lid and spiral pasta inside for storage - 950ML / Clear White
460ml square airtight plastic food container with white locking lid and dry yellow grains - 460ml / Clear White
700ml square airtight plastic kitchen storage jar with white lid and red dates - 700ml / Clear White
A 1300ml square airtight plastic food container made of PET and TPR for pantry storage - 1300ML / Transparent Black
+6
Airtight Food Storage Container Kitchen Organization Clear Plastic Jar Square Stackable Canister For Grains Cereal Flour
$1.24-2.10
No MOQ
 · 
24 sold recently
Long Handle Cup Cleaning Brush L-Shaped Scrubber With Soft PP Bristles For Bottle Blender Kitchen Gaps Multi-Purpose
Long Handle Cup Cleaning Brush L-Shaped Scrubber With Soft PP Bristles For Bottle Blender Kitchen Gaps Multi-Purpose
like
Find Similar
White long-handled cup cleaning brush with grey and white bristles and curved handle - White (Japanese Style Cup Brush)
Long Handle Cup Cleaning Brush L-Shaped Scrubber With Soft PP Bristles For Bottle Blender Kitchen Gaps Multi-Purpose
$0.05
No MOQ
 · 
12 views
Ocean Theme Starfish Shell Silicone Mold For Fondant Cake Decoration Chocolate Baking Marine Style Clay Craft Tool
Ocean Theme Starfish Shell Silicone Mold For Fondant Cake Decoration Chocolate Baking Marine Style Clay Craft Tool
like
Find Similar
Pink silicone ocean mold with starfish and seashell shapes for cake decoration - 1# Pink (8.2*8.2*1CM)
Pink silicone mold with a golden scallop shell creation for ocean theme cakes - 3# Pink (5.5*5.5*1.5CM)
White silicone mold with seashell cavities and realistic beige shell finish on dual-tone background - 3# Gray (5.5*5.5*1.5CM)
Light gray silicone ocean mold featuring starfish and seashells for fondant baking - 1# Gray (8.2*8.2*1CM)
+4
Ocean Theme Starfish Shell Silicone Mold For Fondant Cake Decoration Chocolate Baking Marine Style Clay Craft Tool
-5%
$0.36-1.35
No MOQ
 · 
28 sold recently
Aromatherapy Scented Candle With Crystal Stones Glass Jar Soy Wax For Relaxation Home Decor Gift Macaron Color Modern Style
Aromatherapy Scented Candle With Crystal Stones Glass Jar Soy Wax For Relaxation Home Decor Gift Macaron Color Modern Style
like
Find Similar
Green crystal macaron scented candle in glass jar with artistic gift box packaging - Gardenia / Green
Pink glass scented candle jar with orange crystal stones on wooden coaster - Coco Scent / Pink
White macaron crystal stone candle in a glass jar with matching terrazzo pattern gift box - Freesia / White
Black glass jar scented candle with purple crystal stone decor and terrazzo gift box - Bluebell / Black
+2
Aromatherapy Scented Candle With Crystal Stones Glass Jar Soy Wax For Relaxation Home Decor Gift Macaron Color Modern Style
$2.54
Mix MOQ : 3
 · 
106 sold recently
Marble Pattern Kitchen Wall Stickers PET Aluminum Foil Oil Proof Heat Resistant Self Adhesive Backsplash Wallpaper Decor
Marble Pattern Kitchen Wall Stickers PET Aluminum Foil Oil Proof Heat Resistant Self Adhesive Backsplash Wallpaper Decor
like
Find Similar
Jazz White marble self-adhesive wallpaper for kitchen countertops waterproof oil-proof - 60cm x 3m / Jazz White
Transparent heat resistant kitchen wall oil-proof sticker for marble tile protection - 60cm x 3m / Transparent
Waterproof Athens White marble self-adhesive kitchen wallpaper with a gray-white texture - 60cm x 3m / Athens White
Water Cloud Grey marble self-adhesive kitchen countertop film with heat resistant finish - 60cm x 3m / Cloud Gray
+23
Marble Pattern Kitchen Wall Stickers PET Aluminum Foil Oil Proof Heat Resistant Self Adhesive Backsplash Wallpaper Decor
$1.44-4.32
No MOQ
 · 
69 views
Holographic Christmas Window Stickers Rainbow Prism Static Cling Snowflake Reindeer Tree Decal Decor
Holographic Christmas Window Stickers Rainbow Prism Static Cling Snowflake Reindeer Tree Decal Decor
like
Find Similar
Detailed dimensions of 9pcs holographic Christmas reindeer and snowflake window clings - Christmas Reindeer Holographic Style (XC2309)
Detail showing 9pcs rainbow holographic Christmas window stickers with various sizes - Christmas Tree Reindeer Style (XC2302)
Detailed view of 105 Christmas static window stickers showing reindeer and rainbow patterns - Christmas Snowflake Gift Style (XC2301)
Set of 52 holographic snowflake window clings with static film for Christmas decor - Holographic Snowflake Style (XC2308)
Holographic Christmas Window Stickers Rainbow Prism Static Cling Snowflake Reindeer Tree Decal Decor
$4.18
Mix MOQ : 2
 · 
11 views
Creative Cartoon Girl Face Tissue Box ABS Plastic Wall Mounted Decorative Puffy Skirt Style Toilet Paper Napkin Holder Case
Creative Cartoon Girl Face Tissue Box ABS Plastic Wall Mounted Decorative Puffy Skirt Style Toilet Paper Napkin Holder Case
like
Find Similar
Milk Apricot Coffee
White Peach Pink
Light Mango Yellow
Avocado
+1
Creative Cartoon Girl Face Tissue Box ABS Plastic Wall Mounted Decorative Puffy Skirt Style Toilet Paper Napkin Holder Case
$3.29
No MOQ
 · 
28 sold recently
Cat Design Automatic Aromatherapy Machine LED Display Wall Mounted Nano Atomization Rechargeable Essential Oil Diffuser
Cat Design Automatic Aromatherapy Machine LED Display Wall Mounted Nano Atomization Rechargeable Essential Oil Diffuser
like
Find Similar
Lavender air freshener spray in transparent glass bottle with black cap and floral notes - Lavender Essential Oil (1 Bottle)
Smart diffuser refill in Shangri-La scent with pink liquid and black cap bottle - Shangri-La Essential Oil (1 Bottle)
Hilton scent automatic fragrance diffuser refill in clear glass bottle with black cap - Hilton Essential Oil (1 Bottle)
Bluebell scented oil for automatic diffuser in a transparent glass bottle - Bluebell Essential Oil (1 Bottle)
+6
Cat Design Automatic Aromatherapy Machine LED Display Wall Mounted Nano Atomization Rechargeable Essential Oil Diffuser
$0.60-5.45
Mix MOQ : 2
 · 
52 sold recently
Laundry Basket Foldable Storage Bag With Round Aluminum Handles Durable Polyester Fabric For Home Organization
Laundry Basket Foldable Storage Bag With Round Aluminum Handles Durable Polyester Fabric For Home Organization
like
Find Similar
Coffee brown laundry basket with metal handles and laundry print 32x25x50cm - 32*25*50cm / Khaki
Dark gray laundry bag with round metal handles and white text print, size 32x25x50cm - 32*25*50cm / Dark Gray
Light grey laundry hamper with metal handles and LAUNDRY text in 32x25x50cm size - 32*25*50cm / Light Gray
Light blue laundry basket with metal handles and vertical white laundry text print - 32*25*50cm / Lake Blue
+1
Laundry Basket Foldable Storage Bag With Round Aluminum Handles Durable Polyester Fabric For Home Organization
-4%
$5.34
No MOQ
 · 
26 views
Triangular Sink Caddy Sponge Holder Stainless Steel Drainage Rack Kitchen Organizer Corner Storage Basket Punch Free
Triangular Sink Caddy Sponge Holder Stainless Steel Drainage Rack Kitchen Organizer Corner Storage Basket Punch Free
like
Find Similar
Black stainless steel kitchen sink sponge holder with triangular corner drain design - Stainless Steel Black
Macro detail of the stainless steel kitchen sponge rack dimensions 13.4cm x 9cm with adhesive - Stainless Steel Silver
Black stainless steel corner sink organizer rack for sponges and brushes with drainage design - Carbon Steel Black
Triangular Sink Caddy Sponge Holder Stainless Steel Drainage Rack Kitchen Organizer Corner Storage Basket Punch Free
$1.87-2.16
No MOQ
 · 
18 sold recently
Thickened HDPE Drawstring Garbage Bags Leakproof Heavy Duty Cute Cartoon Print Trash Bags For Kitchen Home
Thickened HDPE Drawstring Garbage Bags Leakproof Heavy Duty Cute Cartoon Print Trash Bags For Kitchen Home
like
Find Similar
Thickened drawstring storage bag with cute blue rabbit print and matching canister - Happy Rabbit Thickened (Drawstring) / 5 Rolls (75 Counts)
Beige drawstring waste bags featuring a cute cartoon bear and strawberry pattern - Happy Bear Thickened (Drawstring) / 1 Large Roll (100 Counts)
Durable thick drawstring garbage bag in privacy black featuring bunny ear handles - 4-Silk Black (Non-tear Drawstring) / 1 Large Roll (100 Counts)
Thickened green drawstring garbage bag featuring a cute panda print for home kitchen use - Panda Thickened (Drawstring) / 1 Roll (15 Counts)
+67
Thickened HDPE Drawstring Garbage Bags Leakproof Heavy Duty Cute Cartoon Print Trash Bags For Kitchen Home
$0.23-18.41
No MOQ
 · 
15 sold recently
Reusable Waterproof Shower Cap For Women Thickened EVA Bathing Hat With Elastic Band Lace Trim Cute Cartoon Patterns
Reusable Waterproof Shower Cap For Women Thickened EVA Bathing Hat With Elastic Band Lace Trim Cute Cartoon Patterns
like
Find Similar
Waterproof shower cap with heart balloon print and elegant white lace trim for women - Heart Balloon
Waterproof elastic shower cap for women featuring pink polka dots on white PEVA fabric - Pink Polka Dots
Waterproof shower cap featuring colored polka dots and elegant white lace elastic trim - Colored Polka Dots
Waterproof shower cap for women featuring yellow cartoon bear and white lace elastic band - Yellow Bear
+2
Reusable Waterproof Shower Cap For Women Thickened EVA Bathing Hat With Elastic Band Lace Trim Cute Cartoon Patterns
$0.22
No MOQ
 · 
456 sold recently
Multi Layer Retainer Box U055 Orthodontic Denture Case Drainage Soaking Basket Portable Plastic Magnetic Lock Guard
Multi Layer Retainer Box U055 Orthodontic Denture Case Drainage Soaking Basket Portable Plastic Magnetic Lock Guard
like
Find Similar
Apricot 3-layer orthodontic retainer box with drainage layer and secure latch closure - U055 Lock Type / Apricot
Three-layer orthodontic retainer storage box with soaking layer and drainage rack - Cleaning Brush
Orthodontic care set including aligner remover, white chewies, and a mini cleaning brush - Accessories (Remover, Chewie, Brush)
Portable apricot magnetic retainer case, 9.3cm diameter slim orthodontic storage box - U050 Portable Magnetic Type / Apricot
+2
Multi Layer Retainer Box U055 Orthodontic Denture Case Drainage Soaking Basket Portable Plastic Magnetic Lock Guard
$0.14-4.90
Mix MOQ : 2
 · 
13 sold recently
Free Shipping
Wall Mounted Plastic Storage Bracket Self Adhesive No Drill Holder For Kitchen Cabinet Refrigerator Wrap And Garbage Bag
Wall Mounted Plastic Storage Bracket Self Adhesive No Drill Holder For Kitchen Cabinet Refrigerator Wrap And Garbage Bag
like
Find Similar
6 options
Wall Mounted Plastic Storage Bracket Self Adhesive No Drill Holder For Kitchen Cabinet Refrigerator Wrap And Garbage Bag
$0.44-0.96
Mix MOQ : 2
 · 
12 views
Double Sided Kitchen Dish Scouring Pad Sponge Steel Wire Mesh Pot Cleaning Cloth With Hanging Loop Heavy Duty
Double Sided Kitchen Dish Scouring Pad Sponge Steel Wire Mesh Pot Cleaning Cloth With Hanging Loop Heavy Duty
like
Find Similar
Round dual-sided kitchen scrubbing sponge with silver metallic mesh and yellow border - Double-Sided Multi-Functional
Thick double-sided kitchen sponge with silver scouring surface and yellow fabric hem - 2.5cm Thickened
Set of round double-sided dishwashing sponges with grey scrubbing fiber and yellow edges - Set of 10 (1.5cm Thickness)
Bulk pack of double-sided yellow and silver dishwashing sponges for kitchen cleaning - Set of 10 (2.5cm Thickness)
+7
Double Sided Kitchen Dish Scouring Pad Sponge Steel Wire Mesh Pot Cleaning Cloth With Hanging Loop Heavy Duty
$0.04-0.63
Mix MOQ : 2
 · 
54 sold recently
360 Degree Rotating Kitchen Hook ABS Plastic Multi Claw Self Adhesive Wall Mounted Punch Free Folding Rack
360 Degree Rotating Kitchen Hook ABS Plastic Multi Claw Self Adhesive Wall Mounted Punch Free Folding Rack
like
Find Similar
White 360-degree rotating kitchen wall hook rack with 6 hooks for spatula storage - White
Black plastic 360 rotating 6-claw kitchen hook with adhesive mounting square base - Black
360 Degree Rotating Kitchen Hook ABS Plastic Multi Claw Self Adhesive Wall Mounted Punch Free Folding Rack
$0.71
Mix MOQ : 2
Liquid Air Freshener Aromatherapy Frosted Glass Bottle Metal Lid Car Home Odor Eliminator Long Lasting Scent Modern Elegant
Liquid Air Freshener Aromatherapy Frosted Glass Bottle Metal Lid Car Home Odor Eliminator Long Lasting Scent Modern Elegant
like
Find Similar
Close-up of 65ml lavender liquid car air freshener with a purple frosted glass bottle - 65ml / Lavender
Close-up of 65ml frosted pink glass car fragrance bottle surrounded by fresh red roses - 65ml / Rose
Close-up of SUNPRETTY frosted glass bottle with osmanthus liquid and silver logo cap - 65ml / Fragrans
65ml Sunpretty lemon car air freshener in frosted yellow glass with silver cap detail - 65ml / Lemon
+2
Liquid Air Freshener Aromatherapy Frosted Glass Bottle Metal Lid Car Home Odor Eliminator Long Lasting Scent Modern Elegant
$0.35
No MOQ
 · 
52 sold recently
Flower Shaped Adhesive Wall Hooks No Drill Strong Load Bearing Waterproof PET Material Modern Luxury Home Organizer
Flower Shaped Adhesive Wall Hooks No Drill Strong Load Bearing Waterproof PET Material Modern Luxury Home Organizer
like
Find Similar
Grey clover luxury adhesive hooks with textured acrylic base for wall hanging, 4 pack - Transparent (Pack of 4)
Set of 4 luxury dark grey diamond-shaped adhesive wall hooks with clover leaf metal accents - Transparent Grey (Pack of 4)
Set of 4 luxury dark green wall hooks with golden flower accent for towels and clothes - Transparent Green (Pack of 4)
Set of 4 cream adhesive wall hooks with grey flower accent and vertical stripe texture - Cream White (Pack of 4)
+1
Flower Shaped Adhesive Wall Hooks No Drill Strong Load Bearing Waterproof PET Material Modern Luxury Home Organizer
$1.35
No MOQ
 · 
1 reviews
Reed Diffuser Eternal Dried Flowers Glass Container Wooden Stopper Room Air Freshener Long Lasting Home Fragrance
Reed Diffuser Eternal Dried Flowers Glass Container Wooden Stopper Room Air Freshener Long Lasting Home Fragrance
like
Find Similar
MOSE 100ml Reed Diffuser with preserved flowers and eucalyptus on a wooden base - Rose Refill
Luxury reed diffuser with preserved yellow flowers in a glass bottle on stone base - Gardenia Story Set
Square glass reed diffuser bottle No. 8 with preserved flowers and wooden stopper lid - Silver Mountain Water Set
Hong Kong reed diffuser in glass bottle with dried flowers and wooden stopper - Westin White Tea Set
+12
Reed Diffuser Eternal Dried Flowers Glass Container Wooden Stopper Room Air Freshener Long Lasting Home Fragrance
-4%
$1.59-4.33
No MOQ
 · 
89 sold recently
Scented Candle Soy Wax Blend With Dried Flowers In Ribbed Glass Jar For Aromatherapy Home Decor Romantic Gift
Scented Candle Soy Wax Blend With Dried Flowers In Ribbed Glass Jar For Aromatherapy Home Decor Romantic Gift
like
Find Similar
Scented soy candle in glass jar with dried blue and purple flowers and Long Fine label - Bluebell
Scented soy candle in ribbed glass jar with dried flowers and matching glass lid - Rose Pomegranate
Dried flower aromatherapy candle in a striped glass jar with Longfine tag and floral decor - Grapefruit Love
Scented soy candle in a glass jar decorated with colorful dried flowers and green leaves - Rose of No Man's Land
+5
Scented Candle Soy Wax Blend With Dried Flowers In Ribbed Glass Jar For Aromatherapy Home Decor Romantic Gift
-4%
$3.29
No MOQ
 · 
12 sold recently
Scented Wax Tablet Wardrobe Fragrance Solid Soy Wax Hanging Air Freshener Closet Car Drawer Aroma Gypsum Tablet Decorative
Scented Wax Tablet Wardrobe Fragrance Solid Soy Wax Hanging Air Freshener Closet Car Drawer Aroma Gypsum Tablet Decorative
like
Find Similar
White gypsum scented tablet with yellow wax core and black ribbon on wood - Ebony Oud - Oval
Yellow scented wax tablet with white relief frame for home and wardrobe fragrance - Small - Shangri-La
Hanging peach oolong scented wax tablet for closet with fresh fruit aroma - Small - White Peach Oolong
English Pear & Freesia scented wax tablet air freshener in purple and white - Small - Freesia
+10
Scented Wax Tablet Wardrobe Fragrance Solid Soy Wax Hanging Air Freshener Closet Car Drawer Aroma Gypsum Tablet Decorative
-5%
$0.36-0.60
No MOQ
 · 
52 sold recently
Fine Mesh Laundry Wash Bag Protective Clothing Protector For Washing Machine Delicates Lingerie Sweater Zipper Design
Fine Mesh Laundry Wash Bag Protective Clothing Protector For Washing Machine Delicates Lingerie Sweater Zipper Design
like
Find Similar
Fine mesh laundry bag in cylindrical shape, 15x17cm size for washing delicates - Cylindrical Fine Mesh (15x17cm)
Fine mesh laundry wash bag with grey zipper for sweaters, 48CM x 38CM size - Grey Large Fine Mesh (48x38cm)
White fine mesh laundry bag with grey zipper 30x38cm size for washing machine - Grey Medium Fine Mesh (30x38cm)
Fine mesh laundry bag for delicates, white rectangular net, 23x28cm size with zipper - Grey Small Fine Mesh (28x23cm)
+2
Fine Mesh Laundry Wash Bag Protective Clothing Protector For Washing Machine Delicates Lingerie Sweater Zipper Design
-7%
$0.26-0.53
No MOQ
 · 
14 views
Long Handle Bath Brush Body Scrubber Soft Bristle Loofah Back Sponge Plastic For Shower Massage Hanging Hole
Long Handle Bath Brush Body Scrubber Soft Bristle Loofah Back Sponge Plastic For Shower Massage Hanging Hole
like
Find Similar
Cream long-handled bath brush with dense soft bristles and hanging hole in a basket - Japanese Thick Bath Brush / Beige
Cyan long handle bath brush shower loofah scrubber, 43cm length with hanging rope - Long Handle Bath Loofah / Green
Light green long handle bath brush with anti-slip wave texture and soft white bristles - Single-sided Bath Brush / Green
Cream-white long-handle bath sponge with soft mesh and hanging rope for back cleaning - Long Handle Bath Loofah / Beige
+7
Long Handle Bath Brush Body Scrubber Soft Bristle Loofah Back Sponge Plastic For Shower Massage Hanging Hole
$0.24-0.52
Mix MOQ : 2
 · 
396 sold recently
Minimalist White PP Plastic Storage Box Flip Top Dustproof Desktop Organizer For Stationery Cosmetics Journal Stickers
Minimalist White PP Plastic Storage Box Flip Top Dustproof Desktop Organizer For Stationery Cosmetics Journal Stickers
like
Find Similar
White frosted plastic storage box with lid, 18x12x10cm size for stationery and cosmetics - Large / White
White minimalist plastic storage box with lid for stationery and cosmetic organization - Medium / White
Minimalist White PP Plastic Storage Box Flip Top Dustproof Desktop Organizer For Stationery Cosmetics Journal Stickers
-5%
$0.49-0.60
No MOQ
 · 
13 sold recently
Nordic Creative Rainbow Plastic Stool U Shaped Thickened Arch Footstool Non Slip Shoe Changing Bench For Kids Adults Home Decor
Nordic Creative Rainbow Plastic Stool U Shaped Thickened Arch Footstool Non Slip Shoe Changing Bench For Kids Adults Home Decor
like
Find Similar
Cute Nordic style colorful plastic stools for kids with cartoon faces for home living room - Cream White + Eye Stickers
Nordic rainbow style cream white small plastic stool with sturdy arched modern design - Cream White
Nordic rainbow plastic small stool for children in matcha green finish 36cm - Matcha Green
Bright yellow rainbow-shaped plastic stool for kids, minimalist Nordic style design - Banana Yellow
+8
Nordic Creative Rainbow Plastic Stool U Shaped Thickened Arch Footstool Non Slip Shoe Changing Bench For Kids Adults Home Decor
$6.89-7.09
No MOQ
Wall Mounted Folding Kitchen Trash Can Plastic Space Saving Hanging Waste Bin For Cabinet Door Home Office
Wall Mounted Folding Kitchen Trash Can Plastic Space Saving Hanging Waste Bin For Cabinet Door Home Office
like
Find Similar
Collapsible kitchen trash can in light grey and white hanging on a cabinet door - Small / Grey/White
Wall-mounted folding kitchen waste bin in light grey for cabinet doors - Large / Grey/White
Small light blue folding kitchen trash can for cabinet door hanging waste storage - Small / Blue White
Hanging foldable kitchen waste bin in white and purple pink color for cabinet doors - Large / Purple White
+2
Wall Mounted Folding Kitchen Trash Can Plastic Space Saving Hanging Waste Bin For Cabinet Door Home Office
$1.50-1.87
No MOQ
 · 
28 views
Go to

More in home & kitchen

Explore more in bedding & bathroom

homecolortravelshapestoragepolyesterdoublelayerdailyfoot
handholderplasticcleaningstylesimplekidswhiteheadbody

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access