Everful

Wholesale bedding & bathroom

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bedding & Bathroom

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

All products in bedding & bathroom

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Vintage American Style Cushion Cover Light Luxury French Sofa Soft Plush Floral Geometric Print Pillowcase For Home Decor
Vintage American Style Cushion Cover Light Luxury French Sofa Soft Plush Floral Geometric Print Pillowcase For Home Decor
like
Find Similar
Retro geometric throw pillow cover with black lily floral pattern and spring text design - 45*45cm Short Plush Double-sided (Excluding Pillow Core) / Harlequin Grid and White Lily Design (TQS5-1)
Retro black pillow cover with flower drawing and black-white checkered circle pattern - 45*45cm Short Plush Double-sided (Excluding Pillow Core) / Black White Circular Grid Floral Design (TQS5-2)
Detail of vintage floral print with English poem on a black decorative throw pillow case - 45*45cm Short Plush Double-sided (Excluding Pillow Core) / Black Background Classical Floral Design (TQS5-3)
Retro Harlequin plaid cushion cover with lily illustration and quote on gray background - 45*45cm Short Plush Double-sided (Excluding Pillow Core) / Vintage Art Lily Design (TQS5-4)
+6
Vintage American Style Cushion Cover Light Luxury French Sofa Soft Plush Floral Geometric Print Pillowcase For Home Decor
$1.59
Mix MOQ : 2
Tropical Green Palm Leaf Toilet Sticker Waterproof PVC Watercolor Plant Wall Decal For Bathroom Home Decor Accessories
Tropical Green Palm Leaf Toilet Sticker Waterproof PVC Watercolor Plant Wall Decal For Bathroom Home Decor Accessories
like
Find Similar
Detailed dimensions of tropical green leaf wall stickers measuring 29cm by 24cm - 24*29cm
Tropical Green Palm Leaf Toilet Sticker Waterproof PVC Watercolor Plant Wall Decal For Bathroom Home Decor Accessories
-4%
$0.69
No MOQ
Removable PVC Floral Basket Toilet Lid Stickers Decorative Flower Wall Decals For Bathroom Restroom Home Decoration
Removable PVC Floral Basket Toilet Lid Stickers Decorative Flower Wall Decals For Bathroom Restroom Home Decoration
like
Find Similar
Detail showing dimensions and layout for creative flower basket embossed wall stickers - 25*29cm*2pcs/fun-m516
Removable PVC Floral Basket Toilet Lid Stickers Decorative Flower Wall Decals For Bathroom Restroom Home Decoration
$1.01
No MOQ
Vibrant Floral Butterfly Toilet Sticker Waterproof PVC Self Adhesive Wall Decal For Bathroom Home Art Decoration Mural
Vibrant Floral Butterfly Toilet Sticker Waterproof PVC Self Adhesive Wall Decal For Bathroom Home Art Decoration Mural
like
Find Similar
Floral wall sticker sheet with butterfly and daisy patterns, 29cm size for home decor - Floral Butterfly (HY-M189) / 29x29cm / Colorful
NewVibrant Floral Butterfly Toilet Sticker Waterproof PVC Self Adhesive Wall Decal For Bathroom Home Art Decoration Mural
$0.58
No MOQ
Cartoon Animal Peach Skin Throw Pillowcase Square Decorative Cushion Cover For Children Room Sofa Home Decor Modern Style
Cartoon Animal Peach Skin Throw Pillowcase Square Decorative Cushion Cover For Children Room Sofa Home Decor Modern Style
like
Find Similar
Detail of white square pillow case with a cute yellow cartoon giraffe and blue clouds - Giraffe Style (DRD234-1)
Detail of square pillowcase featuring a cartoon polar bear design and LOVE text - Love Polar Bear Style (DRD234-2)
Detail showing cartoon elephant pattern with pink bow on white square cushion cover - Ballet Elephant Style (DRD234-3)
Close-up of square blue pillow cover featuring a cute cartoon elephant with a large bow - Bowknot Elephant Style (DRD234-4)
+36
Cartoon Animal Peach Skin Throw Pillowcase Square Decorative Cushion Cover For Children Room Sofa Home Decor Modern Style
-5%
$1.23
Mix MOQ : 2
Easter Bunny Toilet Lid Cover And U-Shaped Mat Plush Soft Anti-Slip Bathroom Decorative Rug For Holiday Home Decoration
Easter Bunny Toilet Lid Cover And U-Shaped Mat Plush Soft Anti-Slip Bathroom Decorative Rug For Holiday Home Decoration
like
Find Similar
Detail of Easter bathroom set with blue bunny mats and soft flannel texture - Blue
Detail of soft green Easter toilet cover and U-shaped rug with white rabbit silhouette - Green
Pink Easter bathroom set featuring plush bunny toilet cover and non-slip U-shaped floor mat - Pink
Detail of yellow Easter bathroom set with white bunny silhouette and soft plush texture - Yellow
NewEaster Bunny Toilet Lid Cover And U-Shaped Mat Plush Soft Anti-Slip Bathroom Decorative Rug For Holiday Home Decoration
$4.32
No MOQ
Vintage Gold Baroque Floral Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Self Adhesive Home Decoration For Restroom
Vintage Gold Baroque Floral Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Self Adhesive Home Decoration For Restroom
like
Find Similar
Detailed view of vintage gold floral wall sticker with classical European pattern dimensions - 25x29cm / Gold (M-341)
Vintage Gold Baroque Floral Toilet Lid Sticker Waterproof PVC Bathroom Wall Decal Self Adhesive Home Decoration For Restroom
$0.72
No MOQ
Creative Bathroom Decoration Wall Sticker Black Silhouette Woman In Bathtub Floral Pattern PVC Waterproof Self Adhesive Mural
Creative Bathroom Decoration Wall Sticker Black Silhouette Woman In Bathtub Floral Pattern PVC Waterproof Self Adhesive Mural
like
Find Similar
Detail showing dimensions of a bathroom wall sticker with a woman in a bathtub - 22*30cm/fun-f389 / Black
Creative Bathroom Decoration Wall Sticker Black Silhouette Woman In Bathtub Floral Pattern PVC Waterproof Self Adhesive Mural
$0.86
No MOQ
Watercolor Peony Floral Butterfly Toilet Sticker Waterproof Removable PVC Self Adhesive Wall Decal For Bathroom Home Decor
Watercolor Peony Floral Butterfly Toilet Sticker Waterproof Removable PVC Self Adhesive Wall Decal For Bathroom Home Decor
like
Find Similar
Floral butterfly wall sticker with sunflower and pink blooms for bathroom decor 30x20cm - Floral Butterfly Style (MS7052)
Pink peony and butterfly self-adhesive PVC wall sticker for bathroom decor, 30x30cm size - Floral Butterfly Style (MS7051)
NewWatercolor Peony Floral Butterfly Toilet Sticker Waterproof Removable PVC Self Adhesive Wall Decal For Bathroom Home Decor
$0.78
Mix MOQ : 2
Watercolor Pink Rose Flower Toilet Sticker Waterproof PVC Floral Butterfly Dragonfly Decal For Bathroom Home Decor Wall Art
Watercolor Pink Rose Flower Toilet Sticker Waterproof PVC Floral Butterfly Dragonfly Decal For Bathroom Home Decor Wall Art
like
Find Similar
1 option
Watercolor Pink Rose Flower Toilet Sticker Waterproof PVC Floral Butterfly Dragonfly Decal For Bathroom Home Decor Wall Art
$0.86
Mix MOQ : 2
Eva Waterproof Toilet Seat Cover Self Adhesive Soft Thickened Bathroom Mat With Handle Universal Washable Free Cartoon Print
Eva Waterproof Toilet Seat Cover Self Adhesive Soft Thickened Bathroom Mat With Handle Universal Washable Free Cartoon Print
like
Find Similar
Gray EVA waterproof toilet seat pad with anti-slip stripes and lift handle design - Solid Grey
Waterproof light green EVA toilet seat cover with non-slip texture and lifting handle - Solid Green
Pink waterproof EVA toilet seat cover pads with anti-slip stripe texture and handle - Solid Pink
Waterproof EVA toilet seat pad with blue penguin print and hygienic lifting handle - Blue Penguin
+4
Eva Waterproof Toilet Seat Cover Self Adhesive Soft Thickened Bathroom Mat With Handle Universal Washable Free Cartoon Print
$0.49-0.61
No MOQ
 · 
11 views
Herringbone Woven Plush Pillow Case Double Sided Soft Throw Cushion Cover Winter Warm Home Decor For Sofa Couch Living Room
Herringbone Woven Plush Pillow Case Double Sided Soft Throw Cushion Cover Winter Warm Home Decor For Sofa Couch Living Room
like
Find Similar
Brown and cream herringbone knit cushion covers set of two on a rattan chair - 45x45 with 400g Core / Coffee
Pair of square herringbone woven pillow covers in grey and white on a rattan bench - 45x45 with 400g Core / Gray
Set of 2 black and white chevron woven throw pillow covers on a vintage rattan bench - 45x45 with 400g Core / Black
Pair of red and white chevron knitted cushion covers with textured finish - 45x45 with 400g Core / Burgundy
+11
Herringbone Woven Plush Pillow Case Double Sided Soft Throw Cushion Cover Winter Warm Home Decor For Sofa Couch Living Room
-10%
$2.59-5.32
Mix MOQ : 2
Modern Soft Plush Jacquard Cushion Cover Quilted Pattern Square Pillowcase With Sherpa Backing For Sofa Bed Home Decor
Modern Soft Plush Jacquard Cushion Cover Quilted Pattern Square Pillowcase With Sherpa Backing For Sofa Bed Home Decor
like
Find Similar
Plush light purple pillow with 3D rhombus texture on a vintage leather chair - Purple / 45*45mm
+5
Modern Soft Plush Jacquard Cushion Cover Quilted Pattern Square Pillowcase With Sherpa Backing For Sofa Bed Home Decor
-5%
$1.78-3.84
Mix MOQ : 2
Flannel Bathrobe Long Thick Warm Winter Lounge Wear Shawl Collar Nightrobe For Men And Women Soft Fleece Pajamas
Flannel Bathrobe Long Thick Warm Winter Lounge Wear Shawl Collar Nightrobe For Men And Women Soft Fleece Pajamas
like
Find Similar
Pink long flannel bathrobe with white piping detail, waist tie and front pockets - 3XL / Cherry Blossom Pink (Women)
Pink long flannel bathrobe for men and women with white piping and waist belt tie - 3XL / Cherry Blossom Pink (Men)
Classic black flannel bathrobe for men and women featuring white contrast piping trim - M / Hurricane Black (Women)
Classic thick black flannel robe for men with elegant white trim and belted waist - M / Hurricane Black (Men)
+50
Flannel Bathrobe Long Thick Warm Winter Lounge Wear Shawl Collar Nightrobe For Men And Women Soft Fleece Pajamas
$14.12
No MOQ
Watercolor Floral Botanical Leaf Toilet Sticker PVC Waterproof Bathroom Decorative Wall Decal For Toilet Tank Modern Home Decor
Watercolor Floral Botanical Leaf Toilet Sticker PVC Waterproof Bathroom Decorative Wall Decal For Toilet Tank Modern Home Decor
like
Find Similar
Detail view of 29cm watercolor floral toilet wall sticker with green leaves and yellow flowers - 29x29cm
Watercolor Floral Botanical Leaf Toilet Sticker PVC Waterproof Bathroom Decorative Wall Decal For Toilet Tank Modern Home Decor
$0.72
No MOQ
Tropical Jungle Tiger Printed Pillow Case Polyester American Minimalist Leaf Geometric Decorative Cushion Cover For Sofa Bed
Tropical Jungle Tiger Printed Pillow Case Polyester American Minimalist Leaf Geometric Decorative Cushion Cover For Sofa Bed
like
Find Similar
Modern black and white tiger print throw pillow cover in soft peach skin fabric - Black And White Zebra Print (DRD402-1)
Modern emerald cushion cover with elegant white lilies and hummingbirds print - Dark Green Hummingbird Lily (DRD402-2)
Tropical tiger and palm leaf pattern square cushion cover for home sofa decor - Tropical Tiger with Greenery (DRD402-3)
Tropical jungle tiger print square pillowcase featuring green leaves and wild animal motif - Tiger with Cub (DRD402-4)
+7
Tropical Jungle Tiger Printed Pillow Case Polyester American Minimalist Leaf Geometric Decorative Cushion Cover For Sofa Bed
$1.27
Mix MOQ : 2
Watercolor Lily Flower Butterfly Toilet Seat Sticker PVC Waterproof Self Adhesive Bathroom Decal Home Decoration Mural
Watercolor Lily Flower Butterfly Toilet Seat Sticker PVC Waterproof Self Adhesive Bathroom Decal Home Decoration Mural
like
Find Similar
Waterproof floral toilet lid decal with watercolor pink flowers and blue butterflies - Watercolor Lily Butterfly Style (PH-QT-1021)
Watercolor Lily Flower Butterfly Toilet Seat Sticker PVC Waterproof Self Adhesive Bathroom Decal Home Decoration Mural
-5%
$0.71
No MOQ
Mysterious Mystical Hand Moon Stars Eye PVC Toilet Sticker Bohemian Home Decor Wall Decal Waterproof Bathroom Art Mural
Mysterious Mystical Hand Moon Stars Eye PVC Toilet Sticker Bohemian Home Decor Wall Decal Waterproof Bathroom Art Mural
like
Find Similar
Layout and size details of celestial wall stickers featuring eye and moon symbols - TA143 (30x30)
Mysterious Mystical Hand Moon Stars Eye PVC Toilet Sticker Bohemian Home Decor Wall Decal Waterproof Bathroom Art Mural
$0.92
Mix MOQ : 4
Modern Minimalist Striped Floor Mat Non-Slip Absorbent Entryway Rug Machine Washable Geometric Indoor Carpet Polypropylene
Modern Minimalist Striped Floor Mat Non-Slip Absorbent Entryway Rug Machine Washable Geometric Indoor Carpet Polypropylene
like
Find Similar
Nordic absorbent bath mat with green and beige stripes on a tiled indoor floor - 50x80cm / Green
Nordic striped non-slip bath mat in black, beige, and brown on a wooden floor - 45x70cm / Khaki
Nordic geometric striped bathroom rug in blue and beige with non-slip texture - 45x70cm / Blue
+9
Modern Minimalist Striped Floor Mat Non-Slip Absorbent Entryway Rug Machine Washable Geometric Indoor Carpet Polypropylene
$4.61-8.07
No MOQ
Watercolor Flower Butterfly WC Bathroom Door Sticker PVC Removable Toilet Wall Decal Washroom Restroom Decorative Sign
Watercolor Flower Butterfly WC Bathroom Door Sticker PVC Removable Toilet Wall Decal Washroom Restroom Decorative Sign
like
Find Similar
Floral butterfly WC wall sticker in purple and blue hues for bathroom decor - Dark Purple
Watercolor Flower Butterfly WC Bathroom Door Sticker PVC Removable Toilet Wall Decal Washroom Restroom Decorative Sign
-4%
$0.82
No MOQ
Sunflower Wreath WC Sign Wall Sticker PVC Waterproof Butterfly Floral Decal For Bathroom Toilet Door Decor
Sunflower Wreath WC Sign Wall Sticker PVC Waterproof Butterfly Floral Decal For Bathroom Toilet Door Decor
like
Find Similar
WC wall sticker featuring yellow sunflowers and pink butterflies in 29x29cm size - Sunflower WC Sign (PH-QT9076)
Sunflower Wreath WC Sign Wall Sticker PVC Waterproof Butterfly Floral Decal For Bathroom Toilet Door Decor
$0.86
No MOQ
Watercolor Tropical Green Plant Toilet Lid Sticker Floral Bathroom Tank Decoration Waterproof PVC Home Decor Wall Decal
Watercolor Tropical Green Plant Toilet Lid Sticker Floral Bathroom Tank Decoration Waterproof PVC Home Decor Wall Decal
like
Find Similar
Tropical green plants toilet sticker with pink flowers size 29x22cm for home decor - Eucalyptus Pink Flower Hanging Style (M-224)
Detailed view of watercolor flower wall decals with dimensions 29x22cm showing roses and leaves - White Rose Hydrangea Style (M-225)
Detail view of watercolor pink rose and green leaf wall sticker measuring 29x22cm - Pink White Rose Eucalyptus Style (M-226)
Detail view of tropical watercolor flower wall decals with dimensions 29cm x 22cm - Hibiscus Frangipani Style (M-227)
Watercolor Tropical Green Plant Toilet Lid Sticker Floral Bathroom Tank Decoration Waterproof PVC Home Decor Wall Decal
$0.72
No MOQ
Modern Minimalist High Density Jacquard Geometric Pillowcase Luxury Orange Cushion Cover For Sofa Living Room Bedroom Decor
Modern Minimalist High Density Jacquard Geometric Pillowcase Luxury Orange Cushion Cover For Sofa Living Room Bedroom Decor
like
Find Similar
Caramel geometric throw pillow cover with white logo pattern and invisible zipper detail - 45x45 with 400g Core / Ring
Modern orange geometric lumbar pillow and square cushion set on luxury leather chair - 45x45 with 400g Core / Square Block Chain
Orange geometric embroidery pillow case set with luxury chain pattern on modern leather chair - 45x45 with 400g Core / Maze
+33
Modern Minimalist High Density Jacquard Geometric Pillowcase Luxury Orange Cushion Cover For Sofa Living Room Bedroom Decor
$2.74-10.09
Mix MOQ : 2
Halloween Gothic Witchy Occult Pillowcases Mystery Tarot Card Bat Skeleton Print Polyester Throw Pillow Cover Home Decor
Halloween Gothic Witchy Occult Pillowcases Mystery Tarot Card Bat Skeleton Print Polyester Throw Pillow Cover Home Decor
like
Find Similar
Halloween throw pillow cover featuring mystical alchemy and palmistry illustrations - Mystic Rune Style (DRD44-1)
White Halloween pillow cover featuring mystic eye graphic and dark surrealism art - All-Seeing Eye Style (DRD44-2)
Halloween decorative square pillow cover with orange pumpkin and cat patterns on black - Autumn Halloween Doodle (DRD44-3)
Square Halloween cushion cover with black and white bat pattern for sofa decor - Gothic Bats Swarm Style (DRD44-4)
+16
Halloween Gothic Witchy Occult Pillowcases Mystery Tarot Card Bat Skeleton Print Polyester Throw Pillow Cover Home Decor
-4%
$1.15
Mix MOQ : 2
 · 
18 views
Nordic Tropical Plant Leaves Throw Pillow Case Peach Skin Polyester Printed Cushion Cover For Sofa Living Room Home Decor
Nordic Tropical Plant Leaves Throw Pillow Case Peach Skin Polyester Printed Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Nordic square pillowcase with green monstera leaves and golden line art details - 18x18 Inch / Tropical Monstera Gold Lines (DRD225-1)
Nordic square pillow cover featuring green palm leaves and golden Good Vibes text - 18x18 Inch / Green Palm GOOD VIBES (DRD225-2)
Nordic peach skin pillowcase with green palm leaves and Vacation Mood on text - 18x18 Inch / Palm Leaf Vacation Mood on (DRD225-3)
Tropical monstera leaves and gold line pattern on white square peach skin pillowcase - 18x18 Inch / Tropical Plant Gold Dots (DRD225-4)
+15
Nordic Tropical Plant Leaves Throw Pillow Case Peach Skin Polyester Printed Cushion Cover For Sofa Living Room Home Decor
$1.24
Mix MOQ : 2
Waterproof PVC Pink Flower Toilet Sticker Peony Dahlia Botanical Floral Removable Bathroom Wall Decal For Home Decoration
Waterproof PVC Pink Flower Toilet Sticker Peony Dahlia Botanical Floral Removable Bathroom Wall Decal For Home Decoration
like
Find Similar
Pink flower wall sticker size diagram showing 29x29cm dimensions and HY-M183 model - Dahlia Style (HY-M183)
Detail showing 29x29cm pink peony flower toilet sticker with product size dimensions - Peony Style (HY-M184)
Pink peony flower toilet sticker with leaves and size dimensions of 29cm for home decor - Peony Style (HY-M185)
Pink peony flower wall sticker with product size specifications measuring 29cm x 29cm - Peony Style (HY-M186)
Waterproof PVC Pink Flower Toilet Sticker Peony Dahlia Botanical Floral Removable Bathroom Wall Decal For Home Decoration
$0.58
No MOQ
Linen Pillow Case Simulated Embroidery Double Sided Floral Printed Square Decorative Cushion Cover For Sofa Living Room Home Decor
Linen Pillow Case Simulated Embroidery Double Sided Floral Printed Square Decorative Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Double-sided floral print square pillowcase in black with vibrant vintage flowers - Black Multicolor Floral (ymdd01-1) / Double Sided Print Without Core
Floral print square pillowcase with pink flowers and lavender on beige fabric - Off-white Pastoral Floral (ymdd01-2) / Double Sided Print Without Core
Bohemian cushion cover with floral embroidery in orange, green, and beige tones - Bohemian 3D Floral (ymdd01-3) / Double Sided Print Without Core
Baroque floral throw pillow cover with vintage flowers on black fabric for home decor - Black Vintage Floral (ymdd01-4) / Double Sided Print Without Core
+17
Linen Pillow Case Simulated Embroidery Double Sided Floral Printed Square Decorative Cushion Cover For Sofa Living Room Home Decor
$1.59
Mix MOQ : 2
Watercolor Flower Dress Girl Butterflies Toilet Sticker Removable PVC Bathroom Wall Decal Aesthetic Home Decor Art
Watercolor Flower Dress Girl Butterflies Toilet Sticker Removable PVC Bathroom Wall Decal Aesthetic Home Decor Art
like
Find Similar
Watercolor wall sticker with elegant girl in purple floral dress and butterflies - Watercolor Flower Dress Girl Style / Purple Series
Watercolor Flower Dress Girl Butterflies Toilet Sticker Removable PVC Bathroom Wall Decal Aesthetic Home Decor Art
$0.98
Mix MOQ : 4
Natural Loofah Facial Pads Round Exfoliating Luffa Sponge For Makeup Removal And Deep Face Cleaning Scrubber
Natural Loofah Facial Pads Round Exfoliating Luffa Sponge For Makeup Removal And Deep Face Cleaning Scrubber
like
Find Similar
Natural loofah exfoliating facial pads for gentle skin cleansing and makeup removal - Single 6x6cm (Bulk)
Natural Loofah Facial Pads Round Exfoliating Luffa Sponge For Makeup Removal And Deep Face Cleaning Scrubber
$0.12
No MOQ
 · 
44 views
Vintage Floral Pattern Linen Throw Pillow Case Square Decorative Cushion Cover For Home Sofa Living Room Artistic Bird Horse Print
Vintage Floral Pattern Linen Throw Pillow Case Square Decorative Cushion Cover For Home Sofa Living Room Artistic Bird Horse Print
like
Find Similar
Black square cushion cover with embroidered purple iris floral pattern for home decor - Iris Pattern (TYMD24-1) / 45*45cm (Single-Sided Without Core)
Square black cushion cover featuring vintage pink and gold floral embroidery pattern - Rose Pattern (TYMD24-2) / 45*45cm (Single-Sided Without Core)
Macro shot of vintage embroidered flower pattern on square decorative cushion cover - Vintage Red Rose (TYMD24-3) / 45*45cm (Single-Sided Without Core)
Black decorative throw pillow cover featuring hummingbird and colorful flower embroidery - Hummingbird And Flower (TYMD24-4) / 45*45cm (Single-Sided Without Core)
+37
Vintage Floral Pattern Linen Throw Pillow Case Square Decorative Cushion Cover For Home Sofa Living Room Artistic Bird Horse Print
$1.30
Mix MOQ : 2
Cartoon Unicorn Heart Toilet Sticker PVC Waterproof Watercolor Handpainted Bathroom Wall Decal For Toilet Lid Decoration
Cartoon Unicorn Heart Toilet Sticker PVC Waterproof Watercolor Handpainted Bathroom Wall Decal For Toilet Lid Decoration
like
Find Similar
Detail view of unicorn and red heart wall sticker with precise dimensions and layout size - 29*29CM(fun-m315)
NewCartoon Unicorn Heart Toilet Sticker PVC Waterproof Watercolor Handpainted Bathroom Wall Decal For Toilet Lid Decoration
$0.86
No MOQ
Linen Plant Leaf Letter Print Decorative Pillowcase Modern Square Sofa Cushion Cover For Home Living Room Bedroom Decor
Linen Plant Leaf Letter Print Decorative Pillowcase Modern Square Sofa Cushion Cover For Home Living Room Bedroom Decor
like
Find Similar
Square beige cushion cover with green botanical print and gather text on leather sofa - 18x18 Inch / Botanical Print(SPP007-1)
Botanical pillow cover with This is our happy place text on a white sofa with plants - 18x18 Inch / Happy Place Print(SPP007-2)
Square beige pillowcase with green botanical leaves, white flowers and Bless text print - 18x18 Inch / Bless Print(SPP007-3)
Home Sweet Home printed pillowcase with gradient brown leaf patterns on a white sofa - 18x18 Inch / Home Sweet Home Print(SPP007-4)
Linen Plant Leaf Letter Print Decorative Pillowcase Modern Square Sofa Cushion Cover For Home Living Room Bedroom Decor
$1.30
Mix MOQ : 2
Bathroom Rules Wall Decal Soak Your Troubles Away Wall Sticker PVC Waterproof Removable DIY Black Letters Decoration For Bathroom Toilet Washroom Home Decor
Bathroom Rules Wall Decal Soak Your Troubles Away Wall Sticker PVC Waterproof Removable DIY Black Letters Decoration For Bathroom Toilet Washroom Home Decor
like
Find Similar
Soak Your Troubles Away wall decal in black, 60x40cm sheet size for bathroom decor - HMY6-219 / 40x60cm
Bathroom Rules Wall Decal Soak Your Troubles Away Wall Sticker PVC Waterproof Removable DIY Black Letters Decoration For Bathroom Toilet Washroom Home Decor
$1.35
Mix MOQ : 3
Silicone Floor Drain Cover Deodorant Anti-Odor Sink Strainer For Bathroom Kitchen Hair Catcher Cartoon Cute Animal Shape
Silicone Floor Drain Cover Deodorant Anti-Odor Sink Strainer For Bathroom Kitchen Hair Catcher Cartoon Cute Animal Shape
like
Find Similar
Pink floral silicone drain cover 17.5cm x 16cm for bathroom and kitchen sink odor protection - 17.5x16cm / Spring Flower - Pink
Green flower-shaped silicone drain cover measuring 16cm x 15.8cm for bathroom use - 16x15.8cm / Spring Flower - Green
Flower-shaped yellow and blue silicone drain cover mat for sinks and floors, 17.8cm x 17.4cm - 17.8x17.4cm / Spring Flower - Yellow
Gray silicone floor drain cover 15x15cm with wave texture and fishtail handle - 15x15cm / Whale Tail Floor Drain Cover - Grey
+22
Silicone Floor Drain Cover Deodorant Anti-Odor Sink Strainer For Bathroom Kitchen Hair Catcher Cartoon Cute Animal Shape
$0.97-1.38
No MOQ
Pink Floral Toilet Sticker Waterproof PVC Flower Wall Decal For Bathroom Lid Tank Home Decor Self Adhesive Decorative Sticker
Pink Floral Toilet Sticker Waterproof PVC Flower Wall Decal For Bathroom Lid Tank Home Decor Self Adhesive Decorative Sticker
like
Find Similar
Lotus flower wall sticker for bathroom and living room decor with dimensions 30x20cm - 20*30cm
Pink Floral Toilet Sticker Waterproof PVC Flower Wall Decal For Bathroom Lid Tank Home Decor Self Adhesive Decorative Sticker
$0.66
Mix MOQ : 2
Spring Floral Linen Pillow Case Decorative Square Cushion Cover For Sofa Living Room Flower Truck Inspirational Quotes
Spring Floral Linen Pillow Case Decorative Square Cushion Cover For Sofa Living Room Flower Truck Inspirational Quotes
like
Find Similar
Linen pillow cover featuring spring flowers and a watering can on black and white stripes - Striped Watering Can Floral Style (SPP011-1) / Single Side Printing Without Core / 18x18 Inch
Linen sofa cushion with Hello Spring floral design on white background in living room - Hello Spring Slogan Style (SPP011-2) / Single Side Printing Without Core / 18x18 Inch
Modern spring floral truck pillow with black and white stripes on a white sofa - Striped Flower Truck Style (SPP011-3) / Single Side Printing Without Core / 18x18 Inch
Linen floral pillow with Live Life In Full Bloom text on white sofa surrounded by plants - Bloom Slogan Style (SPP011-4) / Single Side Printing Without Core / 18x18 Inch
Spring Floral Linen Pillow Case Decorative Square Cushion Cover For Sofa Living Room Flower Truck Inspirational Quotes
$1.30
Mix MOQ : 2
Sunflower Bathroom Toilet Stickers Waterproof PVC Wall Decal For Home Washroom Decor Removable Floral Sunflowers Pattern
Sunflower Bathroom Toilet Stickers Waterproof PVC Wall Decal For Home Washroom Decor Removable Floral Sunflowers Pattern
like
Find Similar
Waterproof sunflower self-adhesive wall stickers for bathroom and bedroom decor - 30x30cm
Sunflower Bathroom Toilet Stickers Waterproof PVC Wall Decal For Home Washroom Decor Removable Floral Sunflowers Pattern
$0.58
No MOQ
Cute Cartoon Diatom Mud Floor Mat Semicircular Absorbent Quick Dry Non Slip Bath Rug For Bathroom Entrance
Cute Cartoon Diatom Mud Floor Mat Semicircular Absorbent Quick Dry Non Slip Bath Rug For Bathroom Entrance
like
Find Similar
Rainbow flower diatomite bath mat, 35x60cm semi-circle absorbent non-slip door rug - 35*60cm / Rainbow Flowers
Semi-circular diatomaceous earth bath mat with colorful happy journey flower design - 40*60cm / Happy Journey Flowers
Semi-circle diatomaceous mud bath mat with cute blue Snooze Bear cartoon design - 40*60cm / Goodnight Bear
Cute Cartoon Diatom Mud Floor Mat Semicircular Absorbent Quick Dry Non Slip Bath Rug For Bathroom Entrance
$3.40
Mix MOQ : 2
Cute Cartoon Cat Butterfly Flower Toilet Sticker Waterproof PVC Bathroom Decal Self Adhesive Home Decor Mural Art Sticker
Cute Cartoon Cat Butterfly Flower Toilet Sticker Waterproof PVC Bathroom Decal Self Adhesive Home Decor Mural Art Sticker
like
Find Similar
Detailed size specifications for cute cat and butterfly wall sticker, 29cm by 28cm dimensions - 28x29cm (M-301)
Cute Cartoon Cat Butterfly Flower Toilet Sticker Waterproof PVC Bathroom Decal Self Adhesive Home Decor Mural Art Sticker
$0.58
No MOQ
Tropical Summer Pineapple Printed Short Velvet Pillowcase Modern Minimalist Decorative Cushion Cover For Home Sofa Living Room
Tropical Summer Pineapple Printed Short Velvet Pillowcase Modern Minimalist Decorative Cushion Cover For Home Sofa Living Room
like
Find Similar
Summer pineapple print throw pillow cover with hello summer text on a white sofa - 45x45cm Single-sided No Insert / CDR316-1
Decorative square pillowcase featuring a bright pineapple print on a white sofa setup - 45x45cm Single-sided No Insert / CDR316-2
Decorative pillowcase with colorful pineapple prints on a textured linen-style fabric - 45x45cm Single-sided No Insert / CDR316-3
Hello Summer pineapple print cushion cover on a white sofa with orange knitted blanket - 45x45cm Single-sided No Insert / CDR316-4
NewTropical Summer Pineapple Printed Short Velvet Pillowcase Modern Minimalist Decorative Cushion Cover For Home Sofa Living Room
$1.21
Mix MOQ : 2
Flamingo Tropical Leaves Floral Toilet Lid Sticker PVC Removable Wall Decal For Bathroom Home Decor Modern Simple Style
Flamingo Tropical Leaves Floral Toilet Lid Sticker PVC Removable Wall Decal For Bathroom Home Decor Modern Simple Style
like
Find Similar
Detail of flamingo wall stickers showing layout size and application measurements - 28*29cm Flamingo Flower Leaf Pattern (LD-M073)
Flamingo Tropical Leaves Floral Toilet Lid Sticker PVC Removable Wall Decal For Bathroom Home Decor Modern Simple Style
$0.16
No MOQ
3D Imitation Embroidery Floral Butterfly Linen Pillowcase Digital Printing Square Sofa Cushion Cover For Living Room Decor
3D Imitation Embroidery Floral Butterfly Linen Pillowcase Digital Printing Square Sofa Cushion Cover For Living Room Decor
like
Find Similar
Beige floral cushion cover with 3D embroidery effect and butterfly patterns - 45x45cm Linen Single Side Without Core / Multicolor Style 1 (DYM324-1)
3D faux embroidery floral pillow cover with colorful flowers and butterflies on parchment texture - 45x45cm Linen Single Side Without Core / Multicolor Style 2 (DYM324-2)
Square beige cushion cover with 3D floral embroidery and colorful butterfly patterns - 45x45cm Linen Single Side Without Core / Multicolor Style 3 (DYM324-3)
Detailed view of 3D floral embroidery print on premium linen cushion cover with butterflies - 45x45cm Linen Single Side Without Core / Multicolor Style 4 (DYM324-4)
+8
3D Imitation Embroidery Floral Butterfly Linen Pillowcase Digital Printing Square Sofa Cushion Cover For Living Room Decor
$1.30
Mix MOQ : 2
Tropical Monstera Leaves Toilet Stickers PVC Waterproof Self-adhesive Plant Wall Decals For Bathroom Home Decor Green Foliage
Tropical Monstera Leaves Toilet Stickers PVC Waterproof Self-adhesive Plant Wall Decals For Bathroom Home Decor Green Foliage
like
Find Similar
Set of tropical monstera and palm leaf wall stickers measuring 29cm for home decor - Tropical Green Plant Style (M-294印) / 29cmx29cm
Tropical Monstera Leaves Toilet Stickers PVC Waterproof Self-adhesive Plant Wall Decals For Bathroom Home Decor Green Foliage
$0.63
No MOQ
Houndstooth Checkerboard Tufted Throw Pillow Case Soft Faux Lamb Wool Decorative Cushion Cover For Sofa Couch Home Decor
Houndstooth Checkerboard Tufted Throw Pillow Case Soft Faux Lamb Wool Decorative Cushion Cover For Sofa Couch Home Decor
like
Find Similar
Elegant black and white houndstooth decorative cushion covers on a green velvet chair - 30*50cm (With 380g High Elastic Brushed Core) / Dark Green Black Houndstooth
Modern houndstooth tufted pillow cover in cream and orange brown geometric pattern - 30*50cm (With 380g High Elastic Brushed Core) / Minimalist Line Tufting
Modern black and white checkered tufted pillow cover in soft plush sherpa fabric - 30*50cm (With 380g High Elastic Brushed Core) / Black & White Checkerboard
Classic houndstooth tufted pillow cover in black and beige on gold metal chair - 30*50cm (With 380g High Elastic Brushed Core) / Light Coffee Houndstooth
+50
Houndstooth Checkerboard Tufted Throw Pillow Case Soft Faux Lamb Wool Decorative Cushion Cover For Sofa Couch Home Decor
$3.17-10.23
Mix MOQ : 2
Coral Fleece Bathrobe Long Flannel Robe Thick Warm Winter Sleepwear Shawl Collar Belted Nightgown Unisex Couple Loungewear
Coral Fleece Bathrobe Long Flannel Robe Thick Warm Winter Sleepwear Shawl Collar Belted Nightgown Unisex Couple Loungewear
like
Find Similar
Coconut Brown plush long bathrobe with belted waist and white piping trim for couples - M / Coconut Brown (Women)
Coconut brown long plush coral fleece bathrobe with waist belt for men in winter - M / Coconut Brown (Men)
Thick cream yellow coral fleece bathrobe with waist belt and deep side pockets - M / Creamy Yellow (Women)
Thick cream coral fleece long bathrobe with shawl collar and waist belt for men - M / Creamy Yellow (Men)
+26
Coral Fleece Bathrobe Long Flannel Robe Thick Warm Winter Sleepwear Shawl Collar Belted Nightgown Unisex Couple Loungewear
$17.00
No MOQ
 · 
12 views
Pink Cherry Blossom Butterfly Bathroom Toilet Wall Sticker PVC Waterproof Self Adhesive Elegant Home Decor Art Decal
Pink Cherry Blossom Butterfly Bathroom Toilet Wall Sticker PVC Waterproof Self Adhesive Elegant Home Decor Art Decal
like
Find Similar
Detail of pink 3D flower and butterfly wall stickers with 20x29cm size dimensions - Cherry Blossom Butterfly Style (M-311)
Pink Cherry Blossom Butterfly Bathroom Toilet Wall Sticker PVC Waterproof Self Adhesive Elegant Home Decor Art Decal
$0.58
No MOQ
Vintage Ink Blue Rose Toilet Sticker Gold Foil Floral PVC Wall Decal For Bathroom Home Decoration Self-Adhesive Art Sticker
Vintage Ink Blue Rose Toilet Sticker Gold Foil Floral PVC Wall Decal For Bathroom Home Decoration Self-Adhesive Art Sticker
like
Find Similar
Detail view of black rose floral wall decal with size guide and installation layout - Ink Blue Rose Flower (HY-M526)
Vintage Ink Blue Rose Toilet Sticker Gold Foil Floral PVC Wall Decal For Bathroom Home Decoration Self-Adhesive Art Sticker
$0.58
No MOQ
Nordic Minimalist Geometric Pillowcase Polyester Peach Skin Decorative Cushion Cover For Sofa Couch Home Bedroom Decor
Nordic Minimalist Geometric Pillowcase Polyester Peach Skin Decorative Cushion Cover For Sofa Couch Home Bedroom Decor
like
Find Similar
Minimalist geometric square cushion cover with tribal patterns in caramel orange and slate blue - Bohemian Ethnic Geometric Style (DRD90-1)
Nordic minimalist square cushion cover with navy blue geometric diamond pattern in cream white - Ethnic Dark Blue Diamond Style (DRD90-2)
Square pillow cover with colorful geometric tribal patterns on soft canvas fabric - Tribal Geometric Print Style (DRD90-3)
Modern square taupe cushion cover with white arrow patterns and linen-like texture - Simple Taupe Arrow Line Style (DRD90-4)
+6
NewNordic Minimalist Geometric Pillowcase Polyester Peach Skin Decorative Cushion Cover For Sofa Couch Home Bedroom Decor
$1.24
Mix MOQ : 2
Nordic Style Daisy Floral Print Peach Skin Cushion Cover Artistic Abstract Flower Sofa Throw Pillow Case Home Decor
Nordic Style Daisy Floral Print Peach Skin Cushion Cover Artistic Abstract Flower Sofa Throw Pillow Case Home Decor
like
Find Similar
Detail of light blue peach skin fabric texture with daisy flower bouquet illustration - 45*45cm (No Insert) / Light Blue White Daisy in Vase (DRD445-1)
Detailed view of Nordic daisy floral print peach skin pillowcase with abstract geometric pattern - 45*45cm (No Insert) / Simple Abstract Geometric Blocks (DRD445-2)
Mustard yellow Nordic cushion cover featuring a grey abstract leaf print in peach skin - 45*45cm (No Insert) / Mustard Yellow Gray Abstract Leaf (DRD445-3)
Nordic peach skin pillowcase featuring golden Matisse style abstract floral print - 45*45cm (No Insert) / Artistic Streamline Abstract Leaf (DRD445-4)
+13
Nordic Style Daisy Floral Print Peach Skin Cushion Cover Artistic Abstract Flower Sofa Throw Pillow Case Home Decor
-5%
$1.20
Mix MOQ : 2
Watercolor Birds Flowers Toilet Sticker PVC Removable Bathroom Decor Wall Decal For Toilet Cover Home Decoration Aesthetic
Watercolor Birds Flowers Toilet Sticker PVC Removable Bathroom Decor Wall Decal For Toilet Cover Home Decoration Aesthetic
like
Find Similar
Watercolor bird wall sticker sheet size 29x25cm and finish size 27x23cm dimensions - Watercolor Flower Bird Style
Watercolor Birds Flowers Toilet Sticker PVC Removable Bathroom Decor Wall Decal For Toilet Cover Home Decoration Aesthetic
$0.86
No MOQ
Bohemian Tufted Woven Throw Pillow Case Geometric Striped Decorative Cushion Cover For Sofa Living Room Bedroom Home Decor
Bohemian Tufted Woven Throw Pillow Case Geometric Striped Decorative Cushion Cover For Sofa Living Room Bedroom Home Decor
like
Find Similar
Modern beige tufted cushion cover with black and grey vertical woven stripes - 18x18 Inch / Black and White (Without Core)
Blue and dark grey tufted boho throw pillow cover in woven fabric on a soft beige sofa - 18x18 Inch / Blue (Without Core)
Modern woven tufted pillow covers with black and white vertical stripes for home decor - 18x18 Inch / White Plush White Background (Without Core)
Set of 2 grey and white tufted boho pillow covers with textured stripe patterns - 18x18 Inch / Grey Plush White Background (Without Core)
+52
Bohemian Tufted Woven Throw Pillow Case Geometric Striped Decorative Cushion Cover For Sofa Living Room Bedroom Home Decor
-5%
$8.49-13.28
Mix MOQ : 2
Bathroom Lettering Wall Sticker Vertical Door Decal Waterproof PVC Vinyl Art Decor For Toilet Bathroom Door Minimalist Leaf Decoration Black
Bathroom Lettering Wall Sticker Vertical Door Decal Waterproof PVC Vinyl Art Decor For Toilet Bathroom Door Minimalist Leaf Decoration Black
like
Find Similar
Self-adhesive PVC bathroom wall sticker with floral design and layout dimensions - Layout Specification (10Y23-A33) / Black
Bathroom Lettering Wall Sticker Vertical Door Decal Waterproof PVC Vinyl Art Decor For Toilet Bathroom Door Minimalist Leaf Decoration Black
$0.69
Mix MOQ : 8
Watercolor Koi Fish Flower Plant Bathroom Toilet Sticker PVC Waterproof Wall Decal For Toilet Lid Tank Home Decoration
Watercolor Koi Fish Flower Plant Bathroom Toilet Sticker PVC Waterproof Wall Decal For Toilet Lid Tank Home Decoration
like
Find Similar
Detail view of the 29cm watercolor koi fish and flower wall sticker dimensions and layout - 29x29cm (fun-m57)
Watercolor Koi Fish Flower Plant Bathroom Toilet Sticker PVC Waterproof Wall Decal For Toilet Lid Tank Home Decoration
$0.72
No MOQ
3D Abstract Cross Flannel Throw Blanket Blue Swirl Art Soft Fleece Nap Blanket For Home Decor Bedding Blanket
3D Abstract Cross Flannel Throw Blanket Blue Swirl Art Soft Fleece Nap Blanket For Home Decor Bedding Blanket
like
Find Similar
Artistic cross print flannel blanket with blue swirls on a modern grey sofa - 100x150cm
3D Abstract Cross Flannel Throw Blanket Blue Swirl Art Soft Fleece Nap Blanket For Home Decor Bedding Blanket
-5%
$4.52
No MOQ
 · 
10 views
Geometric Color Block Cushion Cover Nordic Style Polyester Peach Skin Decorative Square Pillow Case For Sofa Living Room
Geometric Color Block Cushion Cover Nordic Style Polyester Peach Skin Decorative Square Pillow Case For Sofa Living Room
like
Find Similar
Detail of square peach skin pillowcase with geometric floral pattern in yellow and teal - 18x18 Inch / Minimalist Geometric Floral (DDRD418-1)
Detail showing geometric quatrefoil pattern on peach skin fabric square pillowcase cover - 18x18 Inch / Clover Geometric (DDRD418-2)
Close-up of geometric peach skin fabric texture on square decorative pillowcase - 18x18 Inch / Retro Leaf Grid (DDRD418-3)
Detail of square peach skin pillowcase with geometric diamond and red floral patterns - 18x18 Inch / Rhombus Radial Floral (DDRD418-4)
+19
Geometric Color Block Cushion Cover Nordic Style Polyester Peach Skin Decorative Square Pillow Case For Sofa Living Room
-5%
$1.20
Mix MOQ : 2
Cute Cartoon Boy Jellyfish Seaweed Toilet Sticker Waterproof PVC Bathroom Decor Self Adhesive Wall Decal For Home Decoration
Cute Cartoon Boy Jellyfish Seaweed Toilet Sticker Waterproof PVC Bathroom Decor Self Adhesive Wall Decal For Home Decoration
like
Find Similar
Size specifications of cartoon boy jellyfish bathroom sticker for wall and toilet decoration - 29x29cm (fun-m425)
Cute Cartoon Boy Jellyfish Seaweed Toilet Sticker Waterproof PVC Bathroom Decor Self Adhesive Wall Decal For Home Decoration
$0.86
No MOQ
Purple Lavender Butterfly Toilet Sticker PVC Waterproof Removable Wisteria Flower Wall Decal For Bathroom Home Decor
Purple Lavender Butterfly Toilet Sticker PVC Waterproof Removable Wisteria Flower Wall Decal For Bathroom Home Decor
like
Find Similar
Detailed dimension guide for purple lavender butterfly wall stickers showing size specs - Purple Floral Butterfly Style (HY-M302) / 29x29cm
NewPurple Lavender Butterfly Toilet Sticker PVC Waterproof Removable Wisteria Flower Wall Decal For Bathroom Home Decor
$0.86
No MOQ
Linen Pillowcase Vintage Watercolor Botanical Flower Butterfly Print Square Decorative Cushion Cover For Sofa Living Room Home Decor
Linen Pillowcase Vintage Watercolor Botanical Flower Butterfly Print Square Decorative Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Linen pillowcase with watercolor floral and butterfly patterns on a beige background - 18x18 Inch / Beige Watercolor Floral Style (YMD78-1)
Linen pillowcase with vintage floral and butterfly watercolor print for home sofa decor - 18x18 Inch / Vintage Pastoral Flower Butterfly Style (YMD78-2)
Linen pillow cover featuring watercolor flower vase and butterfly prints for sofa decor - 18x18 Inch / Blue Glass Bottle Flower Butterfly Style (YMD78-3)
Linen pillowcase with watercolor flower, butterfly patterns and Nice Day text - 18x18 Inch / Watercolor Natural Insect Letter Style (YMD78-4)
Linen Pillowcase Vintage Watercolor Botanical Flower Butterfly Print Square Decorative Cushion Cover For Sofa Living Room Home Decor
-4%
$1.15
Mix MOQ : 2
Nordic Dandelion Print Pillow Case Imitation Silk Satin Decorative Cushion Cover For Sofa Bedroom Living Room White Square Home Decor
Nordic Dandelion Print Pillow Case Imitation Silk Satin Decorative Cushion Cover For Sofa Bedroom Living Room White Square Home Decor
like
Find Similar
Nordic white satin pillow cover with black dandelion print and silky finish - 45*45cm (With 400g Non-woven Insert) / Style 1
Nordic dandelion pattern cushion cover in white faux silk fabric with elegant floral print - 45*45cm (With 400g Non-woven Insert) / Style 2
+4
NewNordic Dandelion Print Pillow Case Imitation Silk Satin Decorative Cushion Cover For Sofa Bedroom Living Room White Square Home Decor
$2.16-4.76
Mix MOQ : 2
Retro Celestial Sun Moon Star Pattern Decorative Pillowcase Soft Plush Polyester Cushion Cover For Sofa Living Room Home Decor
Retro Celestial Sun Moon Star Pattern Decorative Pillowcase Soft Plush Polyester Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Vintage celestial sun moon pillow cover with golden stars on black cotton linen fabric - Black Mystic Sun Moon (CDR431-1) / 45x45cm Short Plush No Core
Pink vintage sun and moon throw pillow cover with mystical celestial astrology pattern - Pink Eyes Closed Sun Stars (CDR431-2) / 45x45cm Short Plush No Core
Retro American moon and sun pillowcase in light pink with bohemian stars on fabric - Pink Retro Celestial Pattern (CDR431-3) / 45x45cm Short Plush No Core
Vintage celestial pillow case with gold moon and star print on black fabric - Black Retro Moon Stars (CDR431-4) / 45x45cm Short Plush No Core
Retro Celestial Sun Moon Star Pattern Decorative Pillowcase Soft Plush Polyester Cushion Cover For Sofa Living Room Home Decor
$1.30
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in bedding & bathroom

homecolorholderstoragestylepolyesterdoubleheaddesignheart
hangingplastictravelshapecleaningsimplekidslayerwhitedaily

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access