Everful

Wholesale bedding & bathroom

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bedding & Bathroom

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

All products in bedding & bathroom

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Modern Minimalist Gold Mountain Abstract Art Pillowcase Polyester Printed Cushion Cover For Sofa Living Room Home Decor
Modern Minimalist Gold Mountain Abstract Art Pillowcase Polyester Printed Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Golden mountain landscape cushion cover in teal and pink art deco geometric style - 18x18 Inch / Design 11
Golden mountain peak pillowcase featuring modern moon and forest illustration - 18x18 Inch / Design 1
Modern square throw pillow with golden mountain peaks and marble texture design - 18x18 Inch / Design 2
Golden peak pillowcase with purple mountain and pine forest landscape art - 18x18 Inch / Design 3
+31
Modern Minimalist Gold Mountain Abstract Art Pillowcase Polyester Printed Cushion Cover For Sofa Living Room Home Decor
-5%
$1.20
Mix MOQ : 2
Lidded Soap Box PET Plastic Double Layer Drainage Waterproof Dustproof Bathroom Travel Countertop Case Modern Minimalist
Lidded Soap Box PET Plastic Double Layer Drainage Waterproof Dustproof Bathroom Travel Countertop Case Modern Minimalist
like
Find Similar
Obsidian black portable soap box with lid and drainage tray, 13.5x9.5x5.2cm size - Double Layer Sealed / Obsidian Black
Creamy white travel soap box with transparent lid and waterproof seal, 13.5x9.5x5.2cm - Double Layer Sealed / Cream White
Minimalist double-layer waterproof soap box in grey with lid for travel, 13.5x9.5x5.2cm - Double Layer Sealed / Versatile Grey
Set of 2 stackable double-layer soap boxes in cream white and grey with sealing lids - Double Layer Sealed / Cream White + Simple Grey
+15
Lidded Soap Box PET Plastic Double Layer Drainage Waterproof Dustproof Bathroom Travel Countertop Case Modern Minimalist
$0.93-3.71
No MOQ
 · 
20 sold recently
Couple Long Bathrobe Thickened Flannel Pineapple Grid Warm Sleepwear Robe With Belt For Men And Women
Couple Long Bathrobe Thickened Flannel Pineapple Grid Warm Sleepwear Robe With Belt For Men And Women
like
Find Similar
Women's ivory white long fleece bathrobe with waist belt and textured fabric - M / White Women
Men's white flannel long bathrobe with belted waist and pockets for winter warmth - M / White Men
Thick purple waffle texture flannel bathrobe for women with tie waist and plush fabric - M / Purple Women
Men's purple flannel bathrobe with pineapple grid texture and waist tie detail - M / Purple Men
+41
Couple Long Bathrobe Thickened Flannel Pineapple Grid Warm Sleepwear Robe With Belt For Men And Women
$13.54
No MOQ
 · 
11 views
Spring Bee Sunflower Decorative Throw Pillow Covers Polyester Linen Look Buffalo Check Bee Sweet Gingham Pattern Nordic Style Square Cushion Cases For Home Sofa Decor
Spring Bee Sunflower Decorative Throw Pillow Covers Polyester Linen Look Buffalo Check Bee Sweet Gingham Pattern Nordic Style Square Cushion Cases For Home Sofa Decor
like
Find Similar
Linen bee sunflower gnome pillow cover with Let It Be text on white background - 45*45cm (No Insert) / Gnome Bee Style (YMD299-1)
Bee Sweet yellow buffalo check pillow cover with bee and daisy print floral pattern - 45*45cm (No Insert) / Bee Flower Style (YMD299-2)
Linen floral pillow cover with vintage truck, yellow daisies and bumblebees print - 45*45cm (No Insert) / Bee Truck Style (YMD299-3)
Country style bee and sunflower gingham throw pillow cover with Farm Fresh Honey text - 45*45cm (No Insert) / Farm Bee Plaid Style (YMD299-4)
Spring Bee Sunflower Decorative Throw Pillow Covers Polyester Linen Look Buffalo Check Bee Sweet Gingham Pattern Nordic Style Square Cushion Cases For Home Sofa Decor
$1.38
Mix MOQ : 2
American Style Bohemian Geometric Tassel Pillow Case Polyester Jacquard Decorative Cushion Cover For Sofa Living Room Decor
American Style Bohemian Geometric Tassel Pillow Case Polyester Jacquard Decorative Cushion Cover For Sofa Living Room Decor
like
Find Similar
Bohemian cream white throw pillow with woven texture and decorative tassels for sofa - 40x60CM (Without Insert) / Twist Beige
Bohemian cream white jacquard pillow cover with tassels on minimalist sofa - 40x60CM (Without Insert) / Rice Pattern Style
Bohemian orange and black striped pillow with tassels and square lumbar set - 40x60CM (Without Insert) / Orange Sides
Bohemian jacquard pillow set with geometric embroidery and tassels in cream and black - 40x60CM (Without Insert) / Beige Black Double Diamond
+104
American Style Bohemian Geometric Tassel Pillow Case Polyester Jacquard Decorative Cushion Cover For Sofa Living Room Decor
$2.88-4.61
No MOQ
Modern Minimalist Jacquard Plush Pillow Case 3D Geometric Rhombus Pattern Cushion Cover For Sofa Living Room Home Decor
Modern Minimalist Jacquard Plush Pillow Case 3D Geometric Rhombus Pattern Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Dark blue plush geometric jacquard throw pillow cover with tufted diamond pattern - 45x45cm (With 500g High Elastic Insert) / Navy Blue
Sage green plush cushion cover with geometric 3D jacquard pattern and cable knit texture - 45x45cm (With 500g High Elastic Insert) / Bean Green
Gray tufted geometric diamond throw pillow cover on a modern wooden chair - 45x45cm (With 500g High Elastic Insert) / Gray
Ginger yellow plush pillow cover with geometric diamond jacquard knit texture on wood chair - 45x45cm (With 500g High Elastic Insert) / Turmeric
+68
NewModern Minimalist Jacquard Plush Pillow Case 3D Geometric Rhombus Pattern Cushion Cover For Sofa Living Room Home Decor
-5%
$2.05-8.63
Mix MOQ : 2
Blue Floral Linen Throw Pillowcase Spring Botanical Printed Square Sofa Decorative Cushion Cover For Living Room Home Decor
Blue Floral Linen Throw Pillowcase Spring Botanical Printed Square Sofa Decorative Cushion Cover For Living Room Home Decor
like
Find Similar
Linen pillowcase with blue floral forget-me-not prints and rustic vase design - Blue Floral Vase Style (DYM225-1)
Blue floral linen throw pillow cover with hello SPRING text for sofa decor - Hello Spring Lettering Style (DYM225-2)
Light blue linen pillowcase with floral print and Bless OUR Home text decoration - Bless Our Home Lettering Style (DYM225-3)
Blue floral linen throw pillow cover with spring botanical print for sofa decoration - Blue Forget-me-not Bush Style (DYM225-4)
NewBlue Floral Linen Throw Pillowcase Spring Botanical Printed Square Sofa Decorative Cushion Cover For Living Room Home Decor
$1.21
Mix MOQ : 2
Valentine Day Pillowcase Heart Pattern Polyester Decorative Throw Pillow Cover For Sofa Living Room Love Theme Pink White
Valentine Day Pillowcase Heart Pattern Polyester Decorative Throw Pillow Cover For Sofa Living Room Love Theme Pink White
like
Find Similar
Linen Valentine's Day pillow cover with pink stripes and hello VALENTINE print - No Insert / Hello Valentine Lettering (YMD019-1)
Pink linen Valentine's pillow cover with white heart patterns and Love script - No Insert / Pink Love Heart (YMD019-2)
Peach pink linen pillow cover with white LOVE grows here floral print for Valentine decor - No Insert / Botanical Love Slogan (YMD019-3)
Pink and white checkered linen pillow cover for Valentine sofa decoration - No Insert / Pink and White Gingham (YMD019-4)
Valentine Day Pillowcase Heart Pattern Polyester Decorative Throw Pillow Cover For Sofa Living Room Love Theme Pink White
$1.21
Mix MOQ : 2
Modern Minimalist Lemon Print Polyester Cushion Cover Fresh Fruit Pattern Square Decorative Pillowcase For Sofa Living Room Home Decor
Modern Minimalist Lemon Print Polyester Cushion Cover Fresh Fruit Pattern Square Decorative Pillowcase For Sofa Living Room Home Decor
like
Find Similar
Square minimalist cushion cover with lemon branch print on off-white fabric background - 45*45cm Short Plush Single Sided Without Core / Lemon Branch Print (CDR446-1)
Square throw pillow cover featuring fresh watercolor lemon prints and green leaves decor - 45*45cm Short Plush Single Sided Without Core / Watercolor Lemon Print (CDR446-2)
Minimalist white square pillowcase featuring watercolor lemon print and green leaves design - 45*45cm Short Plush Single Sided Without Core / Lemon Script Text Print (CDR446-3)
Square pillow cover with minimalist lemon print and green leaves on white background - 45*45cm Short Plush Single Sided Without Core / Realistic Lemon Foliage Print (CDR446-4)
Modern Minimalist Lemon Print Polyester Cushion Cover Fresh Fruit Pattern Square Decorative Pillowcase For Sofa Living Room Home Decor
$1.30
Mix MOQ : 2
French Cream Style Chenille Pillow Cover 3D Leaf Texture Geometric Decorative Cushion Case For Sofa Living Room Bedroom
French Cream Style Chenille Pillow Cover 3D Leaf Texture Geometric Decorative Cushion Case For Sofa Living Room Bedroom
like
Find Similar
Beige chenille square cushion cover with 3D leaf pattern in French cream style - 45*45 (Without Core) / French Creamy Leaf
Cream chenille square cushion cover with 3D textured geometric leaf chevron patterns - 45*45 (Without Core) / Geometric Square
+10
NewFrench Cream Style Chenille Pillow Cover 3D Leaf Texture Geometric Decorative Cushion Case For Sofa Living Room Bedroom
-5%
$2.19-5.07
Mix MOQ : 2
Matisse Abstract Floral Pillowcase Nordic Geometric Cushion Cover Modern Peach Skin Decorative Throw Pillow Case For Sofa Home
Matisse Abstract Floral Pillowcase Nordic Geometric Cushion Cover Modern Peach Skin Decorative Throw Pillow Case For Sofa Home
like
Find Similar
Detail of Nordic blue Matisse art cushion cover with yellow cutout floral pattern - Henri Matisse Blue Paper Cut Art (DRD195-1) / 45x45
Nordic abstract floral pillow cover featuring blue seaweed and orange sun on beige canvas - Abstract Blue Seaweed And Orange Sun (DRD195-2) / 45x45
Close-up of blue square cushion cover featuring white handwritten artistic font design - Royal Blue Quote Design (DRD195-3) / 45x45
Detailed close-up of Matisse style cushion cover with blue leaves and yellow sun print - Matisse Art Exhibition Poster Style (DRD195-4) / 45x45
+9
NewMatisse Abstract Floral Pillowcase Nordic Geometric Cushion Cover Modern Peach Skin Decorative Throw Pillow Case For Sofa Home
-5%
$1.23
Mix MOQ : 2
Watercolor Garden Gnome Pillowcase Soft Short Plush Printed Square Cushion Cover Spring Flower Spirit Home Decor
Watercolor Garden Gnome Pillowcase Soft Short Plush Printed Square Cushion Cover Spring Flower Spirit Home Decor
like
Find Similar
Detailed watercolor gnome garden illustration on square white decorative cushion cover - Gnome with Truck Style (CDR20-1) / Short Plush Single Side Without Core
Garden gnome throw pillow case with floral hat and shovel on white background - Gnome with Shovel Style (CDR20-2) / Short Plush Single Side Without Core
Garden gnome throw pillow cover with lawn mower and floral watercolor pattern - Gnome with Mower Style (CDR20-3) / Short Plush Single Side Without Core
Watercolor garden gnome pillow cover with floral hat and roses for home sofa decor - Gnome with Flowers Style (CDR20-4) / Short Plush Single Side Without Core
+11
NewWatercolor Garden Gnome Pillowcase Soft Short Plush Printed Square Cushion Cover Spring Flower Spirit Home Decor
$1.30
Mix MOQ : 2
Bohemian Knitted Acrylic Bed Runner And Throw Pillow Zigzag Wave Pattern Tassels Modern Ethnic Style Home Decor
Bohemian Knitted Acrylic Bed Runner And Throw Pillow Zigzag Wave Pattern Tassels Modern Ethnic Style Home Decor
like
Find Similar
Bohemian knitted throw blanket with colorful zigzag patterns and decorative tassels - Yellow Series (127x180cm)
Bohemian knit throw blanket with wave patterns and fringe on a wooden armchair - Red Series (127x180cm)
Bohemian knit throw blanket with blue and yellow wave patterns and decorative tassels - Blue Series (127x180cm)
Bohemian zigzag knit throw blanket with fringe tassels in caramel and forest green - Khaki Series (127x180cm)
+7
Bohemian Knitted Acrylic Bed Runner And Throw Pillow Zigzag Wave Pattern Tassels Modern Ethnic Style Home Decor
$5.99-17.18
No MOQ
 · 
34 views
Valentine's Day Romantic Heart Pattern Polyester Pillow Case Love Letter Digital Print Square Cushion Cover Home Decor
Valentine's Day Romantic Heart Pattern Polyester Pillow Case Love Letter Digital Print Square Cushion Cover Home Decor
like
Find Similar
Detailed view of white square cushion cover with 16 diverse red heart grid patterns - 18x18 Inch / 16-Grid Red Heart Print Style (DRD369-1)
Detailed view of red heart pattern and festive greeting on Valentine's square pillowcase - 18x18 Inch / Red White Heart Festive Greeting Style (DRD369-2)
Detail view of Valentine decorative pillowcase featuring a romantic red heart bokeh design - 18x18 Inch / Full Red White Heart Print Style (DRD369-3)
Detail of red Valentine's Day pillow cover with Happy Valentine's Day text and heart - 18x18 Inch / Red Background White Text Peace Dove Style (DRD369-4)
+15
NewValentine's Day Romantic Heart Pattern Polyester Pillow Case Love Letter Digital Print Square Cushion Cover Home Decor
-5%
$1.23
Mix MOQ : 2
Herringbone Woven Plush Pillow Case Double Sided Soft Throw Cushion Cover Winter Warm Home Decor For Sofa Couch Living Room
Herringbone Woven Plush Pillow Case Double Sided Soft Throw Cushion Cover Winter Warm Home Decor For Sofa Couch Living Room
like
Find Similar
Brown and cream herringbone knit cushion covers set of two on a rattan chair - 45x45 with 400g Core / Coffee
Pair of square herringbone woven pillow covers in grey and white on a rattan bench - 45x45 with 400g Core / Gray
Set of 2 black and white chevron woven throw pillow covers on a vintage rattan bench - 45x45 with 400g Core / Black
Pair of red and white chevron knitted cushion covers with textured finish - 45x45 with 400g Core / Burgundy
+11
Herringbone Woven Plush Pillow Case Double Sided Soft Throw Cushion Cover Winter Warm Home Decor For Sofa Couch Living Room
-10%
$2.59-5.32
Mix MOQ : 2
Animal Shaped Soft Flannel Nap Blanket Portable Travel Air Conditioning Throw Blanket For Office Home Sofa Adults Kids Gift
Animal Shaped Soft Flannel Nap Blanket Portable Travel Air Conditioning Throw Blanket For Office Home Sofa Adults Kids Gift
like
Find Similar
7 options
Animal Shaped Soft Flannel Nap Blanket Portable Travel Air Conditioning Throw Blanket For Office Home Sofa Adults Kids Gift
$6.34
Mix MOQ : 10
 · 
24 views
Plush Throw Blanket Faux Rabbit Fur Soft Thick Warm For Sofa Bed 3D Striped Carved Solid Color Cozy Decorative
Plush Throw Blanket Faux Rabbit Fur Soft Thick Warm For Sofa Bed 3D Striped Carved Solid Color Cozy Decorative
like
Find Similar
Grass green striped flannel blanket made of soft plush fabric for sofa and home - 70x100cm / Fruit Green
Thick beige faux rabbit fur blanket with soft vertical stripes for cozy home use - 70x100cm / Khaki
Plush foggy blue faux rabbit fur throw blanket with 3D stripe texture for sofas - 70x100cm / Blue
Thick dark gray plush blanket with vertical stripe texture on a cozy white sofa - 70x100cm / Dark Gray
+50
Plush Throw Blanket Faux Rabbit Fur Soft Thick Warm For Sofa Bed 3D Striped Carved Solid Color Cozy Decorative
-14%
$2.04-10.00
No MOQ
 · 
161 sold recently
Linen Plant Leaf Letter Print Decorative Pillowcase Modern Square Sofa Cushion Cover For Home Living Room Bedroom Decor
Linen Plant Leaf Letter Print Decorative Pillowcase Modern Square Sofa Cushion Cover For Home Living Room Bedroom Decor
like
Find Similar
Square beige cushion cover with green botanical print and gather text on leather sofa - 18x18 Inch / Botanical Print(SPP007-1)
Botanical pillow cover with This is our happy place text on a white sofa with plants - 18x18 Inch / Happy Place Print(SPP007-2)
Square beige pillowcase with green botanical leaves, white flowers and Bless text print - 18x18 Inch / Bless Print(SPP007-3)
Home Sweet Home printed pillowcase with gradient brown leaf patterns on a white sofa - 18x18 Inch / Home Sweet Home Print(SPP007-4)
NewLinen Plant Leaf Letter Print Decorative Pillowcase Modern Square Sofa Cushion Cover For Home Living Room Bedroom Decor
$1.30
Mix MOQ : 2
Waffle Weave Bathrobe V-Neck Absorbent Quick Dry Kimono Style Robe With Belt And Pockets For Unisex Couples
Waffle Weave Bathrobe V-Neck Absorbent Quick Dry Kimono Style Robe With Belt And Pockets For Unisex Couples
like
Find Similar
White waffle weave bathrobe for women and men with tie waist and front pockets - M / White (Women)
Men's white waffle cotton bathrobe with long sleeves and waist tie belt - M / White (Men)
Pink waffle knit bathrobe for women with tie waist and pockets for cozy home wear - M / Light Pink
Women's light yellow waffle weave bathrobe with V-neck and belted waist in modern bathroom - M / Light Yellow (Women)
+17
Waffle Weave Bathrobe V-Neck Absorbent Quick Dry Kimono Style Robe With Belt And Pockets For Unisex Couples
-5%
$7.39
No MOQ
 · 
16 views
Modern Minimalist Linen Decorative Pillowcase Printed Plaid Square Cushion Cover For Living Room Sofa Bedroom Home Decor
Modern Minimalist Linen Decorative Pillowcase Printed Plaid Square Cushion Cover For Living Room Sofa Bedroom Home Decor
like
Find Similar
2 options
Modern Minimalist Linen Decorative Pillowcase Printed Plaid Square Cushion Cover For Living Room Sofa Bedroom Home Decor
$1.21-4.73
Mix MOQ : 2
Hummingbird And Floral Print Quilted Flannel Blanket Reversible Soft Polyester Throw For Sofa Couch Bed Home Decor
Hummingbird And Floral Print Quilted Flannel Blanket Reversible Soft Polyester Throw For Sofa Couch Bed Home Decor
like
Find Similar
Quilted flannel throw blanket featuring colorful hummingbird and floral digital prints - Hummingbird Floral Digital Print / 100x150cm
Hummingbird And Floral Print Quilted Flannel Blanket Reversible Soft Polyester Throw For Sofa Couch Bed Home Decor
$4.76
No MOQ
 · 
11 views
Warm Double Layer Taffeta Velvet Throw Blanket Soft Thickened Fleece Bedding For Sofa Office Dormitory Nap Solid Color
Warm Double Layer Taffeta Velvet Throw Blanket Soft Thickened Fleece Bedding For Sofa Office Dormitory Nap Solid Color
like
Find Similar
Pink geometric fleece blanket with creamy white sherpa lining for cozy home bedding - Carnival Price Drop / 150cm*200cm / Sakura Pink
Double-layer thick yellow knitted throw blanket with white fleece backing for sofa bed - Midnight Sale - Tafury Jacquard Double-layer Blanket [apricot Yellow] - Special Price Drop! / Midnight - 150cm*200cm - Carnival Price Drop
Green knitted double-layer blanket with soft white sherpa fleece lining on a cozy bed - Midnight Sale - Taro Jacquard Double-layer Blanket [fruit Green] - Special Price Drop! / Midnight - 150cm*200cm - Carnival Price Drop
Thick off-white double-layer knit blanket with soft sherpa fleece lining for sofa and bed - Midnight Sale - Taphne Jacquard Double-layer Blanket [creamy White] - Special Price Drop / Midnight - 150cm*200cm - Carnival Price Drop
+38
Warm Double Layer Taffeta Velvet Throw Blanket Soft Thickened Fleece Bedding For Sofa Office Dormitory Nap Solid Color
$4.15-15.02
No MOQ
 · 
11 sold recently
Modern Minimalist Geometric Abstract Short Plush Cushion Cover Nordic Coffee Brown Decorative Throw Pillowcase For Sofa Living Room
Modern Minimalist Geometric Abstract Short Plush Cushion Cover Nordic Coffee Brown Decorative Throw Pillowcase For Sofa Living Room
like
Find Similar
Nordic brown square cushion cover with white abstract geometric fluid lines patterns - Abstract Lines (CRS60-1) / 45x45cm
Close-up of modern geometric cushion cover with brown dots and square patterns - Geometric Dots (CRS60-2) / 45x45cm
Modern coffee brown throw pillow cover featuring white abstract geometric patterns and black dot - Geometric Patchwork (CRS60-3) / 45x45cm
Modern brown cushion cover with white abstract geometric lines and patterns - Abstract Dots (CRS60-4) / 45x45cm
+8
Modern Minimalist Geometric Abstract Short Plush Cushion Cover Nordic Coffee Brown Decorative Throw Pillowcase For Sofa Living Room
$1.59
Mix MOQ : 2
Bohemian Jacquard Throw Pillow Cover With Tassels Geometric Decorative Cushion Case For Sofa Bed Living Room Home Decor
Bohemian Jacquard Throw Pillow Cover With Tassels Geometric Decorative Cushion Case For Sofa Bed Living Room Home Decor
like
Find Similar
Bohemian jacquard pillow covers with grey knit stripes and decorative tassels - Gray Center Stripe / 40x60cm Only (Without Core)
Boho beige woven cushion set with geometric patterns and tassels on a modern armchair - Dark Forest Black Tree / 40x60cm Only (Without Core)
Bohemian jacquard pillow set with geometric embroidery and tassels in cream and black - Beige Black Double Diamond / 40x60cm Only (Without Core)
Bohemian style square and lumbar pillow set with yellow geometric textures and tassels - Three Rope Pattern With White Tassels / 40x60cm Only (Without Core)
+104
NewBohemian Jacquard Throw Pillow Cover With Tassels Geometric Decorative Cushion Case For Sofa Bed Living Room Home Decor
-5%
$2.74-4.38
No MOQ
Tropical Jungle Tiger Printed Pillow Case Polyester American Minimalist Leaf Geometric Decorative Cushion Cover For Sofa Bed
Tropical Jungle Tiger Printed Pillow Case Polyester American Minimalist Leaf Geometric Decorative Cushion Cover For Sofa Bed
like
Find Similar
Modern black and white tiger print throw pillow cover in soft peach skin fabric - Black And White Zebra Print (DRD402-1)
Modern emerald cushion cover with elegant white lilies and hummingbirds print - Dark Green Hummingbird Lily (DRD402-2)
Tropical tiger and palm leaf pattern square cushion cover for home sofa decor - Tropical Tiger with Greenery (DRD402-3)
Tropical jungle tiger print square pillowcase featuring green leaves and wild animal motif - Tiger with Cub (DRD402-4)
+7
Tropical Jungle Tiger Printed Pillow Case Polyester American Minimalist Leaf Geometric Decorative Cushion Cover For Sofa Bed
$1.27
Mix MOQ : 2
Nordic Modern Minimalist Plush Pillow Case Soft Macaron Color Alphabet Flower Printed Throw Pillow Cover Decorative Cushion Case For Sofa Home Living Room
Nordic Modern Minimalist Plush Pillow Case Soft Macaron Color Alphabet Flower Printed Throw Pillow Cover Decorative Cushion Case For Sofa Home Living Room
like
Find Similar
Modern pink plush pillowcase with white geometric V-shape patterns for sofa decor - Pink Chevron (CDR37-1)
Pink square plush pillowcase featuring artistic Home Sweet Home lettering and hearts - Pink Home Letter (CDR37-2)
Modern white square cushion cover featuring pink floral pattern in minimalist Nordic style - White Pink Floral (CDR37-3)
Modern white plush pillowcase with pink geometric patterns including waves and dots - White Pink Geometric (CDR37-4)
+24
Nordic Modern Minimalist Plush Pillow Case Soft Macaron Color Alphabet Flower Printed Throw Pillow Cover Decorative Cushion Case For Sofa Home Living Room
$1.30
Mix MOQ : 2
Valentine's Day Linen Pillowcase Cupid Angel Heart Printed Decorative Throw Pillow Cover For Sofa Living Room Home Decor
Valentine's Day Linen Pillowcase Cupid Angel Heart Printed Decorative Throw Pillow Cover For Sofa Living Room Home Decor
like
Find Similar
Linen pillow cover featuring a cute angel with pink wings and blue roses print - 45*45cm Linen Single-Sided No Insert / Angel Rose Style (DYM93-1)
Square cotton linen Valentine cushion cover with Cupid gin and whiskey bottle prints - 45*45cm Linen Single-Sided No Insert / Pink Wine Bottle Style (DYM93-2)
Linen pillowcase with cartoon angel heart print and Cupid Vibes slogan in pink - 45*45cm Linen Single-Sided No Insert / Bubble Blowing Angel Girl Style (DYM93-3)
Detail of angel with heart sunglasses and Love Season print on square pillow cover - 45*45cm Linen Single-Sided No Insert / Brown Hair Angel Rose Style (DYM93-4)
+17
Valentine's Day Linen Pillowcase Cupid Angel Heart Printed Decorative Throw Pillow Cover For Sofa Living Room Home Decor
$1.30
Mix MOQ : 2
Hummingbird Floral Print Throw Pillow Case Soft Short Plush Square Cushion Cover For Sofa Living Room Home Decor
Hummingbird Floral Print Throw Pillow Case Soft Short Plush Square Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
White vintage square pillowcase featuring a watercolor gold-plated hummingbird print - 45x45cm Single Side No Core / Hummingbird Floral Style 1 (CDR13-1)
White square throw pillow featuring a colorful hummingbird print and artistic geometric details - 45x45cm Single Side No Core / Hummingbird Starlight Style 2 (CDR13-2)
Square white pillowcase featuring colorful artistic hummingbird digital print pattern - 45x45cm Single Side No Core / Colorful Hummingbird Style 3 (CDR13-3)
Vintage floral hummingbird print throw pillow cover in white fabric for home decor - 45x45cm Single Side No Core / Hummingbird Feeding Style 4 (CDR13-4)
+12
Hummingbird Floral Print Throw Pillow Case Soft Short Plush Square Cushion Cover For Sofa Living Room Home Decor
$1.30
Mix MOQ : 2
Spring Plant Flower Printed Cushion Cover Short Plush Square Pillow Case For Living Room Sofa Home Decor Floral Pillowcase
Spring Plant Flower Printed Cushion Cover Short Plush Square Pillow Case For Living Room Sofa Home Decor Floral Pillowcase
like
Find Similar
Detailed view of dark green cushion cover with white floral pattern and fabric texture - 45*45cm Single-sided Without Core / Dark Green White Flower Style(CDR341-1)
Detailed view of watercolor green and white floral print on a white square cushion cover - 45*45cm Single-sided Without Core / White Light Green Floral Style(CDR341-2)
Square cushion cover with watercolor green leaves and white flowers on cream fabric - 45*45cm Single-sided Without Core / Beige Watercolor Plant Style(CDR341-3)
Detail of green floral watercolor print on high-quality white decorative cushion cover - 45*45cm Single-sided Without Core / White Green Plant Watercolor Style(CDR341-4)
+12
Spring Plant Flower Printed Cushion Cover Short Plush Square Pillow Case For Living Room Sofa Home Decor Floral Pillowcase
$1.30
Mix MOQ : 2
Pink Flannel Blanket For Kids Cute Elephant Sleeping On Moon Soft Fleece Throw For Sofa Nap Nursery Bedroom Home Decor
Pink Flannel Blanket For Kids Cute Elephant Sleeping On Moon Soft Fleece Throw For Sofa Nap Nursery Bedroom Home Decor
like
Find Similar
Pink flannel baby blanket with cartoon elephant sleeping on moon and stars - Pink / 100x150cm
Pink Flannel Blanket For Kids Cute Elephant Sleeping On Moon Soft Fleece Throw For Sofa Nap Nursery Bedroom Home Decor
-5%
$4.52
No MOQ
 · 
14 views
Vintage Linen Lavender Flower Throw Pillow Cover Decorative Floral Letter Print Square Cushion Case For Home Sofa Couch
Vintage Linen Lavender Flower Throw Pillow Cover Decorative Floral Letter Print Square Cushion Case For Home Sofa Couch
like
Find Similar
Purple spring flower pillow case with hello LOVE print on white sofa decor - 45*45cm (No Insert) / Purple Artistic Letter Pattern (SPP002-1)
Lavender flower cotton linen pillow cover with Love lives here text on white sofa - 45*45cm (No Insert) / Lavender Floral Pattern (SPP002-2)
Lavender flower pillow cover with purple vintage bicycle print on linen sofa cushion - 45*45cm (No Insert) / Bicycle Lavender Pattern (SPP002-3)
Purple lavender floral pillow cover with gold Flower Market text on a cozy white sofa - 45*45cm (No Insert) / Vintage Flowers Market Pattern (SPP002-4)
NewVintage Linen Lavender Flower Throw Pillow Cover Decorative Floral Letter Print Square Cushion Case For Home Sofa Couch
$1.30
Mix MOQ : 2
Peacock Feather Ethnic Style Pillow Case Peach Skin Polyester Decorative Cushion Cover For Sofa Home Bedroom Living Room
Peacock Feather Ethnic Style Pillow Case Peach Skin Polyester Decorative Cushion Cover For Sofa Home Bedroom Living Room
like
Find Similar
Peacock feather print cushion cover in vivid green and blue tones, square pillowcase - 18x18 Inch / Realistic Green Blue Peacock Feather (DRD42-1)
Ethnic peacock feather pattern pillowcase in square peach skin fabric with green tones - 18x18 Inch / Vibrant Peacock Eye Close-up (DRD42-2)
Ethnic peacock feather pattern pillowcase with blue peacock and gold vintage frame - 18x18 Inch / European Vintage Peacock Border (DRD42-3)
Colorful ethnic peacock feather cushion cover made of soft peach skin fabric - 18x18 Inch / Colorful Abstract Art Peacock (DRD42-4)
+14
NewPeacock Feather Ethnic Style Pillow Case Peach Skin Polyester Decorative Cushion Cover For Sofa Home Bedroom Living Room
-4%
$1.15
Mix MOQ : 2
Microfiber Kitchen Towels Vintage Floral Butterfly Print Absorbent Dishcloth Decorative Dish Towels For Home Farmhouse Kitchen
Microfiber Kitchen Towels Vintage Floral Butterfly Print Absorbent Dishcloth Decorative Dish Towels For Home Farmhouse Kitchen
like
Find Similar
Floral kitchen towels set with vintage camera sunflower print and Focus text - Camera Sunflower Style (MJBT80-1)
Detail of floral kitchen towels with Stay Hopeful text on a rustic wooden rack - Stay Hopeful Floral Style (MJBT80-2)
Floral terry kitchen towels with Spread Kindness print and feather pattern, 2-pack set - Mjbt80-3 / 40*60cm
Floral terry kitchen towels with inspirational quote Be Proud Of How Far You Have Come - Mjbt80-4 / 40*60cm
+18
Microfiber Kitchen Towels Vintage Floral Butterfly Print Absorbent Dishcloth Decorative Dish Towels For Home Farmhouse Kitchen
$1.99
Mix MOQ : 2
 · 
24 sold recently
Mother's Day Decorative Polyester Heart Pillowcase Happy Mother's Day Lettering Cushion Cover For Sofa Bedroom Decor
Mother's Day Decorative Polyester Heart Pillowcase Happy Mother's Day Lettering Cushion Cover For Sofa Bedroom Decor
like
Find Similar
Peach skin polyester pillowcase with Mom I love you so much text and pink hearts - Mom I Love You So Much Style (DRD182-1)
Square peach skin pillowcase featuring Best Mom print with crown and pink hearts - Best Mom Style (DRD182-2)
White polyester throw pillow cover featuring love you Mom text with red heart icon - Love You Mom Style (DRD182-3)
White square pillowcase with pink My Mom is the best text for Mother's Day gift - My Mom Is The Best Style (DRD182-4)
+7
Mother's Day Decorative Polyester Heart Pillowcase Happy Mother's Day Lettering Cushion Cover For Sofa Bedroom Decor
-5%
$1.20
Mix MOQ : 2
Faux Rabbit Fur Plush Throw Pillow Case Tie-Dye Bubble Velvet Cushion Cover Modern Minimalist Decorative Pillowcase For Sofa
Faux Rabbit Fur Plush Throw Pillow Case Tie-Dye Bubble Velvet Cushion Cover Modern Minimalist Decorative Pillowcase For Sofa
like
Find Similar
Plush faux rabbit fur square throw pillow case in warm cream white for home decor - 45x45cm (With 400g Non-Woven Core) / White
Plush faux rabbit fur pillow cover in soft pink shade for cozy home living room decor - 45x45cm (With 400g Non-Woven Core) / Khaki
Faux rabbit fur throw pillow case in tie-dye yellow and white plush for home decor - 45x45cm (With 400g Non-Woven Core) / Melange White
Plush faux rabbit fur pillow cover in cream white with grey tie-dye pattern texture - 45x45cm (With 750g Down Silk Core) / Gray
+22
Faux Rabbit Fur Plush Throw Pillow Case Tie-Dye Bubble Velvet Cushion Cover Modern Minimalist Decorative Pillowcase For Sofa
$3.17-8.50
Mix MOQ : 2
American Independence Day Star Print Linen Pillow Cover Decorative Patriotic Cushion Case For Sofa Home Office Decor
American Independence Day Star Print Linen Pillow Cover Decorative Patriotic Cushion Case For Sofa Home Office Decor
like
Find Similar
Independence Day linen pillowcase with Home of the Free print and patriotic stars - 45*45cm Linen Single Sided Without Core / Off-white Star Style (DYM290-5（1）)
Linen Independence Day pillowcase with red fabric, blue and white stars and freedom text - 45*45cm Linen Single Sided Without Core / Red Freedom Letter Style (DYM290-5（2）)
Patriotic July 4th red linen pillow cover featuring stars and Let Freedom Ring text - 45*45cm Linen Single Sided Without Core / Red Let Freedom Ring Letter Style (DYM290-5（3）)
Independence Day linen pillow cover with blue stars and Because of the Brave print - 45*45cm Linen Single Sided Without Core / Off-white Because Of The Brave Style (DYM290-5(4))
American Independence Day Star Print Linen Pillow Cover Decorative Patriotic Cushion Case For Sofa Home Office Decor
$1.21
Mix MOQ : 2
Modern Floral Geometric Polyester Pillowcase Digital Print Cushion Cover For Sofa Living Room Decor Square Without Insert
Modern Floral Geometric Polyester Pillowcase Digital Print Cushion Cover For Sofa Living Room Decor Square Without Insert
like
Find Similar
Detailed macro view of retro floral print on square cream cushion cover fabric - Warm Floral Bird Pattern (DRD309-1) / 18x18 Inch
Detailed view of the square pillow cover with vintage orange floral and butterfly patterns - Vintage Floral Butterfly (DRD309-2) / 18x18 Inch
Modern floral cushion cover in bright turquoise with black and blue decorative patterns - Modern Cyan Blue Floral (DRD309-3) / 18x18 Inch
Teal square cushion cover with white and blue bohemian mandala flower patterns - Bohemian Mandala (DRD309-4) / 18x18 Inch
+15
Modern Floral Geometric Polyester Pillowcase Digital Print Cushion Cover For Sofa Living Room Decor Square Without Insert
-5%
$1.20
Mix MOQ : 2
American Pastoral Style Floral Pattern Pillowcase Decorative Soft Short Plush Throw Pillow Cover For Living Room Sofa Home Decor
American Pastoral Style Floral Pattern Pillowcase Decorative Soft Short Plush Throw Pillow Cover For Living Room Sofa Home Decor
like
Find Similar
Modern floral cushion cover featuring blue swallows and beige flowers on cream fabric - 45*45cm (No Insert) / Blue Swallow Decorative Pattern (TQR76-1)
Square beige pillow cover with red and blue symmetric floral pattern on sofa - 45*45cm (No Insert) / Red Blue Green Geometric Floral (TQR76-2)
Floral luxury cushion cover with orange flowers on waffle fabric for garden decor - 45*45cm (No Insert) / Orange Yellow Beige Flowers (TQR76-3)
Bohemian cream throw pillow case with green monstera leaves pattern on fabric sofa - 45*45cm (No Insert) / Monstera Leaf Pattern (TQR76-4)
+31
American Pastoral Style Floral Pattern Pillowcase Decorative Soft Short Plush Throw Pillow Cover For Living Room Sofa Home Decor
$1.30
Mix MOQ : 2
3D Rose Embossed Flannel Blanket Vintage Baroque Floral Pattern Soft Warm Polyester Throw For Sofa Bed Home Decor
3D Rose Embossed Flannel Blanket Vintage Baroque Floral Pattern Soft Warm Polyester Throw For Sofa Bed Home Decor
like
Find Similar
3D embossed pink rose flannel blanket with floral patterns and baroque scroll ornaments - 100x150 Style
3D Rose Embossed Flannel Blanket Vintage Baroque Floral Pattern Soft Warm Polyester Throw For Sofa Bed Home Decor
$4.76
No MOQ
Modern Minimalist Linen Cushion Cover Bohemian Geometric Mandala Pattern Ethnic Style Printed Pillowcase For Sofa Home Office Decor
Modern Minimalist Linen Cushion Cover Bohemian Geometric Mandala Pattern Ethnic Style Printed Pillowcase For Sofa Home Office Decor
like
Find Similar
Detailed texture of geometric mandala pattern on square linen decorative pillowcase - Mandala Print (YMD160-1)
Close-up of geometric mandala pattern on square linen cushion cover with blue and gold tones - Blue Gold Mandala (YMD160-2)
Modern geometric linen cushion cover featuring ethnic tribal sea star and fish patterns - Ethnic Marine Style (YMD160-3)
Detail of bohemian geometric pattern on square linen pillowcase with ethnic design - Vintage Bohemian (YMD160-4)
+18
Modern Minimalist Linen Cushion Cover Bohemian Geometric Mandala Pattern Ethnic Style Printed Pillowcase For Sofa Home Office Decor
-4%
$1.34
Mix MOQ : 2
Luxury Ripple Texture Refillable Soap Lotion Dispenser Bottle Press Pump Liquid Container For Bathroom Kitchen Sink
Luxury Ripple Texture Refillable Soap Lotion Dispenser Bottle Press Pump Liquid Container For Bathroom Kitchen Sink
like
Find Similar
Large transparent dispenser bottle with water ripple design and silver pump, 175mm height - 400ml-Transparent Round
Large grey transparent lotion bottle with water ripple texture and dimensions 175x75mm - 400ml-Transparent Gray Round
Large square water ripple lotion bottle with silver pump and transparent glass finish - 400ml-Transparent Square
Large transparent grey square lotion bottle with ripple texture and silver pump head - 400ml-Transparent Gray Square
Luxury Ripple Texture Refillable Soap Lotion Dispenser Bottle Press Pump Liquid Container For Bathroom Kitchen Sink
$2.19-2.56
No MOQ
 · 
25 sold recently
Bohemian Woven Throw Blanket Cotton Jacquard Tassels Sofa Cover Picnic Camping Decorative Ethnic Mystical
Bohemian Woven Throw Blanket Cotton Jacquard Tassels Sofa Cover Picnic Camping Decorative Ethnic Mystical
like
Find Similar
Bohemian orange woven camping blanket with ethnic geometric patterns and tassel edges - XT2022-4 Orange Geometric Ethnic
Bohemian cotton woven blanket with abstract eye patterns and fringe on white sofa - XT07-12 Abstract Eye Geometric
Bohemian cotton woven camping blanket with floral moon patterns and tassels - XT01-2 Black Moon Phase Floral
Bohemian sunflower woven blanket with tassels for camping or sofa decor in blue and brown - XT07-1 Starry Night Sunflower
+29
Bohemian Woven Throw Blanket Cotton Jacquard Tassels Sofa Cover Picnic Camping Decorative Ethnic Mystical
-4%
$13.69-15.06
No MOQ
 · 
105 views
Modern Geometric Abstract Peach Skin Pillow Cover Gold White Black Patterned Decorative Cushion Case For Sofa Home Decor
Modern Geometric Abstract Peach Skin Pillow Cover Gold White Black Patterned Decorative Cushion Case For Sofa Home Decor
like
Find Similar
Detail of modern geometric pillowcase with black white stripes and golden glitter texture - Black White Gold Geometric Chevron (DRD205-1)
Detail of white peach skin pillowcase with golden 3D geometric cube glitter patterns - Gold White Geometric Cubes (DRD205-2)
Detailed view of modern geometric pattern on a peach skin pillowcase with gold and black shapes - Black White Gold Polka Dot Geometric (DRD205-3)
Macro shot of geometric peach skin pillowcase with black and gold abstract patterns - Black Gold White Block Geometric (DRD205-4)
+12
Modern Geometric Abstract Peach Skin Pillow Cover Gold White Black Patterned Decorative Cushion Case For Sofa Home Decor
-5%
$1.20
Mix MOQ : 2
Minimalist Corduroy Pillowcase Decorative Square Throw Pillow Cover Corn Strip Texture Soft Cushion Case For Sofa Decor
Minimalist Corduroy Pillowcase Decorative Square Throw Pillow Cover Corn Strip Texture Soft Cushion Case For Sofa Decor
like
Find Similar
Beige corduroy square pillow cover with textured 3D corn stripes on a leather chair - 45x45cm (With 500g Core) / Light Gray
Soft pink corduroy striped pillow cover on brown leather chair for cozy home decor - 45x45cm (With 500g Core) / Light Purple
Soft bright blue corduroy pillow cover with striped texture on a leather chair - 45x45cm (With 500g Core) / Sky Blue
Blue corduroy pillow cover with 3D striped texture on a brown leather chair - 45x45cm (With 500g Core) / Denim Blue
+176
Minimalist Corduroy Pillowcase Decorative Square Throw Pillow Cover Corn Strip Texture Soft Cushion Case For Sofa Decor
-5%
$2.19-5.20
Mix MOQ : 2
Blue Butterfly Floral Print Lumbar Pillowcase Soft Short Plush Decorative Cushion Cover For Sofa Living Room Home Decor
Blue Butterfly Floral Print Lumbar Pillowcase Soft Short Plush Decorative Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Rectangular pillowcase featuring blue floral prints, butterflies, and a white center blank - Blue Hydrangea Butterfly Style (CDR348-5) / 30*50cm Short Plush Single Sided Without Core
Rectangular pillowcase featuring blue watercolor floral pattern on a white fabric background - Blue Watercolor Floral Wreath Style (CDR348-6) / 30*50cm Short Plush Single Sided Without Core
Blue butterfly floral lumbar pillow cover with watercolor hydrangea on white background - Blue Hydrangea Herbal Style (CDR348-1) / 30*50cm Short Plush Single Sided Without Core
Blue butterfly floral print lumbar pillowcase in white watercolor art style - Blue Floral Cluster Butterfly Style (CDR348-2) / 30*50cm Short Plush Single Sided Without Core
+2
NewBlue Butterfly Floral Print Lumbar Pillowcase Soft Short Plush Decorative Cushion Cover For Sofa Living Room Home Decor
$1.30
Mix MOQ : 2
Nordic Style Abstract Illustration Pillowcase Polyester Square Cushion Cover Modern Minimalist Decorative Case For Sofa Bed
Nordic Style Abstract Illustration Pillowcase Polyester Square Cushion Cover Modern Minimalist Decorative Case For Sofa Bed
like
Find Similar
Detail of Nordic blue square pillowcase featuring a crescent moon and artistic night window scene - 18x18 Inch / Night Starry Sky (DRD261-1)
Detail of Nordic minimalist blue pillowcase with floral vase art on smooth fabric - 18x18 Inch / Simple Vase Flowers (DRD261-2)
Detailed view of Nordic abstract landscape cushion cover featuring minimalist blue mountain art - 18x18 Inch / Abstract Mountains (DRD261-3)
Detail of blue and beige geometric pillow cover with abstract arch and palm leaf patterns - 18x18 Inch / Geometric Architecture (DRD261-4)
+5
NewNordic Style Abstract Illustration Pillowcase Polyester Square Cushion Cover Modern Minimalist Decorative Case For Sofa Bed
-5%
$1.20
Mix MOQ : 2
Tie-Dye Plush Decorative Throw Pillow Case Soft Rainbow Square Cushion Cover For Sofa Living Room Bedroom Decor
Tie-Dye Plush Decorative Throw Pillow Case Soft Rainbow Square Cushion Cover For Sofa Living Room Bedroom Decor
like
Find Similar
Plush faux fur square pillow cover featuring vibrant rainbow tie-dye candy color patterns - 45*45cm (With 500g Brushed Fabric High Elastic Core) / Metallic Pink
Tie-dye plush pillow cover in purple and pink tones with soft faux rabbit fur texture - 45*45cm (With 500g Brushed Fabric High Elastic Core) / Dreamy Purple
+4
Tie-Dye Plush Decorative Throw Pillow Case Soft Rainbow Square Cushion Cover For Sofa Living Room Bedroom Decor
$2.31-5.04
Mix MOQ : 2
Exfoliating Shower Bath Set Including Body Scrubbing Gloves And Long Back Scrubber And Soft Mesh Bath Ball
Exfoliating Shower Bath Set Including Body Scrubbing Gloves And Long Back Scrubber And Soft Mesh Bath Ball
like
Find Similar
Beige and pink exfoliating bath set with back scrubber, loofah sponge, and glove - 3-Piece Set (Mitt + Back Scrubber + Bath Ball) / Light Pink
3-piece exfoliating bath set with back scrubber, loofah sponge, and glove in light green - 3-Piece Set (Mitt + Back Scrubber + Bath Ball) / Mustard Green
Purple 3-piece bath set including back scrubber, shower ball, and exfoliating mitt - 3-Piece Set (Mitt + Back Scrubber + Bath Ball) / Purple Coffee
Pink exfoliating bath set with textured scrubbing glove and long back scrubber strap - 2-Piece Set (Mitt + Back Scrubber) / Light Pink
+12
Exfoliating Shower Bath Set Including Body Scrubbing Gloves And Long Back Scrubber And Soft Mesh Bath Ball
$0.45-1.12
Mix MOQ : 2
 · 
89 views
Nordic Minimalist Geometric Pillowcase Polyester Peach Skin Decorative Cushion Cover For Sofa Couch Home Bedroom Decor
Nordic Minimalist Geometric Pillowcase Polyester Peach Skin Decorative Cushion Cover For Sofa Couch Home Bedroom Decor
like
Find Similar
Minimalist geometric square cushion cover with tribal patterns in caramel orange and slate blue - Bohemian Ethnic Geometric Style (DRD90-1)
Nordic minimalist square cushion cover with navy blue geometric diamond pattern in cream white - Ethnic Dark Blue Diamond Style (DRD90-2)
Square pillow cover with colorful geometric tribal patterns on soft canvas fabric - Tribal Geometric Print Style (DRD90-3)
Modern square taupe cushion cover with white arrow patterns and linen-like texture - Simple Taupe Arrow Line Style (DRD90-4)
+6
NewNordic Minimalist Geometric Pillowcase Polyester Peach Skin Decorative Cushion Cover For Sofa Couch Home Bedroom Decor
$1.24
Mix MOQ : 2
Classical Plush Geometric Hexagon Cushion Cover Quilted Embroidery Solid Color Sofa Pillowcase For Living Room Home Decor
Classical Plush Geometric Hexagon Cushion Cover Quilted Embroidery Solid Color Sofa Pillowcase For Living Room Home Decor
like
Find Similar
Set of two red plush cushion covers with geometric hexagonal pattern for sofa decor - 45x45cm With Insert / Rust red
White plush cushion cover featuring geometric hexagonal textures in square and lumbar sizes - 45x45cm With Insert / White
Plush light pink cushion covers with 3D geometric hexagon patterns for sofa decor - 45x45cm With Insert / Apricot
Solid bright yellow plush cushion cover with 3D geometric honeycomb embossed texture - 45x45cm With Insert / Turmeric
+56
Classical Plush Geometric Hexagon Cushion Cover Quilted Embroidery Solid Color Sofa Pillowcase For Living Room Home Decor
-5%
$2.33-6.44
Mix MOQ : 2
Easter Peach Skin Velvet Pillowcase Vintage Rabbit Easter Egg Printed Square Cushion Cover For Sofa Living Room Home Decor
Easter Peach Skin Velvet Pillowcase Vintage Rabbit Easter Egg Printed Square Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Happy Easter peach skin pillowcase with watercolor bunny eggs on yellow plaid background - 45x45cm / Egg Cart Style (CDR115-1)
Happy Easter peach skin pillow cover featuring vintage bunny eggs and yellow checkered pattern - 45x45cm / Egg Wreath Style (CDR115-2)
Easter peach skin throw pillow cover with vintage rabbit and colorful eggs print - 45x45cm / Bunny and Egg Style (CDR115-3)
Easter peach skin pillowcase with watercolor bunny egg basket vintage print decor - 45x45cm / Easter Egg Basket Style (CDR115-4)
Easter Peach Skin Velvet Pillowcase Vintage Rabbit Easter Egg Printed Square Cushion Cover For Sofa Living Room Home Decor
$1.30
Mix MOQ : 2
Modern Nordic Style Polyester Pillow Case Watercolor Floral Vintage Truck Bicycle Pattern Decorative Cushion Cover For Sofa Living Room Home Decor
Modern Nordic Style Polyester Pillow Case Watercolor Floral Vintage Truck Bicycle Pattern Decorative Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Floral vintage truck decorative pillowcase with pink roses in a rustic farmhouse style - 45x45cm / Light Blue Vintage Truck With Pink Flowers (YMD261-1)
Floral Home Sweet Home cotton linen square pillow cover with blue stripes and wreath - 45x45cm / Floral Wreath With Home Sweet Home Text (YMD261-2)
Floral bicycle pillow cover in mint green and beige cotton linen with bloom text - 45x45cm / Blue Bicycle With Blooming Flowers (YMD261-3)
Spring flowers pillow cover with floral watercolor design on linen-style fabric - 45x45cm / Glass Jar Flower Arrangement With Spring Flowers Text (YMD261-4)
Modern Nordic Style Polyester Pillow Case Watercolor Floral Vintage Truck Bicycle Pattern Decorative Cushion Cover For Sofa Living Room Home Decor
-5%
$1.31
Mix MOQ : 2
Summer Ocean Coastal Decor Pillowcase Cover Starfish Nautical Anchor Letter Print Square Cushion Case For Sofa Home Living Room
Summer Ocean Coastal Decor Pillowcase Cover Starfish Nautical Anchor Letter Print Square Cushion Case For Sofa Home Living Room
like
Find Similar
Nautical starfish and shell pillow cover with Beach is my Happy Place text - Beach Rules Blue Wood Grain Style (YMD342-1)
Marine starfish pattern pillow cover in turquoise textured fabric for summer decor - Starfish Shell Artistic Font Style (YMD342-2)
Blue nautical pillow cover featuring a vintage anchor print on cotton linen fabric - Anchor Ribbon Nautical Style (YMD342-3)
Blue ocean beach rules square cushion cover with starfish and seashell patterns - Aligned Starfish Pattern Style (YMD342-4)
Summer Ocean Coastal Decor Pillowcase Cover Starfish Nautical Anchor Letter Print Square Cushion Case For Sofa Home Living Room
$1.38
Mix MOQ : 2
Imitation Satin Eye Mask Pillowcase And Scrunchie Satin Sleep Accessory Gift For Women Smooth Comfortable Travel Bedding
Imitation Satin Eye Mask Pillowcase And Scrunchie Satin Sleep Accessory Gift For Women Smooth Comfortable Travel Bedding
like
Find Similar
Champagne silk sleep set with eye mask, pillowcase and scrunchie in elegant gift box - Champagne Gift Box Set (Eye Mask + Pillowcase + Scrunchie)
Three-piece silk sleep set with eye mask and hair scrunchie in a luxury gift box - Navy Blue Gift Box Set (Eye Mask + Pillowcase + Scrunchie)
Pink satin sleep set including an eye mask, pillowcase, and scrunchie in a gift box - Fresh Pink Gift Box Set (Eye Mask + Pillowcase + Scrunchie)
Pink silk sleep set detail showing eye mask and scrunchie in an elegant gift box - Skin Pink Gift Box Set (Eye Mask + Pillowcase + Scrunchie)
+13
Imitation Satin Eye Mask Pillowcase And Scrunchie Satin Sleep Accessory Gift For Women Smooth Comfortable Travel Bedding
-5%
$0.55-7.34
No MOQ
 · 
14 sold recently
Rustic Lavender Floral Linen Cushion Cover Vintage Farmhouse Style Throw Pillowcase Purple Botanical Print Home Decor Square Case
Rustic Lavender Floral Linen Cushion Cover Vintage Farmhouse Style Throw Pillowcase Purple Botanical Print Home Decor Square Case
like
Find Similar
Lavender print pillow cover in purple floral linen with Spring is coming text print - 45x45cm / Lavender in White Kettle (YMD327-1)
Rustic lavender basket print cushion cover in linen fabric for sofa decor - 45x45cm / Lavender Basket (YMD327-2)
Square lavender pillow cover with Spring Market print on cream linen for sofa decor - 45x45cm / Lavender Potted Plant (YMD327-3)
Lavender flower pot print on linen plaid pillowcase with purple watercolor design - 45x45cm / Plaid Lavender Pot (YMD327-4)
+12
Rustic Lavender Floral Linen Cushion Cover Vintage Farmhouse Style Throw Pillowcase Purple Botanical Print Home Decor Square Case
-5%
$1.31
Mix MOQ : 2
Modern Geometric Pink Marble Throw Pillow Case Rose Gold Polyester Decorative Cushion Cover For Sofa Bedding Home Decor
Modern Geometric Pink Marble Throw Pillow Case Rose Gold Polyester Decorative Cushion Cover For Sofa Bedding Home Decor
like
Find Similar
Detail of pink marble geometric cushion cover with gold polka dots and Christmas greeting - Christmas Holiday Pattern (DRD163-1) / 18x18 Inch
Detailed close-up of pink square pillow cover featuring elegant gold and black heart patterns - Pink Heart Pattern (DRD163-2) / 18x18 Inch
Detailed view of rose gold chevron pattern on pink marble texture cushion cover - Rose Gold Wave Pattern (DRD163-3) / 18x18 Inch
Macro detail of pink marble cushion cover with metallic rose gold cactus patterns - Marble Cactus Pattern (DRD163-4) / 18x18 Inch
+36
Modern Geometric Pink Marble Throw Pillow Case Rose Gold Polyester Decorative Cushion Cover For Sofa Bedding Home Decor
-5%
$1.20
Mix MOQ : 2
Tropical Cactus Plant Pattern Throw Pillow Case Decorative Square Peach Skin Polyester Cushion Cover For Sofa Office Home Decor
Tropical Cactus Plant Pattern Throw Pillow Case Decorative Square Peach Skin Polyester Cushion Cover For Sofa Office Home Decor
like
Find Similar
Square pillowcase featuring artistic watercolor cactus print on cotton linen fabric - Cactus Style 1 (DRD98-1)
Detail view of tropical cactus watercolor print on soft peach skin pillow cover - Cactus Style 2 (DRD98-2)
Square white linen cushion cover featuring a vibrant green agave succulent print - Cactus Style 3 (DRD98-3)
Tropical succulent pattern cushion cover with agave print and geometric diamond accents - Cactus Style 4 (DRD98-4)
+32
NewTropical Cactus Plant Pattern Throw Pillow Case Decorative Square Peach Skin Polyester Cushion Cover For Sofa Office Home Decor
-5%
$1.20
Mix MOQ : 2
Cartoon Universe Space Planets Sun Flannel Throw Blanket Soft Polyester Nap Blanket For Bed Sofa Couch Home Decor
Cartoon Universe Space Planets Sun Flannel Throw Blanket Soft Polyester Nap Blanket For Bed Sofa Couch Home Decor
like
Find Similar
Cartoon space flannel blanket with sun and planets draped on a cozy grey sofa - 100x150cm
Cartoon Universe Space Planets Sun Flannel Throw Blanket Soft Polyester Nap Blanket For Bed Sofa Couch Home Decor
-5%
$4.52
No MOQ
Faux Fur Throw Blanket Soft Rabbit Plush Thickened Double Layer Wave Texture For Sofa Bed Office Nap Modern Minimalist
Faux Fur Throw Blanket Soft Rabbit Plush Thickened Double Layer Wave Texture For Sofa Bed Office Nap Modern Minimalist
like
Find Similar
Detailed texture of luxurious light grey faux fur blanket draped over a modern chair - Gradient Grey / 100*160cm (1.2KG)
Plush cream faux fur blanket with wavy 3D texture on a cozy home sofa chair - Off White / 100*160cm (1.2KG)
Macro view of plush faux rabbit fur blanket with luxury 3D striped texture and soft pile - Coffee / 100*160cm (1.2KG)
Detailed texture of thick sage green faux rabbit fur blanket on a cozy sofa - Green / 100*160cm (1.2KG)
+59
Faux Fur Throw Blanket Soft Rabbit Plush Thickened Double Layer Wave Texture For Sofa Bed Office Nap Modern Minimalist
-5%
$5.42-34.44
No MOQ
 · 
177 views
Nordic Dandelion Print Pillow Case Imitation Silk Satin Decorative Cushion Cover For Sofa Bedroom Living Room White Square Home Decor
Nordic Dandelion Print Pillow Case Imitation Silk Satin Decorative Cushion Cover For Sofa Bedroom Living Room White Square Home Decor
like
Find Similar
Nordic white satin pillow cover with black dandelion print and silky finish - 45*45cm (With 400g Non-woven Insert) / Style 1
Nordic dandelion pattern cushion cover in white faux silk fabric with elegant floral print - 45*45cm (With 400g Non-woven Insert) / Style 2
+4
NewNordic Dandelion Print Pillow Case Imitation Silk Satin Decorative Cushion Cover For Sofa Bedroom Living Room White Square Home Decor
$2.16-4.76
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in bedding & bathroom

homecolorholderstoragestylepolyesterdoubleheaddesignheart
hangingplastictravelshapecleaningsimplekidslayerwhitedaily

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access