Everful

Wholesale bedding & bathroom

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Bedding & Bathroom

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Boho Woven Table Runner With Tassels Striped Polyester Table Decor For Dining Room Kitchen Wedding Party Christmas Tablecloth
Boho Woven Table Runner With Tassels Striped Polyester Table Decor For Dining Room Kitchen Wedding Party Christmas Tablecloth
like
Find Similar
Bohemian striped table runner with tassels on a wooden surface with home decor - 30*45cm / Deep Red Tassel
Bohemian table runner with red stripes, white crochet details and tassel fringe on wood table - 30*45cm / Bright Red Tassel
Bohemian style linen table runner with geometric patterns and fringe tassels - 30*45cm / Rhombus Weave Tassel
Modern crochet table runner with cream and orange color blocking and fringe tassels - 30*45cm / Orange Cross Tassel
+146
Boho Woven Table Runner With Tassels Striped Polyester Table Decor For Dining Room Kitchen Wedding Party Christmas Tablecloth
-4%
$0.80-5.35
No MOQ
Bohemian Polyester Jacquard Table Runner With Tassels Geometric Floral Table Decor For Dining Room Home Coffee Table Bed Runner
Bohemian Polyester Jacquard Table Runner With Tassels Geometric Floral Table Decor For Dining Room Home Coffee Table Bed Runner
like
Find Similar
Bohemian jacquard table runner with black geometric patterns and elegant fringe tassels - 35*140cm
Bohemian jacquard table runner with yellow floral patterns and cream tassels on wood - 35*140cm / Ginger Yellow Vintage Floral
+18
Bohemian Polyester Jacquard Table Runner With Tassels Geometric Floral Table Decor For Dining Room Home Coffee Table Bed Runner
-5%
$2.74-15.33
No MOQ
Boho Geometric Diamond Fret Pattern Cotton Curtain With Tassels American Country Semi Blackout Door Window Curtain For Kitchen Living Room
Boho Geometric Diamond Fret Pattern Cotton Curtain With Tassels American Country Semi Blackout Door Window Curtain For Kitchen Living Room
like
Find Similar
Bohemian style striped knit curtain with diamond geometric patterns and white fringe tassels - 132*160 / Orange Fret Pattern Rod Pocket
Green and white geometric jacquard curtain with elegant white fringe tassels for home decor - 132*220 / Green Fret Pattern Grommet
Yellow blackout curtain with geometric diamond jacquard and white cotton tassels on edges - 132*220 / Yellow Fret Pattern Rod Pocket
Navy blue and white diamond geometric pattern curtain with fringe for rustic home decor - 132*160 / Navy Fret Pattern Rod Pocket
+176
Boho Geometric Diamond Fret Pattern Cotton Curtain With Tassels American Country Semi Blackout Door Window Curtain For Kitchen Living Room
-5%
$4.93-18.34
No MOQ
Ramadan Moon Lantern Decorative Pillowcase Polyester Linen Blend Cushion Cover Home Living Room Sofa Decor
Ramadan Moon Lantern Decorative Pillowcase Polyester Linen Blend Cushion Cover Home Living Room Sofa Decor
like
Find Similar
Square Ramadan cushion cover featuring golden crescent moon and lantern ethnic print - 45x45cm(Case Only) / Moon & Lantern Style (YMZ25-1)
Ethnic square pillow cover with golden lantern print on a warm indoor sofa setting - 45x45cm(Case Only) / Twin Lanterns Style (YMZ25-2)
Square pillow cover with golden lantern print for Middle Eastern festive home decoration - 45x45cm(Case Only) / Retro Lantern Style (YMZ25-3)
Eid Moon Lantern decorative square pillow cover with golden crescent print for sofa - 45x45cm(Case Only) / Crescent Moon Style (YMZ25-4)
Ramadan Moon Lantern Decorative Pillowcase Polyester Linen Blend Cushion Cover Home Living Room Sofa Decor
$1.24
Mix MOQ : 2
3D Funny Christmas Snowman Toilet Lid Sticker Creative Hole Effect PVC Removable Wall Decal For Bathroom Holiday Decor
3D Funny Christmas Snowman Toilet Lid Sticker Creative Hole Effect PVC Removable Wall Decal For Bathroom Holiday Decor
like
Find Similar
Detail of 3D Christmas snowman wall sticker showing product dimensions and application size - 24*24cm (HY-M472)
3D Funny Christmas Snowman Toilet Lid Sticker Creative Hole Effect PVC Removable Wall Decal For Bathroom Holiday Decor
$0.58
No MOQ
Christmas Reindeer Santa Claus Toilet Seat Stickers Removable PVC Self Adhesive Wall Decals For Home Bathroom Decor
Christmas Reindeer Santa Claus Toilet Seat Stickers Removable PVC Self Adhesive Wall Decals For Home Bathroom Decor
like
Find Similar
Christmas reindeer sleigh wall decal layout dimensions and sheet size comparison detail - 24*24cm (HY-M489)
Christmas Reindeer Santa Claus Toilet Seat Stickers Removable PVC Self Adhesive Wall Decals For Home Bathroom Decor
$0.58
No MOQ
William Morris Style Floral Cotton Linen Tablecloth Rectangular Vintage Table Cover For Dining Living Room Kitchen Home Decor
William Morris Style Floral Cotton Linen Tablecloth Rectangular Vintage Table Cover For Dining Living Room Kitchen Home Decor
like
Find Similar
Vintage Provencal floral tablecloth with matching cushion covers in yellow cotton linen - 60*60cm / Yellow Provence Grass
Floral cotton linen tablecloth with red flowers and blue leaves in vintage style - 60*60cm / Red Provence Grass
+25
William Morris Style Floral Cotton Linen Tablecloth Rectangular Vintage Table Cover For Dining Living Room Kitchen Home Decor
-5%
$2.19-15.61
No MOQ
Christmas Linen Embroidery Pillowcase Merry Christmas Santa Claus Snowman Throw Pillow Cover For Home Sofa Party Decor
Christmas Linen Embroidery Pillowcase Merry Christmas Santa Claus Snowman Throw Pillow Cover For Home Sofa Party Decor
like
Find Similar
Linen Christmas pillowcase with Santa Claus embroidery and red striped edges - Santa Claus (Santa Pillowcase)
Christmas snowman embroidered linen pillowcase with green piping and 46cm size mark - Snowman Pillowcase
Christmas Linen Embroidery Pillowcase Merry Christmas Santa Claus Snowman Throw Pillow Cover For Home Sofa Party Decor
-4%
$3.54
Mix MOQ : 2
Spanish Greeting Lettering Toilet Sticker Waterproof PVC Bathroom Wall Decal Humorous Home Decor Removable Art Sign Decal
Spanish Greeting Lettering Toilet Sticker Waterproof PVC Bathroom Wall Decal Humorous Home Decor Removable Art Sign Decal
like
Find Similar
Spanish Hola Hermoso decorative toilet wall sticker in black artistic script 18x30cm - 18x30cm
Spanish Greeting Lettering Toilet Sticker Waterproof PVC Bathroom Wall Decal Humorous Home Decor Removable Art Sign Decal
$0.86
Mix MOQ : 2
Skull Decorative Pillow Case Linen Gothic Cushion Cover Halloween Home Decor For Sofa Couch Square
Skull Decorative Pillow Case Linen Gothic Cushion Cover Halloween Home Decor For Sofa Couch Square
like
Find Similar
Linen skull pillowcase with watercolor red roses and floral wreath on white background - Watercolor Rose Skull Style (1)
Skull and red roses printed linen throw pillow cover with artistic floral pattern - Black Background Red Rose Skull Style (2)
Industrial skull design linen pillow cover with crossbones and red splash accents - Industrial Rock Skull Style (3)
Linen skull pillow cover with pirate anchor and flag print on white background - Pirate Anchor Skull Style (4)
+5
Skull Decorative Pillow Case Linen Gothic Cushion Cover Halloween Home Decor For Sofa Couch Square
-4%
$1.18
No MOQ
Artistic Square Cushion Cover Linen Pillowcase Vintage Bookshelf Print Decorative Throw Pillow Case For Sofa
Artistic Square Cushion Cover Linen Pillowcase Vintage Bookshelf Print Decorative Throw Pillow Case For Sofa
like
Find Similar
Detailed texture of linen cushion cover featuring watercolor bookshelf and cats pattern - Cat Bookshelf Style
Watercolor library and fantasy garden oil painting linen pillow cover for home decor - Fantasy Garden Bookshelf Style
Close-up of vintage library bookshelf pillow cover on a textured grey sofa - Vintage Fantasy Bookshelf Style
Detailed texture of watercolor library pillow cover on a gray sofa in a home setting - Hummingbird & Floral Bookshelf Style
+12
Artistic Square Cushion Cover Linen Pillowcase Vintage Bookshelf Print Decorative Throw Pillow Case For Sofa
-4%
$1.18
No MOQ
Cartoon Dinosaur Unicorn Castle Wall Tapestry Kids Bedroom Decor Polyester Fabric Backdrop For Living Room Nursery Wall Hanging
Cartoon Dinosaur Unicorn Castle Wall Tapestry Kids Bedroom Decor Polyester Fabric Backdrop For Living Room Nursery Wall Hanging
like
Find Similar
Detail of colorful cartoon dinosaur wall tapestry in a modern living room setting - 100x70cm
Detailed view of colorful cartoon dinosaur tapestry on a modern living room wall - 100x70cm / Prehistoric Dinosaur World Style
Detail of cartoon dinosaur wall tapestry showing vibrant prehistoric scenes over a sofa - Style 3 / 100X70
Detailed view of cartoon dinosaur tapestry with volcano and lush green forest design - Style 4 / 100X70
+51
Cartoon Dinosaur Unicorn Castle Wall Tapestry Kids Bedroom Decor Polyester Fabric Backdrop For Living Room Nursery Wall Hanging
$2.59-10.37
No MOQ
Free Shipping
Autumn Pumpkin Thanksgiving Throw Pillow Cover Linen Decorative Cushion Case For Couch Sofa Home Decor Give Thanks
Autumn Pumpkin Thanksgiving Throw Pillow Cover Linen Decorative Cushion Case For Couch Sofa Home Decor Give Thanks
like
Find Similar
Linen pillow cover with light blue watercolor pumpkin design on grey striped background - Single Sided Linen (No Insert) / Light Blue Pumpkin Style (DYM360-1)
Linen autumn pumpkin pillowcase with black typography text on a white background - Single Sided Linen (No Insert) / Autumn Pumpkins Text Style (DYM360-2)
Linen pumpkin pillow cover with black Give Thanks lettering and white maple leaf design - Single Sided Linen (No Insert) / Give Thanks Text Style (DYM360-3)
Autumn watercolor pumpkin throw pillow cover with linen texture for sofa decor - Single Sided Linen (No Insert) / Multi-colored Pumpkin Style (DYM360-4)
Autumn Pumpkin Thanksgiving Throw Pillow Cover Linen Decorative Cushion Case For Couch Sofa Home Decor Give Thanks
$1.30
Mix MOQ : 2
Luminous Dinosaur Toilet Sticker Stegosaurus Watercolor Pattern Fluorescent Waterproof PVC Decal For Bathroom Home Decor
Luminous Dinosaur Toilet Sticker Stegosaurus Watercolor Pattern Fluorescent Waterproof PVC Decal For Bathroom Home Decor
like
Find Similar
Glow-in-the-dark stegosaurus wall sticker in a bathroom setting with neon green light - 20*30cm / Green
Luminous stegosaurus dinosaur wall sticker glowing in dark on a white toilet lid - 20*30cm / Blue
Luminous Dinosaur Toilet Sticker Stegosaurus Watercolor Pattern Fluorescent Waterproof PVC Decal For Bathroom Home Decor
$1.96
No MOQ
Modern Minimalist White Lace Curtain Polyester Cotton Blend Semi Blackout Window Treatment French Style Curtains For Bedroom Living Room
Modern Minimalist White Lace Curtain Polyester Cotton Blend Semi Blackout Window Treatment French Style Curtains For Bedroom Living Room
like
Find Similar
White minimalist cotton linen curtain with hollow lace edges in a cozy interior setting - 150cmx45cm / White Style (Wide Lace / Rod Pocket)
Minimalist white cotton linen curtain with lace edge for elegant bedroom window decor - 150cmx45cm / White Style (Wide Lace / Hooks)
Cream linen curtains with navy lace trim for a modern minimalist bedroom home decor - 150cmx45cm / Cream/Blue Style (Blue Lace / Rod Pocket)
Modern minimalist cream linen curtain with dark blue lace trim hanging on a wooden chair - 150cmx45cm / Cream/Blue Style (Blue Lace / Hooks)
+28
Modern Minimalist White Lace Curtain Polyester Cotton Blend Semi Blackout Window Treatment French Style Curtains For Bedroom Living Room
-5%
$4.93-14.24
No MOQ
Easter Cushion Cover Linen Cotton Square Rabbit Carrot Print Pillowcase Home Sofa Decor Festive Cute Style
Easter Cushion Cover Linen Cotton Square Rabbit Carrot Print Pillowcase Home Sofa Decor Festive Cute Style
like
Find Similar
Easter bunny cotton linen pillowcase with cute rabbit backside and carrot illustration - Bunny Back View
Easter Bunny and Hunny text print on green linen texture decorative throw pillow cover - Green BUNNY Letter
Green Easter pillow cover with happy carrot design for festive sofa decoration - Green EASTER Letter
Easter rabbit pillow cover with pink flower crown floral linen square sofa cushion case - Bunny with Floral Crown
Easter Cushion Cover Linen Cotton Square Rabbit Carrot Print Pillowcase Home Sofa Decor Festive Cute Style
-4%
$0.96
No MOQ
 · 
20 sold recently
Bohemian Floral Print Cotton Linen Curtains With Tassels Pastoral Style Rod Pocket Grommet Semi Shading Window Decor For Kitchen Bedroom
Bohemian Floral Print Cotton Linen Curtains With Tassels Pastoral Style Rod Pocket Grommet Semi Shading Window Decor For Kitchen Bedroom
like
Find Similar
24 options
Bohemian Floral Print Cotton Linen Curtains With Tassels Pastoral Style Rod Pocket Grommet Semi Shading Window Decor For Kitchen Bedroom
-5%
$9.58-15.33
No MOQ
American Style Rose Printed Cotton Linen Curtains With Blue Lace Border Semi Shading Floral Window Drapes For Kitchen Bedroom
American Style Rose Printed Cotton Linen Curtains With Blue Lace Border Semi Shading Floral Window Drapes For Kitchen Bedroom
like
Find Similar
24 options
American Style Rose Printed Cotton Linen Curtains With Blue Lace Border Semi Shading Floral Window Drapes For Kitchen Bedroom
-5%
$6.84-12.32
No MOQ
Nordic Christmas Tapestry Polyester Wall Hanging Festive Reindeer Santa Claus Snowflake Pattern Holiday Home Background Decor
Nordic Christmas Tapestry Polyester Wall Hanging Festive Reindeer Santa Claus Snowflake Pattern Holiday Home Background Decor
like
Find Similar
Nordic Christmas tapestry in dark blue featuring a snow forest reindeer and starry sky - 95x73 / Blue Night Reindeer (CGT048-15)
Nordic tapestry featuring a green watercolor Christmas tree print on white fabric - 95x73 / Watercolor Green Christmas Tree (CGT048-1)
Nordic watercolor Christmas tree wall tapestry with colorful ornaments on white fabric - 95x73 / Watercolor Christmas Tree with Star (CGT048-2)
Nordic Christmas tree tapestry with watercolor green tree print on white background - 95x73 / Dense Decorated Christmas Tree (CGT048-3)
+80
Nordic Christmas Tapestry Polyester Wall Hanging Festive Reindeer Santa Claus Snowflake Pattern Holiday Home Background Decor
-5%
$2.12-6.69
Mix MOQ : 2
Vintage Washed Cotton Tablecloth With Ruffled Edge Solid Color Rectangular Round Table Cover For Home Dining Kitchen Decor
Vintage Washed Cotton Tablecloth With Ruffled Edge Solid Color Rectangular Round Table Cover For Home Dining Kitchen Decor
like
Find Similar
Detail of caramel ruffled table cloth showing high-quality cotton fabric texture - Orange Washed Cotton Ruffle / 140*220cm
Mustard yellow cotton linen tablecloth with beige ruffled edges for round or long tables - Yellow Washed Cotton Ruffle / 140*220cm
Elegant cream ruffled edge cotton linen tablecloth for rectangular and round tables - White Washed Cotton Ruffles / 140*220cm
Minimalist grey washed cotton tablecloth with ruffled beige edges for round tables - Gray Washed Cotton Ruffle / 140*220cm
+40
Vintage Washed Cotton Tablecloth With Ruffled Edge Solid Color Rectangular Round Table Cover For Home Dining Kitchen Decor
-5%
$7.12-20.53
No MOQ
Christmas Buffalo Plaid Tablecloth Rectangular Red Black Black White Checkered Table Cover Holiday Home Dining Party Decor
Christmas Buffalo Plaid Tablecloth Rectangular Red Black Black White Checkered Table Cover Holiday Home Dining Party Decor
like
Find Similar
Red and black buffalo plaid Christmas tablecloth displayed on a white dining table set - Red & Black Plaid
Classic black and white checkered rectangular tablecloth for Nordic home dining decor - White & Black Plaid
Christmas Buffalo Plaid Tablecloth Rectangular Red Black Black White Checkered Table Cover Holiday Home Dining Party Decor
-5%
$9.03
Mix MOQ : 2
Japanese Minimalist Round Tablecloth With Tassels Linen Texture Striped Printed Decorative Desk Cover For Home Dining
Japanese Minimalist Round Tablecloth With Tassels Linen Texture Striped Printed Decorative Desk Cover For Home Dining
like
Find Similar
Elegant round tablecloth with landscape print and white tassels for home dining decor - 150cm Round / Coffee Bamboo Print
Round beige linen tablecloth with white embroidery and elegant fringe edges for dining - 150cm Round / Coffee Beige Multi-Striped
Green cotton linen round tablecloth with white diamond stripes and beige tassel trim - 150cm Round / Green Beige Multi-Striped
Round light grey checkered cotton linen tablecloth with elegant white tassel fringes - 150cm Round / Gray White Black Line Plaid
+21
Japanese Minimalist Round Tablecloth With Tassels Linen Texture Striped Printed Decorative Desk Cover For Home Dining
-5%
$11.22-12.05
No MOQ
Modern Minimalist Plaid Tablecloth With Tassels Rectangular Synthetic Fiber Checkered Table Cover For Dining Room Kitchen Decor
Modern Minimalist Plaid Tablecloth With Tassels Rectangular Synthetic Fiber Checkered Table Cover For Dining Room Kitchen Decor
like
Find Similar
Nordic minimalist rectangle tablecloth in beige linen with yellow grid and white tassels - 140*220cm / Beige
Red checkered tablecloth with colorful pom-pom tassels on a wooden dining table - 140*220cm / Red
Minimalist grey rectangular tablecloth with yellow plaid pattern and white fringe - 140*220cm / Gray
Elegant dark green plaid tablecloth with gold grid and white tassel trim for dining tables - 140*220cm / Green
+16
Modern Minimalist Plaid Tablecloth With Tassels Rectangular Synthetic Fiber Checkered Table Cover For Dining Room Kitchen Decor
-5%
$7.67-12.59
No MOQ
 · 
11 views
3D Undersea World Porthole Wall Stickers Waterproof PVC Decals Shark Sea Turtle Pufferfish Removable Bathroom Home Art Decor
3D Undersea World Porthole Wall Stickers Waterproof PVC Decals Shark Sea Turtle Pufferfish Removable Bathroom Home Art Decor
like
Find Similar
3D ocean theme submarine porthole wall stickers set with shark and sea turtle designs - Undersea World Submarine Porthole Style (ATW4033-ZC)
3D Undersea World Porthole Wall Stickers Waterproof PVC Decals Shark Sea Turtle Pufferfish Removable Bathroom Home Art Decor
$1.53
Mix MOQ : 2
Linen Cushion Cover Realistic Animal Lion Tiger Print Square Pillowcase For Sofa Home Decor Africa Vintage Style
Linen Cushion Cover Realistic Animal Lion Tiger Print Square Pillowcase For Sofa Home Decor Africa Vintage Style
like
Find Similar
Artistic lion print linen throw pillow cover on a gray sofa for home decoration - Lurking Lion
Detail of linen cushion cover featuring a tiger, palm leaves, and vintage Africa map - Vintage Tiger Map
Detail of linen cushion cover featuring a vintage Africa map with zebra and palm leaf prints - Vintage Zebra Map
Detail of creative linen pillowcase with realistic three lion cubs photography print - Three Lion Cubs
+13
NewLinen Cushion Cover Realistic Animal Lion Tiger Print Square Pillowcase For Sofa Home Decor Africa Vintage Style
-4%
$1.18
No MOQ
Spring Tulip Flower Throw Pillow Cover Linen Square Decorative Cushion Case For Sofa Home Living Room Butterfly Print
Spring Tulip Flower Throw Pillow Cover Linen Square Decorative Cushion Case For Sofa Home Living Room Butterfly Print
like
Find Similar
Spring tulip flower print throw pillow cover with linen texture and ribbon bow design - Square / Tulip Bouquet Style (YMS73-1)
Decorative pillowcase with buffalo plaid bow and BLESS my BLOOMS text on tricolor background - Square / Bless My Blooms Text Style (YMS73-2)
Spring themed square pillow case with yellow and red stripes and black bow print - Square / Spring Has Sprung Color Block Style (YMS73-3)
Linen pillowcase featuring hand-painted red tulips and a butterfly on a white background - Square / Spring Tulips and Butterfly Style (YMS73-4)
Spring Tulip Flower Throw Pillow Cover Linen Square Decorative Cushion Case For Sofa Home Living Room Butterfly Print
$1.30
Mix MOQ : 3
Earth World Map Throw Pillow Cover Linen Square Decorative Cushion Case For Sofa Living Room Home Decor Geography Theme
Earth World Map Throw Pillow Cover Linen Square Decorative Cushion Case For Sofa Living Room Home Decor Geography Theme
like
Find Similar
Linen pillow cover featuring creative green earth and floral print on grey sofa - Eco Vegetation Earth (1)
Macro shot of linen throw pillow cover with a realistic green and blue Earth globe design - Realistic Greenery Earth (2)
Minimalist linen throw pillow cover with 3D Earth print on grey sofa couch - 3D Realistic Earth (3)
Close-up of linen pillowcase featuring a 3D Earth globe print on a grey sofa - HD Relief Style Earth (4)
+12
Earth World Map Throw Pillow Cover Linen Square Decorative Cushion Case For Sofa Living Room Home Decor Geography Theme
-4%
$1.18
No MOQ
Pastoral Gingham Checkered Tablecloth With Ruffled Lace Border Rectangular Synthetic Fiber Table Cover For Home Party Decoration
Pastoral Gingham Checkered Tablecloth With Ruffled Lace Border Rectangular Synthetic Fiber Table Cover For Home Party Decoration
like
Find Similar
Classic gray and white checkered tablecloth in thick cotton linen with lace edges - 90*150CM / Gray
Close-up of yellow and white checkered tablecloth made of durable cotton linen fabric - 90*150CM / Orange
Nordic blue and white gingham cotton linen tablecloth with a soft texture and drape - 90*150CM / Blue
Close-up of purple and white gingham tablecloth featuring premium woven cotton linen fabric - 90*150CM / Purple
+16
Pastoral Gingham Checkered Tablecloth With Ruffled Lace Border Rectangular Synthetic Fiber Table Cover For Home Party Decoration
-5%
$4.00-8.93
No MOQ
Creative Funny Potty Training Target Sticker PVC Hit The Target Slogan Waterproof Bathroom Wall Decal Restroom Decor
Creative Funny Potty Training Target Sticker PVC Hit The Target Slogan Waterproof Bathroom Wall Decal Restroom Decor
like
Find Similar
Close-up of FX59A Hit The Target bathroom wall sticker with red target icon and dimensions - 14*13cm
Creative Funny Potty Training Target Sticker PVC Hit The Target Slogan Waterproof Bathroom Wall Decal Restroom Decor
$0.35
No MOQ
Pastoral Daisy Cotton Jacquard Tablecloth With Fringe Pom-Pom Trim Rectangular Dustproof Desk Cover For Home Dining Kitchen Decor
Pastoral Daisy Cotton Jacquard Tablecloth With Fringe Pom-Pom Trim Rectangular Dustproof Desk Cover For Home Dining Kitchen Decor
like
Find Similar
Pastel yellow daisy floral cotton jacquard tablecloth with elegant fringe tassels for home decor - 40x60 / Daisy Pattern With Tassel
Pastoral yellow daisy floral cotton jacquard tablecloth with scalloped lace edge - 40x60 / Yellow Daisy
Pastel yellow daisy embroidered cotton tablecloth with elegant white pom-pom fringe trim - 40x60 / Yellow Daisy With Pom-Poms
+42
Pastoral Daisy Cotton Jacquard Tablecloth With Fringe Pom-Pom Trim Rectangular Dustproof Desk Cover For Home Dining Kitchen Decor
-5%
$2.19-19.16
No MOQ
Bohemian Geometric Print Tassel Window Curtain Black White Cotton Linen Semi Shading Panel Living Room Bedroom Kitchen
Bohemian Geometric Print Tassel Window Curtain Black White Cotton Linen Semi Shading Panel Living Room Bedroom Kitchen
like
Find Similar
Bohemian black and white geometric print cotton linen kitchen curtains with tassels - 150x100 / Black & White
Bohemian Geometric Print Tassel Window Curtain Black White Cotton Linen Semi Shading Panel Living Room Bedroom Kitchen
-5%
$7.94-10.40
No MOQ
American Pastoral Jacquard Bird Floral Door Curtains With Tassels Semi Shading Polyester Cotton Kitchen Window Treatments
American Pastoral Jacquard Bird Floral Door Curtains With Tassels Semi Shading Polyester Cotton Kitchen Window Treatments
like
Find Similar
Diamond weave curtain with bird floral motifs and decorative white tassels - Custom Size / Jacquard Beige Orioles (Rod Pocket)
Bohemian jacquard curtain with red and blue geometric patterns and white tassels - Custom Size / Jacquard Miao Totem (Rod Pocket)
Jacquard curtain with orange floral pattern and white tassel trim for home decor - Custom Size / Black Jacquard Iris Floral (Rod Pocket)
Red and white tropical palm tree jacquard curtain with pom-pom fringe in vintage style - Custom Size / Jacquard Red Coconut Tree Pom-poms (Grommet)
+91
American Pastoral Jacquard Bird Floral Door Curtains With Tassels Semi Shading Polyester Cotton Kitchen Window Treatments
-5%
$8.21-21.90
No MOQ
Christmas Linen Cushion Cover 3D Visual Effect Santa Claus Reindeer Snowman Pattern Square Pillowcase For Home Sofa Decor
Christmas Linen Cushion Cover 3D Visual Effect Santa Claus Reindeer Snowman Pattern Square Pillowcase For Home Sofa Decor
like
Find Similar
Macro detail of Christmas pillow cover with 3D Santa Claus and floral gold embroidery - Santa Claus Style (DYM394-1) / Standard Square
Close-up of 3D white reindeer with golden antlers on a luxury Christmas cushion cover - White Reindeer Style (DYM394-2) / Standard Square
Detail of Christmas pillow cover featuring embossed white poinsettia tree and golden star - Floral Christmas Tree Style (DYM394-3) / Standard Square
Detail of 3D Christmas snowman wreath embroidery on a cream linen pillowcase cover - Cute Snowman Style (DYM394-4) / Standard Square
Christmas Linen Cushion Cover 3D Visual Effect Santa Claus Reindeer Snowman Pattern Square Pillowcase For Home Sofa Decor
$1.21
Mix MOQ : 2
Valentine Day Cushion Cover Romantic Heart Love Printed Square Pillowcase Decorative Peach Skin Velvet Home Sofa Decor
Valentine Day Cushion Cover Romantic Heart Love Printed Square Pillowcase Decorative Peach Skin Velvet Home Sofa Decor
like
Find Similar
Square cushion cover with pink hearts and black I Love You print on white fabric - Pink Distressed Heart (1)
Kiss Me linen peach skin pillowcase with red lip print and gold stars for Valentine decor - Kiss Me Lips (2)
Square peach skin pillowcase with romantic 'Will you Marry me?' print for Valentine - Will You Marry Me (3)
Square peach skin pillowcase with black and gold hand-drawn LOVE and BE MINE patterns - Be Mine Black Gold Graffiti (4)
+26
Valentine Day Cushion Cover Romantic Heart Love Printed Square Pillowcase Decorative Peach Skin Velvet Home Sofa Decor
-4%
$1.04
No MOQ
Fantasy Forest Tapestry Fairy Tale House Wall Hanging Polyester Landscape Backdrop For Home Office Bedroom Decoration
Fantasy Forest Tapestry Fairy Tale House Wall Hanging Polyester Landscape Backdrop For Home Office Bedroom Decoration
like
Find Similar
Enchanted forest treehouse wall tapestry hanging over a grey sofa in a living room - Mossy Ancient Tree Landscape (Pattern 2) / Medium Specification (Peach Skin Fabric)
Whimsical forest treehouse wall tapestry hanging over a grey sofa for home decor - Dreamy Forest Cabin (Pattern 4) / Medium Specification (Peach Skin Fabric)
Detail view of fantasy forest treehouse tapestry hanging above a modern sofa - Dreamy Sakura Ruins (Pattern 6) / Medium Specification (Peach Skin Fabric)
Fantasy forest treehouse tapestry with glowing mushrooms hanging above a gray sofa - Fantasy Forest Tree Hole (Pattern 1) / Medium Specification (Peach Skin Fabric)
+158
Fantasy Forest Tapestry Fairy Tale House Wall Hanging Polyester Landscape Backdrop For Home Office Bedroom Decoration
$2.59-10.37
No MOQ
Free Shipping
Nativity Scene Linen Throw Pillow Cover Buffalo Plaid O Holy Night Jesus Is The Reason Festive Home Decor Sofa Cushion Case
Nativity Scene Linen Throw Pillow Cover Buffalo Plaid O Holy Night Jesus Is The Reason Festive Home Decor Sofa Cushion Case
like
Find Similar
Christmas buffalo plaid nativity scene pillow cover in red and black linen - 45x45cm / Buffalo Plaid Nativity Scene Style (YMX87-1)
Christmas cushion cover with 'O holy Night' text and red buffalo plaid angel design - 45x45cm / Beige O Holy Night Style (YMX87-2)
Linen Christmas pillow cover with angel and red bird print for holiday decor - 45x45cm / Beige Jesus Is The Reason Style (YMX87-3)
Christmas nativity scene buffalo plaid pillowcase made of premium linen fabric - 45x45cm / Buffalo Plaid Three Wise Men Style (YMX87-4)
Nativity Scene Linen Throw Pillow Cover Buffalo Plaid O Holy Night Jesus Is The Reason Festive Home Decor Sofa Cushion Case
$1.15
Mix MOQ : 2
Halloween Skull And Crossbones Toilet Sticker PVC Waterproof Gothic Removable Decal For Bathroom Home Decor Mural
Halloween Skull And Crossbones Toilet Sticker PVC Waterproof Gothic Removable Decal For Bathroom Home Decor Mural
like
Find Similar
Detailed size view of black and white skull bathroom wall sticker 29cm by 29cm - 29x29cm (fun-m184)
Halloween Skull And Crossbones Toilet Sticker PVC Waterproof Gothic Removable Decal For Bathroom Home Decor Mural
$0.72
No MOQ
Autumn Fall Leaves Linen Pillow Case Cushion Cover Decorative Pumpkin Gnome Thanksgiving Print Throw Pillowcase For Home Sofa
Autumn Fall Leaves Linen Pillow Case Cushion Cover Decorative Pumpkin Gnome Thanksgiving Print Throw Pillowcase For Home Sofa
like
Find Similar
Fall maple leaves linen pillow cover with vintage texture on a grey sofa - Autumn Leaves Theme (1)
Linen fall leaves decorative square throw pillow cover on a grey sofa for Thanksgiving - Realistic Orange Leaves (2)
Linen sunflower throw pillow cover on grey sofa for Thanksgiving farmhouse home decor - Pastoral Sunflower Floral (3)
Fall leaves pattern linen throw pillow cover with autumn colors on a grey sofa background - Artistic Multicolor Leaves (4)
+12
Autumn Fall Leaves Linen Pillow Case Cushion Cover Decorative Pumpkin Gnome Thanksgiving Print Throw Pillowcase For Home Sofa
-4%
$1.15
No MOQ
Cotton Rope Woven Storage Basket Handwoven Plant Pot Cover Decorative Foldable Indoor Planter With Handles For Home Organization
Cotton Rope Woven Storage Basket Handwoven Plant Pot Cover Decorative Foldable Indoor Planter With Handles For Home Organization
like
Find Similar
Handwoven 25x25cm cotton rope basket with black stripes and integrated handles - Jute Patchwork Black (25x25cm)
Round cotton rope woven basket with handles in cream and light brown two-tone design - Jute Patchwork White (25x25cm)
Minimalist bicolor cotton rope woven storage basket in cream and light grey finish - White Patchwork Gray (25x25cm)
Minimalist cotton rope woven storage basket for plants and desk organization in grey and white - Medium Gray (25x25cm)
Cotton Rope Woven Storage Basket Handwoven Plant Pot Cover Decorative Foldable Indoor Planter With Handles For Home Organization
-11%
$4.06
No MOQ
American Paisley Floral Table Runner Polyester Waterproof Oil-Proof Geometric Pattern Home Dining Table Decoration
American Paisley Floral Table Runner Polyester Waterproof Oil-Proof Geometric Pattern Home Dining Table Decoration
like
Find Similar
Modern geometric yellow table runner with white boho patterns on beige tablecloth - 35*120cm / Yellow Geometric
American vintage floral table runner with warm beige base and orange floral patterns - 35*120cm / Yellow Flower
Elegant American style table runner with butterfly floral patterns on black background - 35*120cm / Black Butterfly Floral
Minimalist geometric table runner with black and white patterns on a cream tablecloth - 35*120cm / Black Geometric
+21
American Paisley Floral Table Runner Polyester Waterproof Oil-Proof Geometric Pattern Home Dining Table Decoration
-4%
$3.54-8.17
No MOQ
Quilted Waterproof Recliner Sofa Cover Single Seat Electric Recliner Protector Thickened Non-Slip Slipcover With Straps
Quilted Waterproof Recliner Sofa Cover Single Seat Electric Recliner Protector Thickened Non-Slip Slipcover With Straps
like
Find Similar
Beige quilted recliner chair cover with adjustable elastic straps and diamond pattern - Khaki
Deep grey quilted sofa cover for single recliner with diamond pattern and elastic straps - Gray
Quilted red recliner chair cover for single sofa with non-slip diamond stitch design - Red
Deep brown quilted recliner cover with diamond patterns and adjustable elastic straps - Red Brown
+2
Quilted Waterproof Recliner Sofa Cover Single Seat Electric Recliner Protector Thickened Non-Slip Slipcover With Straps
$11.24
No MOQ
American Vintage Polyester Embroidered Floral Curtain With Tassels Semi-Blackout Rod Pocket Hook Grommet Window Treatment Home Decor
American Vintage Polyester Embroidered Floral Curtain With Tassels Semi-Blackout Rod Pocket Hook Grommet Window Treatment Home Decor
like
Find Similar
Beige embroidered linen curtain with tassels, floral pattern for living room decor - Small / Blue Spider Lily (Rod Pocket)
Beige embroidered curtain with green floral patterns and tassels for windows - Grey Rose With Stem-mounted Style / 140x45
Beige floral embroidered linen curtain with tassels in French country style - Brown Rose Stem-carrying Style / 140x45
Classic beige embroidered curtain with red floral patterns and elegant fringe trim - Rose Petal Style / 140x45
+284
American Vintage Polyester Embroidered Floral Curtain With Tassels Semi-Blackout Rod Pocket Hook Grommet Window Treatment Home Decor
-5%
$5.75-20.53
No MOQ
Free Shipping
Nordic Minimalist Cotton Linen Tablecloth Rectangular Table Mat With Tassels Botanical Leaf Pattern For Home Dining Room
Nordic Minimalist Cotton Linen Tablecloth Rectangular Table Mat With Tassels Botanical Leaf Pattern For Home Dining Room
like
Find Similar
Elegant beige rectangular polyester tablecloth with green leaf patterns and tassels - 140*140cm / Small Leaf
+4
Nordic Minimalist Cotton Linen Tablecloth Rectangular Table Mat With Tassels Botanical Leaf Pattern For Home Dining Room
-5%
$2.60-5.34
No MOQ
Decorative Pillow Cover Dutch Velvet Textured Solid Color Cushion Case For Sofa Couch Living Room Modern Home Decor
Decorative Pillow Cover Dutch Velvet Textured Solid Color Cushion Case For Sofa Couch Living Room Modern Home Decor
like
Find Similar
Solid ginger yellow velvet pillow cover with textured waffle pattern for sofa and bed - 45x45cm / Orange Yellow
Modern bright yellow square velvet pillow cover with a soft minimalist texture - 45x45cm / Gold Yellow
Square beige velvet pillow cover with invisible zipper closure on white background - 45x45cm / Rice Camel
Navy blue velvet cushion cover with minimalist square design and soft texture finish - 45x45cm / Dark Blue
+4
NewDecorative Pillow Cover Dutch Velvet Textured Solid Color Cushion Case For Sofa Couch Living Room Modern Home Decor
-4%
$2.55
No MOQ
Bohemian Woven Cotton Linen Placemat With Tassels Geometric Pattern Heat Resistant Farmhouse Table Mat For Dining Room Kitchen Decor
Bohemian Woven Cotton Linen Placemat With Tassels Geometric Pattern Heat Resistant Farmhouse Table Mat For Dining Room Kitchen Decor
like
Find Similar
Bohemian beige woven cotton linen table runner with brown geometric patterns and tassels - 30*45 / Three Rope Khaki
Bohemian off-white cotton table runner with grey woven geometric patterns and tassels - 30*45 / Three Rope Gray
Boho beige cotton table runner with brown stripes and tassels on a dark wood table - 30*45 / Two Rope Khaki
Bohemian cotton linen table runner with black diamond patterns and fringe tassels - 30*45 / Black Mesh
Bohemian Woven Cotton Linen Placemat With Tassels Geometric Pattern Heat Resistant Farmhouse Table Mat For Dining Room Kitchen Decor
-4%
$0.80
No MOQ
Watercolor Floral Placemats Heat Resistant Washable Polyester Dining Table Mats Home Party Kitchen Decoration Festive Flower Pattern
Watercolor Floral Placemats Heat Resistant Washable Polyester Dining Table Mats Home Party Kitchen Decoration Festive Flower Pattern
like
Find Similar
Detail of 44x29.5cm watercolor floral placemats showing texture and heat resistant fabric - Style 1 / Watercolor Floral
Detailed size guide for watercolor floral placemats set of 6 measuring 44cm x 29.5cm - Style 2 / Watercolor Floral
Watercolor Floral Placemats Heat Resistant Washable Polyester Dining Table Mats Home Party Kitchen Decoration Festive Flower Pattern
-5%
$2.19-3.29
No MOQ
Christmas Buffalo Plaid Pillowcases Red Black Check Cushion Covers Square Decorative Reindeer Snowflake Print Pillow Covers Home Sofa Decor
Christmas Buffalo Plaid Pillowcases Red Black Check Cushion Covers Square Decorative Reindeer Snowflake Print Pillow Covers Home Sofa Decor
like
Find Similar
Red and black buffalo plaid Christmas pillow cover with white Merry Christmas print - Merry Christmas Lettering With Snowflake Style (Style A) / Cover Only
Christmas cushion cover in red and black buffalo plaid with elk and snowflake pattern - Merry Christmas Lettering With Double Elk Style (Style B) / Cover Only
Christmas cushion cover in red black buffalo plaid with white Christmas tree print - Merry Christmas Lettering With Tree Style (Style C) / Cover Only
Red and black buffalo plaid Christmas square pillow cover with Merry Christmas print - Merry Christmas Lettering With Mixed Ornaments Style (Style D) / Cover Only
+1
Christmas Buffalo Plaid Pillowcases Red Black Check Cushion Covers Square Decorative Reindeer Snowflake Print Pillow Covers Home Sofa Decor
-5%
$2.05
No MOQ
White Sheer Curtain With Colorful Pom Poms Rod Pocket Semi Transparent Window Treatments For Living Room Bedroom Home Decor
White Sheer Curtain With Colorful Pom Poms Rod Pocket Semi Transparent Window Treatments For Living Room Bedroom Home Decor
like
Find Similar
White semi-sheer curtains with colorful polka dot embroidery for bedroom and living room decor - 140cm x 100cm / White (Colorful Dots)
White Sheer Curtain With Colorful Pom Poms Rod Pocket Semi Transparent Window Treatments For Living Room Bedroom Home Decor
-5%
$5.42-10.10
No MOQ
Summer Sunflower Sun Decorative Pillow Case Linen Cushion Cover Yellow White Sunshine Sweet Summer Home Decor Square
Summer Sunflower Sun Decorative Pillow Case Linen Cushion Cover Yellow White Sunshine Sweet Summer Home Decor Square
like
Find Similar
Detail of yellow linen pillowcase featuring bold SWEET summer print and sun motif - Sweet Summer Letter Print Style (YMS43-1)
Detail view of linen square pillow cover with yellow cartoon sun and sun text pattern - Smiley Sun Print Style (YMS43-2)
Square linen pillowcase featuring bright sunflower prints and sun word pattern background - Sunflower Illustration Print Style (YMS43-3)
Detail showing high-quality linen texture with Hello Sunshine print on yellow pillow cover - Hello Sunshine Letter Print Style (YMS43-4)
Summer Sunflower Sun Decorative Pillow Case Linen Cushion Cover Yellow White Sunshine Sweet Summer Home Decor Square
$1.15
Mix MOQ : 2
Lavender Print Café Curtain Fresh Pastoral Style Polyester Small Half Curtain For Kitchen Bedroom Study Home Decor Valance
Lavender Print Café Curtain Fresh Pastoral Style Polyester Small Half Curtain For Kitchen Bedroom Study Home Decor Valance
like
Find Similar
3 options
NewLavender Print Café Curtain Fresh Pastoral Style Polyester Small Half Curtain For Kitchen Bedroom Study Home Decor Valance
-5%
$3.50-7.34
No MOQ
Humorous Cartoon Giraffe Reading Newspaper Toilet Sticker Waterproof PVC Wall Decal For Bathroom Kids Room Decoration
Humorous Cartoon Giraffe Reading Newspaper Toilet Sticker Waterproof PVC Wall Decal For Bathroom Kids Room Decoration
like
Find Similar
Cartoon giraffe reading newspaper on toilet PVC wall sticker for bathroom decor - Pc813 - Giraffe Reading Newspaper - 30-30 (no Bag)
Humorous Cartoon Giraffe Reading Newspaper Toilet Sticker Waterproof PVC Wall Decal For Bathroom Kids Room Decoration
$0.92
Mix MOQ : 4
Waterproof Oilproof Cactus Print Tablecloth With Tassel Fringe Cotton Blend Rectangular Decorative Dining Table Cover
Waterproof Oilproof Cactus Print Tablecloth With Tassel Fringe Cotton Blend Rectangular Decorative Dining Table Cover
like
Find Similar
Waterproof cactus print tablecloth with white tassels on a rustic wooden dining table - 140x260cm / Cactus (Tassel)
+11
Waterproof Oilproof Cactus Print Tablecloth With Tassel Fringe Cotton Blend Rectangular Decorative Dining Table Cover
-5%
$2.46-12.05
No MOQ
Vintage Cotton Linen Tablecloth Rectangular Nordic Geometric Zigzag Mandala Floral Leaf Pattern Dining Table Cover
Vintage Cotton Linen Tablecloth Rectangular Nordic Geometric Zigzag Mandala Floral Leaf Pattern Dining Table Cover
like
Find Similar
Rectangle vintage mandala table cloth in linen texture with elegant blue floral patterns - 60x60cm / Vintage Mandala
Nordic rectangular tablecloth with blue and yellow leaf pattern in a cozy home setting - 60x60cm / Curved Leaves
Rectangular blue zigzag pattern tablecloth made of thick cotton linen fabric - 140x220cm / Blue Zigzag
Vintage style rectangle tablecloth with hand-drawn coffee and floral prints for home dining - 100x140cm / Hand-painted Wine Bottles
+44
Vintage Cotton Linen Tablecloth Rectangular Nordic Geometric Zigzag Mandala Floral Leaf Pattern Dining Table Cover
-5%
$1.92-12.32
No MOQ
Autumn Fall Cushion Cover Pumpkin Maple Leaves Peach Skin Decorative Throw Pillow Case For Sofa Home Thanksgiving
Autumn Fall Cushion Cover Pumpkin Maple Leaves Peach Skin Decorative Throw Pillow Case For Sofa Home Thanksgiving
like
Find Similar
White microfiber pillow cover with black autumn leaves print and seasonal typography - White Background Black Text Autumn Leaf Theme
Detail of watercolor autumn leaves and quote print on a white peach skin pillowcase - Standard Spec / Watercolor Colorful Autumn Leaves(2)
Detail of Leaves are Falling Autumn is Calling text on peach skin fabric pillow cover - Standard Spec / Red Orange Artistic Text Design(3)
Detail of the hidden zipper and soft peach skin fabric on the autumn leaves pillowcase - Brown Yellow Orange Mixed Leaves
+36
Autumn Fall Cushion Cover Pumpkin Maple Leaves Peach Skin Decorative Throw Pillow Case For Sofa Home Thanksgiving
-4%
$1.04
No MOQ
Easter Rabbit Bunny Floral Plaid Pattern Decorative Pillowcase Cushion Cover Linen Texture Home Sofa Decor
Easter Rabbit Bunny Floral Plaid Pattern Decorative Pillowcase Cushion Cover Linen Texture Home Sofa Decor
like
Find Similar
Easter bunny and spring flowers printed square throw pillow cover on white background - Rabbit and Spring Flowers Style (JYM584-1)
Easter throw pillow cover with tulips, polka dots, and Happy Easter lettering on beige canvas - Happy Easter and Pink Tulips Style (JYM584-2)
Easter plaid throw pillow cover with yellow grid and cute bunny print for home decor - Rabbit Back and Colorful Plaid Style (JYM584-3)
Easter plaid throw pillow cover featuring white rabbit and wildflowers on cotton linen texture - White Rabbit and Pastoral Flowers Style (JYM584-4)
NewEaster Rabbit Bunny Floral Plaid Pattern Decorative Pillowcase Cushion Cover Linen Texture Home Sofa Decor
$1.15
No MOQ
Nordic Style Rectangular Tablecloth With Tassels Striped Embroidered Table Cover Chemical Fiber Dustproof For Dining Table Home Party Wedding
Nordic Style Rectangular Tablecloth With Tassels Striped Embroidered Table Cover Chemical Fiber Dustproof For Dining Table Home Party Wedding
like
Find Similar
Rectangle patchwork tablecloth with light blue and green cotton linen and tassels - 140-260 / Blue-Green Striped Embroidery With Tassel
Nordic style tablecloth with blue and green stripes, white stitching and tassel fringe - 140-260 / Blue-Green Plaid Embroidery With Tassel
European style grey rectangular tablecloth with white embroidery and tassel details - 140-260 / Triple Line Gray With Tassel
Minimalist beige and brown striped faux linen tablecloth with handcrafted tassel edges - 140-260 / Triple Line Coffee With Tassel
+41
Nordic Style Rectangular Tablecloth With Tassels Striped Embroidered Table Cover Chemical Fiber Dustproof For Dining Table Home Party Wedding
-5%
$7.94-18.34
No MOQ
French Vintage Lace Ruffle Door Curtain Damask Floral Semi Shading Polyester Embroidered Tassel Curtain For Living Room Bedroom Home
French Vintage Lace Ruffle Door Curtain Damask Floral Semi Shading Polyester Embroidered Tassel Curtain For Living Room Bedroom Home
like
Find Similar
French style lace curtain with ruffle edges and damask pattern in warm bronze gold - 140*100cm / Orange
Dark green French lace curtain with damask floral patterns and ruffled edges for a retro style - 140*100cm / Green
White French lace curtain with floral patterns and ruffled edges for bedroom - 140*100cm / White
Elegant beige floral lace sheer curtain with damask patterns and ruffled edges for windows - 140*100cm / Off White
+16
French Vintage Lace Ruffle Door Curtain Damask Floral Semi Shading Polyester Embroidered Tassel Curtain For Living Room Bedroom Home
-5%
$5.15-9.67
No MOQ
Nordic White Floral Lace Mesh Tablecloth Pastoral Embroidered Rectangular Table Cover For Kitchen Dining Room Home Decor
Nordic White Floral Lace Mesh Tablecloth Pastoral Embroidered Rectangular Table Cover For Kitchen Dining Room Home Decor
like
Find Similar
White lace mesh tablecloth with heart-shaped floral embroidery in minimalist Nordic style - 100cmx140cm
Nordic White Floral Lace Mesh Tablecloth Pastoral Embroidered Rectangular Table Cover For Kitchen Dining Room Home Decor
-5%
$3.56-5.89
No MOQ
Vintage Christmas Linen Cushion Cover Santa Claus Snowman Elk Pattern Holiday Decoration Pillowcase No Insert
Vintage Christmas Linen Cushion Cover Santa Claus Snowman Elk Pattern Holiday Decoration Pillowcase No Insert
like
Find Similar
Macro shot of vintage linen Christmas pillow cover with Santa Claus watercolor print - 45x45cm Linen Single Side Without Core / Santa and Girl Illustration (DYM387-1)
Vintage Christmas pillow cover featuring Santa Claus and reindeer on linen texture - 45x45cm Linen Single Side Without Core / Santa and Elk with Gift Box (DYM387-2)
Vintage Christmas snowman pillow cover featuring gift boxes and pine cones on linen fabric - 45x45cm Linen Single Side Without Core / Snowman in Green Hat with Gifts (DYM387-3)
Close-up of two watercolor snowmen with hats and scarves on linen Christmas pillowcase - 45x45cm Linen Single Side Without Core / Two Standing Snowmen Illustration (DYM387-4)
+21
NewVintage Christmas Linen Cushion Cover Santa Claus Snowman Elk Pattern Holiday Decoration Pillowcase No Insert
$1.30
Mix MOQ : 2
Bohemian American Style Jacquard Curtains With Tassels Geometric Floral Pumpkin Pattern Door Curtains For Living Room
Bohemian American Style Jacquard Curtains With Tassels Geometric Floral Pumpkin Pattern Door Curtains For Living Room
like
Find Similar
Vintage floral jacquard curtains in sage green with decorative white fringe tassels - Jacquard Green Lotus Rice Broom Handle / 150x220cm
Bohemian geometric jacquard curtains with white tassels in a vintage room setting - Jacquard Color-blocked Geometric Meter Broom Handle / 150x220cm
Floral jacquard curtain with elegant white tassel fringe in a retro country style - Jacquard Plum Blossom Beige Broom Handle / 150x220cm
Festive bohemian red geometric curtains with tassels and elegant holiday home decor - Red Badge Beige Broom Handle / 150x220cm
+136
NewBohemian American Style Jacquard Curtains With Tassels Geometric Floral Pumpkin Pattern Door Curtains For Living Room
-5%
$8.21-21.90
No MOQ
Go to

More in home & kitchen

Explore more in bedding & bathroom

homecolortravelshapestoragepolyesterdoublelayerdailyfoot
handholderplasticcleaningstylesimplekidswhiteheadbody

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access