Everful

Wholesale storage boxes, bottles & jars

Functional, design-forward kitchen and home essentials, sourced factory-direct and ready to restock.

Sign Up
Storage Boxes, Bottles & Jars

Find the perfect pieces: storage boxes & bottles and more

Popular collections in storage boxes, bottles & jars

All products in storage boxes, bottles & jars

filterShow Filters
Best Seller
New Arrivals
Price Drop
Creative Triangle Cake Shaped Gift Box Cartoon Pink Strawberry Blue Rainbow Party Favor Candy Packaging Box With Ribbon
Creative Triangle Cake Shaped Gift Box Cartoon Pink Strawberry Blue Rainbow Party Favor Candy Packaging Box With Ribbon
like
Find Similar
Pink and white triangle cake gift boxes with strawberry patterns and silk ribbons - 22x22x7.5cm / Pink Strawberry
Rainbow gradient triangle cake gift box with blue cloud print and silk ribbon bow - 22x22x7.5cm / Blue Rainbow
Creative Triangle Cake Shaped Gift Box Cartoon Pink Strawberry Blue Rainbow Party Favor Candy Packaging Box With Ribbon
-4%
$1.59
No MOQ
 · 
15 views
Ceramic Lard Storage Jar With Lid And Spoon Heat Resistant Seasoning Container Japanese Hand Painted Floral Design
Ceramic Lard Storage Jar With Lid And Spoon Heat Resistant Seasoning Container Japanese Hand Painted Floral Design
like
Find Similar
Ceramic lard container with orange floral pattern and lid, medium size 880ml capacity - 880ml / Orange Flower - Medium Double Ear (With Spoon)
Blue leaf ceramic lard jar with lid and spoon, 880ml medium heat-resistant container - 880ml / Blue Flower - Medium Double Ear (With Spoon)
1500ml ceramic lard pot with floral patterns, yellow handles and matching lid - 1500ml / Orange Flower - Large Double Ear (With Spoon)
Blue Floral Ceramic Lard Pot with Lid and Handles, 1500ml Large Capacity Seasoning Jar - 1500ml / Blue Flower - Large Double Ear (With Spoon)
+5
Ceramic Lard Storage Jar With Lid And Spoon Heat Resistant Seasoning Container Japanese Hand Painted Floral Design
$2.45-6.20
No MOQ
 · 
53 views
Minimalist Solid Color Flip Top Paper Gift Box Portable Handheld Candy Souvenir Packaging Box For Wedding Party Gift Bag
Minimalist Solid Color Flip Top Paper Gift Box Portable Handheld Candy Souvenir Packaging Box For Wedding Party Gift Bag
like
Find Similar
Detail showing two sizes of brown kraft paper gift bags with handles and tab closures - Kraft Paper Color / 15x10x6cm
Macro detail of red matte cardboard gift boxes with handles in two different sizes - Red / 15x10x6cm
Detail of light blue flip-top cardboard gift boxes in two sizes with die-cut handles - Blue / 15x10x6cm
Minimalist matte black paper gift boxes with oval handles in two different sizes - Black / 15x10x6cm
+8
Minimalist Solid Color Flip Top Paper Gift Box Portable Handheld Candy Souvenir Packaging Box For Wedding Party Gift Bag
$0.12-0.20
Mix MOQ : 12
 · 
21 views
Portable Pill Box Medicine Organizer Sealed Moisture Proof Luggage Style Striped Plastic Case For Travel Mini Storage
Portable Pill Box Medicine Organizer Sealed Moisture Proof Luggage Style Striped Plastic Case For Travel Mini Storage
like
Find Similar
Mini cream suitcase style 7-day pill organizer with vertical stripes and silver buckle - Small Cream White
Portable mini black pill organizer box SG-24 with waterproof seal for medicine storage - Small Cream Black
Portable cream-white 7-day pill box SG-25 with secure silver latch and dimensions - Large Cream White
Portable 7-day pill organizer case in large black with secure waterproof sealing buckle - Large Cream Black
Portable Pill Box Medicine Organizer Sealed Moisture Proof Luggage Style Striped Plastic Case For Travel Mini Storage
$1.38-1.79
No MOQ
 · 
1 reviews
Shell Shaped Jewelry Storage Box Transparent Plastic Glitter Dustproof Flip Lid Decorative Desktop Small Trinket Organizer
Shell Shaped Jewelry Storage Box Transparent Plastic Glitter Dustproof Flip Lid Decorative Desktop Small Trinket Organizer
like
Find Similar
Pink shell-shaped jewelry box with iridescent finish and glitter details on black background - Pink
Close-up of a blue transparent shell-shaped jewelry box with glitter on black background - Blue
Detail of purple shell storage box with translucent finish and sparkling glitter texture - Purple
Macro shot of shell shaped clear plastic storage box with subtle glitter finish - White
Shell Shaped Jewelry Storage Box Transparent Plastic Glitter Dustproof Flip Lid Decorative Desktop Small Trinket Organizer
-8%
$0.42
Mix MOQ : 3
 · 
18 sold recently
Cute Angel Cat Money Box Resin Piggy Bank With Gold Crown Bell Wings Kawaii Desktop Decoration Living Room Bedroom Gift
Cute Angel Cat Money Box Resin Piggy Bank With Gold Crown Bell Wings Kawaii Desktop Decoration Living Room Bedroom Gift
like
Find Similar
Cute gray and white angel cat piggy bank with golden crown and red bell collar on pink background - Open Eyes Style
Cute grey cat piggy bank with gold crown and red collar for modern home desk decor - Blink Eyes
Cute Angel Cat Money Box Resin Piggy Bank With Gold Crown Bell Wings Kawaii Desktop Decoration Living Room Bedroom Gift
$4.38
No MOQ
 · 
10 sold recently
Electronics Organizer Bag Waterproof Nylon Cable Storage Case Portable Travel Pouch For Power Bank Chargers USB Earphones
Electronics Organizer Bag Waterproof Nylon Cable Storage Case Portable Travel Pouch For Power Bank Chargers USB Earphones
like
Find Similar
Portable black electronics organizer bag in tear-resistant fabric for cables and chargers - Black
Grey portable travel organizer bag for electronic accessories and charging cables - Gray
Portable digital accessories organizer bag in navy blue with waterproof nylon fabric - Navy Blue
Portable digital accessories organizer pouch in camouflage blue waterproof nylon - Camo Blue
+8
Electronics Organizer Bag Waterproof Nylon Cable Storage Case Portable Travel Pouch For Power Bank Chargers USB Earphones
-4%
$2.14
Mix MOQ : 2
 · 
56 views
Portable Electronics Organizer Bag Travel Cable Storage Pouch Waterproof Polyester PU Leather Multipurpose Handheld Case
Portable Electronics Organizer Bag Travel Cable Storage Pouch Waterproof Polyester PU Leather Multipurpose Handheld Case
like
Find Similar
Red digital accessory storage bag in nylon and PU leather with wrist strap, 19x12x3.5cm - Handheld Wine Red
Beige small digital accessories storage bag with GREAT II print and zipper, 19x12x3.5cm - Handheld Beige
Brown electronics organizer bag with GREAT text and wrist strap, 19x12x3.5cm size - Handheld Coffee
Grey Oxford fabric digital organizer bag with orange zipper and 28x20x3cm dimensions - Flat Style Grey
+14
Portable Electronics Organizer Bag Travel Cable Storage Pouch Waterproof Polyester PU Leather Multipurpose Handheld Case
$2.94-5.42
Mix MOQ : 3
 · 
42 views
Mini Round Metal Tin Boxes With Lids Tinplate Portable Ointment Balm Cosmetic Sample Container Storage Jars For Travel
Mini Round Metal Tin Boxes With Lids Tinplate Portable Ointment Balm Cosmetic Sample Container Storage Jars For Travel
like
Find Similar
Macro detail of a 20g white round tin container with open lid showing metal interior - D50*18mm / Glossy White
Detail of a round matte black metal container showing its lid and inner silver lining - D50*18mm / Matte Grey
Empty silver metal tin 50mm diameter 18mm height for cosmetic cream and lip balm - D50*18mm / Silver
Mini Round Metal Tin Boxes With Lids Tinplate Portable Ointment Balm Cosmetic Sample Container Storage Jars For Travel
$0.36
No MOQ
 · 
61 sold recently
Funny Attitude Ceramic Storage Jar With Lid Hands On Hips Handle Colorful Polka Dots Sugar Bowl Home Kitchen Decor
Funny Attitude Ceramic Storage Jar With Lid Hands On Hips Handle Colorful Polka Dots Sugar Bowl Home Kitchen Decor
like
Find Similar
Quirky ceramic attitude jar with colorful polka dots and light orange twisted handles - Attitude Jar - Pale Yellow (Colorful Splatter) / Bright yellow
Artistic ceramic sugar jar with colorful splatter paint and lid featuring two side handles - Attitude Jar - Azure (Colorful Splatter) / Azure
Ceramic storage jar with lid and hand-painted blue-green floral patterns and unique handles - Attitude Jar - Navy Blue (Floral Pattern) / Navy Blue
Funny Attitude Ceramic Storage Jar With Lid Hands On Hips Handle Colorful Polka Dots Sugar Bowl Home Kitchen Decor
-5%
$5.20
No MOQ
 · 
134 views
Mini Suitcase Money Bank Plastic Trolley Luggage Shape Saving Pot Jewelry Organizer Box For Kids Desktop Decor
Mini Suitcase Money Bank Plastic Trolley Luggage Shape Saving Pot Jewelry Organizer Box For Kids Desktop Decor
like
Find Similar
Mini pink suitcase money box next to its retail packaging box on a light background - Pink
Mini silver suitcase music box with telescopic handle and functional rolling wheels - Silver
Miniature toy suitcase detail showing retractable handle and wheels on pink plastic model - Orange
Mini Suitcase Money Bank Plastic Trolley Luggage Shape Saving Pot Jewelry Organizer Box For Kids Desktop Decor
-4%
$2.80
No MOQ
 · 
115 views
10 Compartments Clear Plastic Storage Box Adjustable Divider Organizer For Jewelry Pill Fishing Tool Case Home Organization
10 Compartments Clear Plastic Storage Box Adjustable Divider Organizer For Jewelry Pill Fishing Tool Case Home Organization
like
Find Similar
Detail view of 10-compartment transparent plastic storage box with blue buckle closure - White
Detail view of pink translucent 10-compartment plastic organizer with blue secure latch - Pink
Translucent 10-compartment plastic storage box with blue buckles shown at a 45-degree angle - Blue
10 Compartments Clear Plastic Storage Box Adjustable Divider Organizer For Jewelry Pill Fishing Tool Case Home Organization
$0.14
No MOQ
 · 
18 views
Wooden Desktop Storage Box With Lock Drawer Style Multi Layer Desktop Organizer Cabinet For Office Home Natural Wood Walnut White
Wooden Desktop Storage Box With Lock Drawer Style Multi Layer Desktop Organizer Cabinet For Office Home Natural Wood Walnut White
like
Find Similar
Single-layer wooden desk organizer drawer with metal lock, 35x26x13cm natural wood grain - 1 Tier / Natural Wood Color
2-tier wooden desk storage box with lock and light wood grain finish, size 35x26x16cm - 2-Tier / Natural Wood Color
Three-layer wooden desk organizer drawer with metal lock and natural wood grain - Triple Layer / Natural Wood Color
4-tier wood desk organizer with locking top drawer and natural grain finish - 4 Tiers / Natural Wood Color
+11
Wooden Desktop Storage Box With Lock Drawer Style Multi Layer Desktop Organizer Cabinet For Office Home Natural Wood Walnut White
$26.10-59.21
No MOQ
 · 
56 views
Minimalist White PP Plastic Storage Box Flip Top Dustproof Desktop Organizer For Stationery Cosmetics Journal Stickers
Minimalist White PP Plastic Storage Box Flip Top Dustproof Desktop Organizer For Stationery Cosmetics Journal Stickers
like
Find Similar
White frosted plastic storage box with lid, 18x12x10cm size for stationery and cosmetics - Large / White
White minimalist plastic storage box with lid for stationery and cosmetic organization - Medium / White
Minimalist White PP Plastic Storage Box Flip Top Dustproof Desktop Organizer For Stationery Cosmetics Journal Stickers
-5%
$0.49-0.60
No MOQ
 · 
13 sold recently
Angel Girl Figurine Resin Vinyl Rabbit Ears Wings Praying Sleeping Ornament Desktop Home Decor Gift
Angel Girl Figurine Resin Vinyl Rabbit Ears Wings Praying Sleeping Ornament Desktop Home Decor Gift
like
Find Similar
Set of 4 cute angel cake toppers with bunny ears and wings in assorted pastel colors - 1121-28A Purple Dress Angel
Cute pink hair angel girl cake topper figurine with rabbit ears and white wings - 1121-11EF-A Praying Pink
Pink rabbit-eared angel girl figurine in sitting pose for room or cake decoration - 1121-11EF-B Looking Up Pink
Pink tent night light with sleeping angel and golden star topper, size 10.5x9x14cm - 1121-7 Star Tent Light Pink
+28
Angel Girl Figurine Resin Vinyl Rabbit Ears Wings Praying Sleeping Ornament Desktop Home Decor Gift
-5%
$2.33-38.37
No MOQ
 · 
23 views
Airtight Rice Bucket Cereal Storage Container PP Plastic Moisture Proof One Touch Lid Visible Window Kitchen Grain Box
Airtight Rice Bucket Cereal Storage Container PP Plastic Moisture Proof One Touch Lid Visible Window Kitchen Grain Box
like
Find Similar
Ivory white 10kg sealed rice container with moisture-proof silicone ring and clear window - With Measuring Cup / Ivory White 10kg
Ivory rice dispenser with vacuum seal and transparent scale window 5kg capacity - With Measuring Cup / Ivory White 5kg
White airtight rice storage container set with gold button and visible window - Rice and Flour Separate Set / Ivory White 10kg+5kg
Ivory white rice storage bin 10kg capacity with airtight seal and insect-proof box - Rice and Flour Separate Set / Ivory White 10kg+10kg
+2
Airtight Rice Bucket Cereal Storage Container PP Plastic Moisture Proof One Touch Lid Visible Window Kitchen Grain Box
-5%
$4.93-13.41
No MOQ
 · 
43 views
Clear Acrylic Desktop Storage Box With Flip Lid Dustproof Large Capacity Organizer For Phone Case Stationery Cosmetics Office Bedroom
Clear Acrylic Desktop Storage Box With Flip Lid Dustproof Large Capacity Organizer For Phone Case Stationery Cosmetics Office Bedroom
like
Find Similar
Clear acrylic storage box with flip lid, 22x19x10cm size for desk organization - Clear
Translucent dark grey acrylic desktop storage box with lid for office stationery - Transparent Gray
Clear Acrylic Desktop Storage Box With Flip Lid Dustproof Large Capacity Organizer For Phone Case Stationery Cosmetics Office Bedroom
$2.82-2.85
No MOQ
 · 
155 views
Ceramic Tea Caddy Airtight Storage Jar Hand Painted Rabbit Osmanthus Pattern Moisture Proof Portable Porcelain Container
Ceramic Tea Caddy Airtight Storage Jar Hand Painted Rabbit Osmanthus Pattern Moisture Proof Portable Porcelain Container
like
Find Similar
Square ceramic tea canister featuring hand-painted golden osmanthus and moon rabbit motifs - Ash Grey Hand-painted Square Tea Canister
Ceramic tea canister with rabbit and osmanthus pattern, 250ml airtight wooden lid - Ash Grey Hand-painted Sanyuan Tea Canister
Hand-painted ceramic tea jars with rabbit motif and gold floral carrying bag - 2pcs Square Tea Canisters + Storage Bag Set
Ceramic tea canister set with rabbit patterns and embroidered storage bag for home use - 2pcs Sanyuan Tea Canisters + Storage Bag Set
+1
Ceramic Tea Caddy Airtight Storage Jar Hand Painted Rabbit Osmanthus Pattern Moisture Proof Portable Porcelain Container
-5%
$4.11-20.81
No MOQ
 · 
48 views
Free Shipping
Gift Paper Bags With Ribbon Bowknot And Rope Handles For Wedding Party Favor Shopping Packaging Elegant Cardboard Bags
Gift Paper Bags With Ribbon Bowknot And Rope Handles For Wedding Party Favor Shopping Packaging Elegant Cardboard Bags
like
Find Similar
White paper gift bag with black border and elegant black ribbon bow handle - Black Frame White Background; Horizontal Extra Small Size 19*15*7 Ribbon Style.
Elegant white gift bag with gold trim, twisted handles and large golden satin ribbon bow - Gold Frame White Background; Horizontal Extra Small Size 19*15*7 Ribbon Style.
Beige gift paper bag with matching satin bow and twisted handle for shopping use - Horizontal XS 19x15x7cm / Champagne
Navy blue paper gift bag with gold trim, golden ribbon bow and twisted rope handles - Gold Frame Navy Blue; Horizontal Extra Small Size 19*15*7 Mm Ribbon Style.
+145
Gift Paper Bags With Ribbon Bowknot And Rope Handles For Wedding Party Favor Shopping Packaging Elegant Cardboard Bags
-6%
$0.30-0.63
No MOQ
 · 
1K+ sold recently
Bling Rhinestone Cigarette Case For Women Double Sided Metal Card Holder Portable Handmade Sparkling Storage Box
Bling Rhinestone Cigarette Case For Women Double Sided Metal Card Holder Portable Handmade Sparkling Storage Box
like
Find Similar
Detail of red rhinestone encrusted metal cigarette case showing fine crystal texture - Red
Detailed top view of rose pink double-sided rhinestone cigarette case with metal frame - Rose Red
Close-up of pink rhinestone covered metal cigarette box with a luxury diamond-encrusted finish - Pink
Double-sided rectangular case with black rhinestones and silver metal frame for women - Black
+6
Bling Rhinestone Cigarette Case For Women Double Sided Metal Card Holder Portable Handmade Sparkling Storage Box
$4.32
No MOQ
 · 
51 views
Square Flip Top Gift Packaging Box White Cardboard Foldable Storage Box For Handmade Soap Flower Tea Nougat Party Favors
Square Flip Top Gift Packaging Box White Cardboard Foldable Storage Box For Handmade Soap Flower Tea Nougat Party Favors
like
Find Similar
Elegant square pink gift box with vintage alphabet print for luxury tea and soap packaging - Pink Letters / 15x15x5cm
Black square gift box with pink floral design and elegant matte paper finish - Black Cherry Blossom / 15x15x5cm
Square Flip Top Gift Packaging Box White Cardboard Foldable Storage Box For Handmade Soap Flower Tea Nougat Party Favors
-5%
$0.32
No MOQ
 · 
59 views
Transparent PP Plastic Storage Box Multi-Grid Portable Jewelry Bead Craft Accessory Organizer Box Clear Parts Container
Transparent PP Plastic Storage Box Multi-Grid Portable Jewelry Bead Craft Accessory Organizer Box Clear Parts Container
like
Find Similar
8 options
Transparent PP Plastic Storage Box Multi-Grid Portable Jewelry Bead Craft Accessory Organizer Box Clear Parts Container
$0.16-8.56
No MOQ
 · 
32 views
Christmas Tin Box Metal Candy Storage Jar Buffalo Plaid Santa Snowman Penguin Gingerbread Man Shape Holiday Gift Container
Christmas Tin Box Metal Candy Storage Jar Buffalo Plaid Santa Snowman Penguin Gingerbread Man Shape Holiday Gift Container
like
Find Similar
Christmas Santa Claus tin container with festive red plaid hat for candies and cookies - Santa Claus
Christmas snowman tin box candy container with winter scarf and holiday decor - Snowman
Christmas penguin tin box with red plaid scarf for candy and cookie gift packaging - Penguin Style
Gingerbread man shaped tin box with red bow pattern for Christmas candy packaging - Gingerbread Man
Christmas Tin Box Metal Candy Storage Jar Buffalo Plaid Santa Snowman Penguin Gingerbread Man Shape Holiday Gift Container
$1.64
Mix MOQ : 2
Car Back Seat Hanging Tissue Box Cover Popcorn Fabric With 3D Flower Ins Style Cute Organizer For Auto Headrest
Car Back Seat Hanging Tissue Box Cover Popcorn Fabric With 3D Flower Ins Style Cute Organizer For Auto Headrest
like
Find Similar
Detail of black bubble texture car headrest tissue box holder with yellow flower - Black Bubble Fabric-Khaki Large 6-Petal Flower
Detail of black bubble texture car tissue holder with 3D cream flower ornament - Black Bubble Fabric-Beige Large 6-Petal Flower
Detail of cream puff fabric car tissue holder with brown floral accent and handle - Beige Bubble Fabric-Khaki Large 6-Petal Flower
White popcorn textured car tissue holder with 3D floral accent and hanging strap - Beige Bubble Fabric-Beige Large 6-Petal Flower
+20
Car Back Seat Hanging Tissue Box Cover Popcorn Fabric With 3D Flower Ins Style Cute Organizer For Auto Headrest
$3.52-3.60
No MOQ
 · 
27 views
Borosilicate Glass Oil Dispenser Bottle With Gravity Automatic Flip Lid Leak Proof For Kitchen Vinegar Soy Sauce Cooking
Borosilicate Glass Oil Dispenser Bottle With Gravity Automatic Flip Lid Leak Proof For Kitchen Vinegar Soy Sauce Cooking
like
Find Similar
Minimalist 500ml glass oil bottle in greyish white with automatic lid and sticker set - 1PC
Set of 2 glass oil bottles 500ml with auto-open lids and seasoning label stickers - 2-Piece Set
Set of 3 leakproof glass oil dispensers in grey white with 500ml capacity and labels - 3 Piece Set
4-piece glass oil dispenser set with 500ml grey automatic flip lids and labels - 4 Pcs Pack
Borosilicate Glass Oil Dispenser Bottle With Gravity Automatic Flip Lid Leak Proof For Kitchen Vinegar Soy Sauce Cooking
-5%
$2.46-7.94
No MOQ
 · 
10 sold recently
Portable Round Metal Pill Case With Mirror Marble Texture Keychain Jewelry Organizer Travel Pocket Box
Portable Round Metal Pill Case With Mirror Marble Texture Keychain Jewelry Organizer Travel Pocket Box
like
Find Similar
Mini round metal pill box keychain with pink and gold marble pattern decorative surface - Round Pill Box + Keychain / Pink Flow Gold
Portable silver metal pill box keychain with green abstract marble pattern lid - Round Pill Box + Keychain / Green Flowing Gold
Portable silver metal pill box keychain with red marble top and snap hook connector - Round Pill Box + Keychain + Lobster Clasp / Pink Flow Gold
Mini round silver metal pill box keychain with green and gold abstract art pattern - Round Pill Box + Keychain + Lobster Clasp / Green Flowing Gold
Portable Round Metal Pill Case With Mirror Marble Texture Keychain Jewelry Organizer Travel Pocket Box
$0.84-1.04
No MOQ
 · 
14 sold recently
Modern Ceramic Candle Jar With Lid Geometric Gold Quatrefoil Pattern Decorative Storage Canister For Home Accents Or Gift
Modern Ceramic Candle Jar With Lid Geometric Gold Quatrefoil Pattern Decorative Storage Canister For Home Accents Or Gift
like
Find Similar
Pink ceramic geometric candle jar with gold quatrefoil pattern and lid for home decor - Pink Geometric Style (B款)
Light blue ceramic storage jar with golden quatrefoil pattern and matching lid - Light Blue Geometric Style (C款)
Luxurious dark green ceramic storage jar with golden geometric clover patterns and lid - Dark Green Geometric Style (D款)
Modern Ceramic Candle Jar With Lid Geometric Gold Quatrefoil Pattern Decorative Storage Canister For Home Accents Or Gift
$6.92
Mix MOQ : 2
 · 
34 views
Kraft Paper Gift Boxes With Handles Portable Candy Cake Treat Packaging For Wedding Birthday Party Holiday Favors
Kraft Paper Gift Boxes With Handles Portable Candy Cake Treat Packaging For Wedding Birthday Party Holiday Favors
like
Find Similar
Brown kraft paper gift box with handle and rustic decorations on white surface - 11.5*8.5*15.5cm / Kraft Paper Color
White kraft paper gift box with handle and clear window for pastry or candy packaging - 11.5*8.5*15.5cm / White
Kraft Paper Gift Boxes With Handles Portable Candy Cake Treat Packaging For Wedding Birthday Party Holiday Favors
$0.12
Mix MOQ : 50
 · 
30 sold recently
Transparent Plastic Storage Box With Flip Lid Dustproof Moisture-Proof Jewelry Bead Case Small Large Size Organizer Box
Transparent Plastic Storage Box With Flip Lid Dustproof Moisture-Proof Jewelry Bead Case Small Large Size Organizer Box
like
Find Similar
Compact square transparent plastic storage box with a hinged flip-top lid and rounded corners - Small Size 7.5x7.5cm
Minimalist transparent plastic storage box with flip lid and secure buckle closure - Large Size 8.5x8.5cm
Transparent rectangular plastic storage box with vertical stripes and flip top lid - Single Box 25x10x9cm
Transparent plastic storage set with large outer case and small inner containers - Small Size Storage Box Set
+3
Transparent Plastic Storage Box With Flip Lid Dustproof Moisture-Proof Jewelry Bead Case Small Large Size Organizer Box
$0.26-6.92
No MOQ
 · 
22 views
Transparent Frosted EVA Jewelry Storage Ziplock Bag Dustproof Oxidation Resistant Small Accessories Packaging Protective Pouch
Transparent Frosted EVA Jewelry Storage Ziplock Bag Dustproof Oxidation Resistant Small Accessories Packaging Protective Pouch
like
Find Similar
Set of transparent EVA storage bags for jewelry and small toys on a grey background - Frosted EVA (7*10CM)
Pink and white cat paw plush in transparent EVA self-sealing bag on a desk - Transparent EVA (15*15CM)
Frosted EVA jewelry storage bags for earrings and rings shown on minimalist background - Frosted EVA (15*15CM)
Frosted EVA jewelry zipper bag 8x6CM showing a gold heart necklace inside - Transparent EVA (6*8CM)
+8
Transparent Frosted EVA Jewelry Storage Ziplock Bag Dustproof Oxidation Resistant Small Accessories Packaging Protective Pouch
-12%
$0.07-0.11
Mix MOQ : 2
 · 
89 views
Cartoon Dinosaur Piggy Bank Large Capacity Shatterproof PVC Vinyl Saving Pot Cute Animal Coin Bank Gift For Kids Boys
Cartoon Dinosaur Piggy Bank Large Capacity Shatterproof PVC Vinyl Saving Pot Cute Animal Coin Bank Gift For Kids Boys
like
Find Similar
Green cartoon dinosaur piggy bank for boys with orange back scales and round shape - Funny Dragon / Cyan
Green cartoon dinosaur piggy bank for boys, cute birthday gift, size 13x15x20cm - Funny Dragon / Blue
Cartoon Dinosaur Piggy Bank Large Capacity Shatterproof PVC Vinyl Saving Pot Cute Animal Coin Bank Gift For Kids Boys
-4%
$4.33
No MOQ
 · 
10 sold recently
Handwoven Willow Seagrass Storage Basket With Lid Wood Button Vintage Natural Desktop Organizer Jewelry Gift Box Home Decor
Handwoven Willow Seagrass Storage Basket With Lid Wood Button Vintage Natural Desktop Organizer Jewelry Gift Box Home Decor
like
Find Similar
Handwoven square seagrass storage basket with lid and toggle button, size 14x14x9cm - Small / 14x14x9
Handwoven square wicker storage box with lid and button closure, 17x17x10cm size - M / 17x17x10
Handwoven 20x20x12cm square seagrass storage box with natural fiber lid and wooden toggle - Large / 20x20x12
Three-piece set of woven storage baskets with lids and wooden toggle closures - Small Medium Large Combination
Handwoven Willow Seagrass Storage Basket With Lid Wood Button Vintage Natural Desktop Organizer Jewelry Gift Box Home Decor
-5%
$3.43-10.96
No MOQ
 · 
16 views
Christmas Round Tinplate Storage Box Metal Candy Gift Case For Holiday Party Decor Festive Pattern
Christmas Round Tinplate Storage Box Metal Candy Gift Case For Holiday Party Decor Festive Pattern
like
Find Similar
12-pack Christmas tin gift boxes in a red display tray with festive holiday designs - Set of 24 Pieces
Christmas Round Tinplate Storage Box Metal Candy Gift Case For Holiday Party Decor Festive Pattern
-5%
$21.35
No MOQ
 · 
1 reviews
Portable Mini Transparent Plastic Square Storage Box For Jewelry Earplugs Small Parts Multi Purpose PP Organization Container
Portable Mini Transparent Plastic Square Storage Box For Jewelry Earplugs Small Parts Multi Purpose PP Organization Container
like
Find Similar
Clear mini square plastic storage box with flip lid dimensions 3.5x3.5x2cm for jewelry - Square Style / Clear
Portable Mini Transparent Plastic Square Storage Box For Jewelry Earplugs Small Parts Multi Purpose PP Organization Container
$0.04
No MOQ
 · 
15 views
Korean Marble Texture Strawberry Heart Pattern Square Paper Gift Box For Soap Chocolate Tea Packaging Jewelry Display Box
Korean Marble Texture Strawberry Heart Pattern Square Paper Gift Box For Soap Chocolate Tea Packaging Jewelry Display Box
like
Find Similar
Square marble style gift box with red strawberry and lip prints on cream background - Sweet Strawberry
Square marble texture gift box with drawer design and elegant decorative label - Classic Marble
Korean Marble Texture Strawberry Heart Pattern Square Paper Gift Box For Soap Chocolate Tea Packaging Jewelry Display Box
-4%
$0.24
No MOQ
 · 
31 views
Car Sun Visor Organizer Bag PU Leather Multi Pocket Card Holder Zipper Mesh Sunglasses Clip Automotive Interior Travel
Car Sun Visor Organizer Bag PU Leather Multi Pocket Card Holder Zipper Mesh Sunglasses Clip Automotive Interior Travel
like
Find Similar
Detailed view of grey PU leather car visor organizer with card slots and mesh pocket - Double Zipper / Gray
Grey PU leather car sun visor organizer with mesh pocket, card slots and zipper pocket - Single Zipper / Gray
Detail of dark blue faux leather car sun visor organizer with multi-card slots and mesh pocket - Single Zipper / Navy Blue
Detail view of black PU leather car sun visor organizer with card slots and mesh pocket - Single Zipper / Black
+6
Car Sun Visor Organizer Bag PU Leather Multi Pocket Card Holder Zipper Mesh Sunglasses Clip Automotive Interior Travel
-5%
$2.60-3.43
Mix MOQ : 2
 · 
21 views
Mermaid Party Favor Gift Boxes Purple Undersea World Theme Paper Handheld Candy Treat Box For Ocean Birthday Baby Shower
Mermaid Party Favor Gift Boxes Purple Undersea World Theme Paper Handheld Candy Treat Box For Ocean Birthday Baby Shower
like
Find Similar
Purple mermaid theme paper gift box with sea shell pattern and carry handle - Purple Portable Box - Mermaid
Purple mermaid theme underwater world square gift box with shell and pearl patterns - Purple Portable Box - Pearl Clam
Purple underwater world gift box with seahorse pattern and handle for cookies and candy - Purple Portable Box - Seahorse
Mermaid Party Favor Gift Boxes Purple Undersea World Theme Paper Handheld Candy Treat Box For Ocean Birthday Baby Shower
$0.22
Mix MOQ : 50
 · 
29 views
Clear Square Plastic Storage Box Transparent PP Small Jewelry Organizer Case With Hinged Lid For Earring Craft Small Parts
Clear Square Plastic Storage Box Transparent PP Small Jewelry Organizer Case With Hinged Lid For Earring Craft Small Parts
like
Find Similar
Mini transparent square PP plastic storage box with flip lid, size 4.5x4.5cm - 4.5x4.5x1.9cm
Compact 5.5cm clear PP plastic square storage box with a secure hinged lid for jewelry - 5.5x5.5x2cm
Square clear PP plastic organizer box 6.5cm with hinged lid for jewelry and small parts - 6.5x6.5x2cm
Square transparent PP plastic storage box with 7.5cm x 7.5cm dimensions and flip lid - 7.5x7.5x2.6cm
+2
Clear Square Plastic Storage Box Transparent PP Small Jewelry Organizer Case With Hinged Lid For Earring Craft Small Parts
-14%
$0.04-0.18
No MOQ
 · 
18 views
Handmade Cotton Rope Woven Storage Basket Cute Cherry Handbag Christmas Reindeer Snowman Gift Bag For Picnic Home Desk Organizer
Handmade Cotton Rope Woven Storage Basket Cute Cherry Handbag Christmas Reindeer Snowman Gift Bag For Picnic Home Desk Organizer
like
Find Similar
Handwoven red and white cotton rope storage basket with cherry charms and dual handles - Red Cherry Bag (19cm Diameter)
Cute cherry and reindeer Christmas woven cotton rope storage bag for holiday picnic - Candy Reindeer
Handmade red and white woven cotton bucket bag with cute cartoon smiley face and tassels - Little Braid Man
Handmade woven cotton cherry tote bag with festive snowman and red plush star decorations - Star Snowman
+1
Handmade Cotton Rope Woven Storage Basket Cute Cherry Handbag Christmas Reindeer Snowman Gift Bag For Picnic Home Desk Organizer
$3.75
No MOQ
Portable Tinplate Storage Box With Lid Cute Ins Style Desktop Organizer For Photo Cards Stationery Jewelry Metal Container
Portable Tinplate Storage Box With Lid Cute Ins Style Desktop Organizer For Photo Cards Stationery Jewelry Metal Container
like
Find Similar
Purple tin storage box with stylish prints arranged on a clean white desk with decor - Black and White Bookmark Frame
Portable Tinplate Storage Box With Lid Cute Ins Style Desktop Organizer For Photo Cards Stationery Jewelry Metal Container
$0.58
Mix MOQ : 2
 · 
54 views
Mini Safe Piggy Bank Metal Money Saving Box With Combination Lock And Keys For Kids Adults Desktop Decor
Mini Safe Piggy Bank Metal Money Saving Box With Combination Lock And Keys For Kids Adults Desktop Decor
like
Find Similar
Matte black mini metal dictionary safe with combination lock and keys for savings - Black
Pink mini book safe money box with mechanical combination lock and key entry - Pink
Red mini metal safe money box with mechanical combination dial and key lock - Red
Mini dictionary safe box 18cm with mechanical lock and keys in black and white colors - White
+1
Mini Safe Piggy Bank Metal Money Saving Box With Combination Lock And Keys For Kids Adults Desktop Decor
$10.68
No MOQ
 · 
41 views
Kawaii Cartoon Animal Piggy Bank Vinyl Taiyaki Croissant Hat Cat Capybara Money Box Desktop Ornament Kids Gift
Kawaii Cartoon Animal Piggy Bank Vinyl Taiyaki Croissant Hat Cat Capybara Money Box Desktop Ornament Kids Gift
like
Find Similar
Cartoon cat piggy bank wearing an orange fish hat with a matching gift box - Taiyaki Cat
Cute Capybara Piggy Bank wearing orange Taiyaki hat for home decor 16.8x12.1x16cm - Taiyaki Capybara
Pink pig money box in yellow Taiyaki hat, baking pet theme coin bank, 16.8x12.1x16cm - Taiyaki Pig
Cute Taiyaki Duck piggy bank in yellow vinyl for kids, non-openable 16cm saving jar - Taiyaki Duck
+4
Kawaii Cartoon Animal Piggy Bank Vinyl Taiyaki Croissant Hat Cat Capybara Money Box Desktop Ornament Kids Gift
$6.05
No MOQ
 · 
11 views
Rhinestone Pill Bottle Keychain Aluminum Alloy Waterproof Sealing Divided Capsule Case Mini Portable Medicine Container
Rhinestone Pill Bottle Keychain Aluminum Alloy Waterproof Sealing Divided Capsule Case Mini Portable Medicine Container
like
Find Similar
Sparkling rhinestone mini medicine bottle keychain with waterproof metal sealing - White
Macro detail of purple and silver rhinestone pill container with keychain metal hook - White + Purple
Detailed view of a pink rhinestone-encrusted capsule pill box with a silver key ring - Solid Pink
Detail of black rhinestone studded pill bottle with waterproof screw cap and key ring - Pure Black
+5
Rhinestone Pill Bottle Keychain Aluminum Alloy Waterproof Sealing Divided Capsule Case Mini Portable Medicine Container
$4.55
Mix MOQ : 3
 · 
28 views
Free Shipping
Handmade Cotton Rope Woven Storage Basket With Lid Cute Animal Embroidery Patchwork Desktop Organizer For Kids Room Home Decor
Handmade Cotton Rope Woven Storage Basket With Lid Cute Animal Embroidery Patchwork Desktop Organizer For Kids Room Home Decor
like
Find Similar
Handcrafted pink woven storage basket with black bows and lid for home organization - Rose Red Bow (22*19)
Sky blue woven storage basket with pink handle and black bow details for home decor - Cyan Bow (22*19)
Blue hand-woven cotton storage basket with pink long-ear handles and cute puppy design - Cyan Puppy (22*19)
Woven cotton rope storage basket with pink handles and cute puppy embroidery - White Spotted Dalmatian (22*19)
+11
Handmade Cotton Rope Woven Storage Basket With Lid Cute Animal Embroidery Patchwork Desktop Organizer For Kids Room Home Decor
$3.46-6.63
No MOQ
Electric Piggy Bank Automatic Money Box Eating Coin Bank With Music And Sound ABS Plastic Desktop Decoration Toy Gift
Electric Piggy Bank Automatic Money Box Eating Coin Bank With Music And Sound ABS Plastic Desktop Decoration Toy Gift
like
Find Similar
Kaonashi electronic piggy bank holding a red plate for automatic coin storage - Robe Character Battery Model
Black Daruma-style electronic piggy bank with a red tray and decorative retail box - Black Daruma Battery Model
Panda robotic money bank with bamboo tray and electronic music features for saving - Panda Style
Brown monster design electric coin bank with a green tray in a cozy home setting - Brown Monster Model
+2
Electric Piggy Bank Automatic Money Box Eating Coin Bank With Music And Sound ABS Plastic Desktop Decoration Toy Gift
$6.63-8.93
No MOQ
 · 
24 sold recently
Rectangular Tinplate Storage Container With Lid Metal Desktop Organizer Butterfly Pattern For Stationery Cards Sweet Style
Rectangular Tinplate Storage Container With Lid Metal Desktop Organizer Butterfly Pattern For Stationery Cards Sweet Style
like
Find Similar
Close-up of pink tin storage box with floral patterns and butterfly illustrations - Butterfly Flower Style / Pink
Close-up of light blue tin storage box featuring romantic butterfly illustrations - Butterfly Love Style / Green
Detail of a purple star pattern tin storage box on a stylish white textured background - Gradient Star Style / Purple
Rectangular Tinplate Storage Container With Lid Metal Desktop Organizer Butterfly Pattern For Stationery Cards Sweet Style
$1.30
Mix MOQ : 2
 · 
16 views
Ceramic Lard Jar Seasoning Container With Lid And Spoon Heat Resistant Modern Cartoon Kitchen Household Storage
Ceramic Lard Jar Seasoning Container With Lid And Spoon Heat Resistant Modern Cartoon Kitchen Household Storage
like
Find Similar
880ml ceramic lard jar with lid and handles featuring blue kitchen utensil pattern - Modern Double Handle Small 880ml (With Spoon)
White ceramic lard container with 1500ml capacity and blue trim for kitchen storage - Modern Double Handle Large 1500ml (With Spoon)
White ceramic lard pot with cartoon egg print and blue rim, 460ml capacity with lid - Classic Stew Pot 460ml (No Opening)
Japanese style ceramic lard jar with lid and spoon, 1400ml white oil storage container - Double Handle 1400ml (With Strainer + Spoon)
+3
Ceramic Lard Jar Seasoning Container With Lid And Spoon Heat Resistant Modern Cartoon Kitchen Household Storage
$2.85-6.28
No MOQ
 · 
15 views
Nordic Acrylic Translucent Storage Box With Lid Dustproof Desktop Organizer For Cosmetics Jewelry Stationery Magazines
Nordic Acrylic Translucent Storage Box With Lid Dustproof Desktop Organizer For Cosmetics Jewelry Stationery Magazines
like
Find Similar
Blue translucent acrylic storage box with white text design and lid for desktop storage - Small Blue
Translucent green acrylic storage box with lid and IDEA logo and side handle - Small Green
Minimalist translucent navy blue acrylic storage box with white IDEA logo and NO. 3 label - M Blue
Translucent green acrylic storage box with lid and white NO.3 printed design - M Green
+2
Nordic Acrylic Translucent Storage Box With Lid Dustproof Desktop Organizer For Cosmetics Jewelry Stationery Magazines
-5%
$15.06-31.48
No MOQ
 · 
17 views
Handmade Woven Seagrass Storage Box With Lid Vintage Desktop Organizer Basket Pastoral Style Natural Plant Fiber Sundry Container Home Decor
Handmade Woven Seagrass Storage Box With Lid Vintage Desktop Organizer Basket Pastoral Style Natural Plant Fiber Sundry Container Home Decor
like
Find Similar
Detail view of a woven storage box showing 28x24x6.5cm dimensions and a wood button closure - Small
Detailed view of handmade woven storage box with lid, dimensions 32x28x7cm and weight 354g - Large
Detailed macro view of natural straw storage boxes with elastic button closure system - Large and Small Combination
Handmade Woven Seagrass Storage Box With Lid Vintage Desktop Organizer Basket Pastoral Style Natural Plant Fiber Sundry Container Home Decor
$5.62-11.53
No MOQ
 · 
16 views
Drawer Gift Box Cardboard Chocolate Tea Packaging Case Geometric Wave Snowflake Pattern French Merci Party Wedding Candy Box
Drawer Gift Box Cardboard Chocolate Tea Packaging Case Geometric Wave Snowflake Pattern French Merci Party Wedding Candy Box
like
Find Similar
Detail of white drawer gift box with grey woven pattern and merci beaucoup label - Roman Space (Wave Pattern)
Detail view of black drawer gift box with white polka dots and merci beaucoup label - Black Snowflake
Drawer Gift Box Cardboard Chocolate Tea Packaging Case Geometric Wave Snowflake Pattern French Merci Party Wedding Candy Box
-5%
$0.54
No MOQ
 · 
22 views
Ceramic Tea Canister Hand Painted Green Bamboo Pattern Airtight Aluminum Alloy Lid Vintage Chinese Style Storage Jar
Ceramic Tea Canister Hand Painted Green Bamboo Pattern Airtight Aluminum Alloy Lid Vintage Chinese Style Storage Jar
like
Find Similar
Mini ceramic tea canister with green bamboo pattern and grey lid, 400ml capacity - 400ml/Short / Short Style-Yingyue Tea Caddy
Hand-painted green bamboo ceramic tea canister 620ml with airtight lid in hand - 620ml/Tall / Tall Style-Yinxiang Tea Caddy
Ceramic Tea Canister Hand Painted Green Bamboo Pattern Airtight Aluminum Alloy Lid Vintage Chinese Style Storage Jar
-5%
$11.22-12.05
No MOQ
 · 
25 views
Clear Plastic Square Storage Box Transparent PP Jewelry Earring Organizer Mini Components Packing Box With Lid
Clear Plastic Square Storage Box Transparent PP Jewelry Earring Organizer Mini Components Packing Box With Lid
like
Find Similar
Set of transparent 3.4cm square PP plastic storage boxes with secure snap lid closure - 3.4x3.4x2cm
Mini transparent square PP plastic storage box with flip lid, size 4.5x4.5cm - 4.5x4.5x1.9cm
Compact 5.5cm clear PP plastic square storage box with a secure hinged lid for jewelry - 5.5x5.5x2cm
Square clear PP plastic organizer box 6.5cm with hinged lid for jewelry and small parts - 6.5x6.5x2cm
+3
Clear Plastic Square Storage Box Transparent PP Jewelry Earring Organizer Mini Components Packing Box With Lid
$0.06-0.20
No MOQ
 · 
16 views
Multi-Compartment Transparent Plastic Jewelry Organizer Box Adjustable Removable Dividers Small Parts Storage Case For Beads Crafts
Multi-Compartment Transparent Plastic Jewelry Organizer Box Adjustable Removable Dividers Small Parts Storage Case For Beads Crafts
like
Find Similar
Detailed view of a 10-compartment clear plastic jewelry box with a pink snap closure - Multi-compartment / White with Pink Clasp
Detail of 10-compartment clear jewelry box with blue latch and hanging hole feature - Multi-compartment / White with Blue Clasp
Pink translucent 10-compartment jewelry box with white buckle and side hanging hole - Multi-compartment / Pink
Detailed close-up of 10-compartment transparent orange plastic storage box with secure latch - Multi-compartment / Orange
+1
Multi-Compartment Transparent Plastic Jewelry Organizer Box Adjustable Removable Dividers Small Parts Storage Case For Beads Crafts
-6%
$0.45
No MOQ
 · 
10 views
Transparent PETG Plastic Press Refillable Dispenser Portable Travel Liquid Storage For Makeup Remover Toner Wide Mouth
Transparent PETG Plastic Press Refillable Dispenser Portable Travel Liquid Storage For Makeup Remover Toner Wide Mouth
like
Find Similar
Travel size 100ml clear pump bottle for makeup remover with white dispenser head - 100ml
Portable 150ml clear plastic pump bottle for makeup remover and toner travel storage - 150ML
200ML clear plastic travel dispenser bottle with white press pump for makeup - 200ml
Transparent PETG Plastic Press Refillable Dispenser Portable Travel Liquid Storage For Makeup Remover Toner Wide Mouth
$0.61-0.79
Mix MOQ : 2
 · 
33 sold recently
Floral Canvas Earphone Case Bag Mini Fabric Storage Pouch With Snap Button Hanging Hook For Wireless Headphones Coin Travel
Floral Canvas Earphone Case Bag Mini Fabric Storage Pouch With Snap Button Hanging Hook For Wireless Headphones Coin Travel
like
Find Similar
Detailed view of floral canvas earphone pouch with pink handle and carabiner clip - Beige
Close-up of floral mini storage pouch with blue handles and pink button detail - Blue
Floral mini pouch with pink checkered handle and hook shown in a lifestyle desk setup - Pink
Floral mini earphone pouch with colorful sozakka logo, red handles and carabiner - Red
+3
Floral Canvas Earphone Case Bag Mini Fabric Storage Pouch With Snap Button Hanging Hook For Wireless Headphones Coin Travel
-13%
$1.22
No MOQ
 · 
13 views
Free Shipping
Weekly Pill Organizer Aluminum Alloy Waterproof Portable Metal Keychain Moisture-Proof Detachable Medicine Container
Weekly Pill Organizer Aluminum Alloy Waterproof Portable Metal Keychain Moisture-Proof Detachable Medicine Container
like
Find Similar
7-tier rainbow aluminum alloy waterproof pill box case with portable keychain ring - Colorful
7-day aluminum alloy waterproof pill box case with portable detachable stackable segments - Silver
Macro view of a 7-day black aluminum pill organizer with detachable waterproof compartments - Black
Weekly Pill Organizer Aluminum Alloy Waterproof Portable Metal Keychain Moisture-Proof Detachable Medicine Container
$4.84-5.71
Mix MOQ : 2
 · 
26 views
Non-Woven Gift Bag Fresh Floral Pattern Best Wishes Print Handbag For Party Birthday Wedding Dessert Packaging
Non-Woven Gift Bag Fresh Floral Pattern Best Wishes Print Handbag For Party Birthday Wedding Dessert Packaging
like
Find Similar
Waterproof non-woven floral tote bag with Best Wishes text for gift packaging - Non-Woven Fabric / Ethnic Complex Floral Style (4016-4) / 23x22x11cm
Floral waterproof non-woven tote bag with black and white retro plant prints for gifts - Non-Woven Fabric / Black White Vintage Botanical Style (4016-1) / 23x22x11cm
Floral waterproof non-woven gift bag with BEST WISHES text and ribbon handles - Non-Woven Fabric / Fresh Colorful Floral Style (4016-3) / 23x22x11cm
Floral laminated non-woven gift bag with butterfly patterns and ribbon handles - Non-Woven Fabric / Vintage Floral Butterfly Style (4016-2) / 23x22x11cm
Non-Woven Gift Bag Fresh Floral Pattern Best Wishes Print Handbag For Party Birthday Wedding Dessert Packaging
$0.23
Mix MOQ : 12
 · 
13 views
Transparent Acrylic Display Case Magnetic Sliding Lid Storage Box For TCG Booster Box Protective Card Collection Case Desktop Organizer
Transparent Acrylic Display Case Magnetic Sliding Lid Storage Box For TCG Booster Box Protective Card Collection Case Desktop Organizer
like
Find Similar
Clear acrylic Pokémon booster pack display box with 5.5 inch inner storage space - Transparent Single
Three-piece set of transparent acrylic TCG display cases with sliding lids for booster boxes - Transparent Multi-Pack
Transparent Acrylic Display Case Magnetic Sliding Lid Storage Box For TCG Booster Box Protective Card Collection Case Desktop Organizer
$7.93-23.05
No MOQ
 · 
23 views
Cotton Rope Woven Tissue Box Holder Oval Desktop Sundries Storage Basket With Cover For Bedroom Living Room Home Decor
Cotton Rope Woven Tissue Box Holder Oval Desktop Sundries Storage Basket With Cover For Bedroom Living Room Home Decor
like
Find Similar
Macro shot showing detailed dimensions and 291g weight of white woven cotton tissue box - White
Detailed view of woven cotton rope tissue box with lid, measuring 23cm by 15cm by 10cm - Khaki
Detail view of woven cotton rope tissue box with dimensions 23x15x10cm and black stitching - White with Black Line
Cotton Rope Woven Tissue Box Holder Oval Desktop Sundries Storage Basket With Cover For Bedroom Living Room Home Decor
$2.31
No MOQ
 · 
10 views
Nordic Acrylic Wood Makeup Organizer Multi Layer Desktop Cosmetics Storage Box With Drawers Dustproof Skincare Display Stand
Nordic Acrylic Wood Makeup Organizer Multi Layer Desktop Cosmetics Storage Box With Drawers Dustproof Skincare Display Stand
like
Find Similar
Modern 4-tier wood and acrylic cosmetic organizer with two drawers and gold handles - 4-Tier 2-Drawers
4-tier acrylic and wood grain desktop storage rack, 30x34cm open shelf design - 4-Tier No Drawer
Minimalist 3-tier acrylic and wood desktop storage organizer with dimensions 30x16.3x34cm - 3-Tier No Drawer
Five-tier desktop acrylic storage rack with wood shelves and dimensions 30x16.3x34cm - 5-Tier No Drawer
+1
Nordic Acrylic Wood Makeup Organizer Multi Layer Desktop Cosmetics Storage Box With Drawers Dustproof Skincare Display Stand
-41%
$13.96-26.83
No MOQ
 · 
57 views
Go to

More in home & kitchen

Explore more in storage boxes, bottles & jars

storagepartysquaremetalflipwhitewalllayerwindowsteel
desktopsmalldisplaykidsroundholderadjustabletopheartgold

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access