Everful

Wholesale scarves & wraps

An ever-growing assortment of factory-direct styles, updated daily.

Sign Up
Scarves & Wraps

Find the perfect pieces: bandanas, shawls, scarves and more

Popular collections in scarves & wraps

All products in scarves & wraps

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Solid Color Satin Polyester Silk-Like Neckerchief For Women Korean Style Long Narrow Decorative Scarf Elegant Head Scarf Accessory
Solid Color Satin Polyester Silk-Like Neckerchief For Women Korean Style Long Narrow Decorative Scarf Elegant Head Scarf Accessory
like
Find Similar
Elegant champagne silk neck scarf tied in a bow on a stylish magazine background - Beige
Elegant dark green silk satin skinny scarf on a hanger for women's fashion styling - Dark Green
Elegant solid dark purple skinny silk scarf tied in a bow on a professional hanger display - Purple
Elegant long black silk-satin skinny scarf tied on a hanger with fashion accessories - Black
+3
Solid Color Satin Polyester Silk-Like Neckerchief For Women Korean Style Long Narrow Decorative Scarf Elegant Head Scarf Accessory
$1.82
No MOQ
 · 
10 sold recently
Solid Color Crinkle Pleated Scarf For Women Cotton Linen Blend Breathable Large Wrap Hijab With Fringe Edge Ethnic Scarf Shawl
Solid Color Crinkle Pleated Scarf For Women Cotton Linen Blend Breathable Large Wrap Hijab With Fringe Edge Ethnic Scarf Shawl
like
Find Similar
Brown crinkle cotton linen scarf for women with fringe edges on a half body mannequin - Brown/Khaki
Solid grey pleated cotton linen scarf for women featuring a lightweight wrinkled texture - Gray
Lightweight red linen cotton scarf with elegant fringe trim for women in ethnic style - Red (24)
Purple crinkled cotton linen scarf with frayed edges displayed on a wooden hanger - Light Purple
+127
Solid Color Crinkle Pleated Scarf For Women Cotton Linen Blend Breathable Large Wrap Hijab With Fringe Edge Ethnic Scarf Shawl
$1.15
Mix MOQ : 10
 · 
42 sold recently
Korean Style Ribbed Knit Scarf For Women Winter Warm Acrylic Solid Color Thickened Neck Warmer Soft Stylish Pashmina Scarf
Korean Style Ribbed Knit Scarf For Women Winter Warm Acrylic Solid Color Thickened Neck Warmer Soft Stylish Pashmina Scarf
like
Find Similar
Thick brown ribbed knit scarf for winter warmth with a soft textured minimalist design - Coffee
Brown ribbed knit scarf in soft thick wool with small white label on light background - Caramel color
Thick dark green ribbed knit scarf with soft texture and small white label for winter - Christmas Green
Thick black knitted winter scarf with brand tag being held against a cozy background - Black
+23
Korean Style Ribbed Knit Scarf For Women Winter Warm Acrylic Solid Color Thickened Neck Warmer Soft Stylish Pashmina Scarf
$4.06
Mix MOQ : 2
 · 
212 sold recently
Elegant Square Scarf Ginkgo Leaf Print Polyester Satin Like Fashion Neck Head Accessory Handbag Wrap For Women
Elegant Square Scarf Ginkgo Leaf Print Polyester Satin Like Fashion Neck Head Accessory Handbag Wrap For Women
like
Find Similar
Close-up of a Morandi green silk scarf with ginkgo leaf patterns on a straw mat - 70*70cm / Green
Elegant ginkgo leaf silk scarf with orange and beige panels on a woven background - 70*70cm / Orange
Detail of silk square scarf showing green ginkgo leaf pattern and silky smooth texture - 70*70cm / Pink
Elegant Square Scarf Ginkgo Leaf Print Polyester Satin Like Fashion Neck Head Accessory Handbag Wrap For Women
$1.12
No MOQ
 · 
59 sold recently
Paisley Satin Square Scarf For Women Silky Polyester Head Scarf Neck Wrap Floral Pattern Hijab Fashion Accessory Gift
Paisley Satin Square Scarf For Women Silky Polyester Head Scarf Neck Wrap Floral Pattern Hijab Fashion Accessory Gift
like
Find Similar
Close-up of black and brown paisley silk satin square scarf draped on a metal rack - 90cm*90cm / Black
Detail of rose red paisley satin square scarf on a rose gold metal display stand - 90cm*90cm / Rose Red
Detail view of red paisley print square silk scarf hanging to show texture and gloss - 90cm*90cm / Red
Detailed view of navy blue and white paisley pattern satin silk square scarf texture - 90cm*90cm / Navy Blue
+3
Paisley Satin Square Scarf For Women Silky Polyester Head Scarf Neck Wrap Floral Pattern Hijab Fashion Accessory Gift
-5%
$1.31
No MOQ
 · 
18 sold recently
Fruit Print Double Layer Narrow Scarf Polyester Satin Skinny Twilly Ribbon For Bag Handle Neck Hair Wrap Accessory
Fruit Print Double Layer Narrow Scarf Polyester Satin Skinny Twilly Ribbon For Bag Handle Neck Hair Wrap Accessory
like
Find Similar
Elegant white satin twilly scarf with yellow citrus print on a minimalist black tray - Green Lemon Print
Elegant peach print double-layered silk scarf tied in a bow on a black tray with bag - Pink Peach Print
Narrow silk twilly with orange fruit print and vibrant orange border on black tray - Orange Citrus Print
Fruit Print Double Layer Narrow Scarf Polyester Satin Skinny Twilly Ribbon For Bag Handle Neck Hair Wrap Accessory
-4%
$1.75
Mix MOQ : 2
 · 
30 sold recently
Women Modern Geometric Polka Dot Print Square Scarf Elegant Faux Satin Satin Neck Scarf Fashion Scarf For Daily Commuting
Women Modern Geometric Polka Dot Print Square Scarf Elegant Faux Satin Satin Neck Scarf Fashion Scarf For Daily Commuting
like
Find Similar
Detail view of square silk scarf showing geometric pattern and fine rolled hem edges - 70cmx70cm / Blue (70FJ500-Blue)
Detailed view of the vibrant geometric patterned satin scarf with fine hemmed edges - 70cmx70cm / Green (70FJ500-Green)
Detailed view of silk-like square scarf featuring geometric circles and warm color blocking - 70cmx70cm / Pink (70FJ500-Pink)
Vertical view of a satin square scarf featuring pink and orange geometric patterns - 70cmx70cm / Purple (70FJ500-Purple)
Women Modern Geometric Polka Dot Print Square Scarf Elegant Faux Satin Satin Neck Scarf Fashion Scarf For Daily Commuting
-5%
$1.51
No MOQ
 · 
13 sold recently
Retro Paisley Satin Square Scarf Twill Satin Like Bandana For Women Office Casual Daily Hijab Luxury Fashion Accessory
Retro Paisley Satin Square Scarf Twill Satin Like Bandana For Women Office Casual Daily Hijab Luxury Fashion Accessory
like
Find Similar
Luxurious beige paisley silk scarf draped over a white shirt with camellia hanger decor - Khaki
Classic black and gold paisley silk satin square scarf displayed on an elegant hanger - Black Gold
Vintage paisley print large square satin silk scarf in bronze yellow with floral patterns - Black Yellow
Vintage paisley silk scarf in brown and black with a silver buckle on a hanger - Coffee
Retro Paisley Satin Square Scarf Twill Satin Like Bandana For Women Office Casual Daily Hijab Luxury Fashion Accessory
$2.07
No MOQ
 · 
10 sold recently
Women High Quality Satin Chiffon Pleated Scarf Elegant Solid Color Long Scarf Sunshade Shawl Wrap Accessories Fashion Scarf
Women High Quality Satin Chiffon Pleated Scarf Elegant Solid Color Long Scarf Sunshade Shawl Wrap Accessories Fashion Scarf
like
Find Similar
Classic black satin chiffon scarf with pleated texture and soft drape finish - 180*70cm / Black
Premium dark blue satin chiffon pleated long scarf with soft draped texture finish - 180*70cm / Deep Blue
Folded khaki pleated satin chiffon scarf with a soft texture on white background - 180*70cm / Camel (4#)
Brown satin chiffon pleated scarf with soft drape texture on white background - 180*70cm / Coffee (5#)
+33
Women High Quality Satin Chiffon Pleated Scarf Elegant Solid Color Long Scarf Sunshade Shawl Wrap Accessories Fashion Scarf
-5%
$2.81
No MOQ
 · 
70 views
Paisley Floral Print Artificial Satin Square Scarf Satin Smooth Neck Head Bandana For Women Fashion Accessories
Paisley Floral Print Artificial Satin Square Scarf Satin Smooth Neck Head Bandana For Women Fashion Accessories
like
Find Similar
Detailed close-up of champagne paisley silk square scarf with fine rolled edge finish - 70cmx70cm / Gray
Elegant 70cm yellow paisley floral satin silk square scarf on aesthetic lifestyle background - 70cmx70cm / Gold
Red paisley floral silk square scarf with decorative gift box for elegant summer fashion - 70cmx70cm / Burgundy
Macro shot of navy blue paisley floral silk scarf with luxury branding and textures - 70cmx70cm / Teal
+2
Paisley Floral Print Artificial Satin Square Scarf Satin Smooth Neck Head Bandana For Women Fashion Accessories
$1.41
Mix MOQ : 2
 · 
100 sold recently
Floral Embroidery Lace Triangle Scarf Bridal Veil For Women Church Mantilla Elegant French Vintage Mesh Wrap Hair Accessory
Floral Embroidery Lace Triangle Scarf Bridal Veil For Women Church Mantilla Elegant French Vintage Mesh Wrap Hair Accessory
like
Find Similar
Vintage brown floral lace triangle scarf with delicate embroidery and scalloped edges - Vintage Floral Embroidery Wave Edge Style (VS769-6) / Dark Coffee
Elegant grey floral lace bridal veil with delicate embroidery and scalloped edges - Vintage Floral Embroidery Wave Edge Style (VS769-4) / Dark Gray
Elegant dark purple lace veil with intricate floral embroidery and scalloped edges - Vintage Floral Embroidery Wave Edge Style (VS769-5) / Dusky Pink
Pink floral lace embroidered triangle scarf bandana for women with delicate wavy edges - Vintage Floral Embroidery Wave Edge Style (VS769-7) / Snow Bud
+22
NewFloral Embroidery Lace Triangle Scarf Bridal Veil For Women Church Mantilla Elegant French Vintage Mesh Wrap Hair Accessory
-4%
$3.29
No MOQ
 · 
11 views
Free Shipping
Printed Square Scarf Cotton Linen Blend Artistic Geometric Patterns Multi Use Neck Tie Hair Band Accessories For Women
Printed Square Scarf Cotton Linen Blend Artistic Geometric Patterns Multi Use Neck Tie Hair Band Accessories For Women
like
Find Similar
Chic red and pink geometric stripe cotton linen neck scarf tied in a stylish knot - Red
Linen cotton neck scarf featuring pink and blue geometric patterns in a tied bow style - Beige
Light green cotton linen square scarf with pink and dark green abstract stripe patterns - Green
Elegant beige square neck scarf with brown and pink leaf print tied in a knot - Coffee
+26
Printed Square Scarf Cotton Linen Blend Artistic Geometric Patterns Multi Use Neck Tie Hair Band Accessories For Women
$1.73
No MOQ
 · 
24 sold recently
Women Paisley Scarf Tassel Long Shawl Wrap Ethnic Style Elegant Soft Pashmina Feeling Winter Accessory
Women Paisley Scarf Tassel Long Shawl Wrap Ethnic Style Elegant Soft Pashmina Feeling Winter Accessory
like
Find Similar
Elegant deep red paisley wool shawl with golden floral patterns and tassels on a coat - 1# Date Red
Elegant dark red paisley scarf with tassels draped over a beige coat for a stylish look - 2# Black Red
Close-up of blue paisley scarf with red fringes and handmade label on an elegant coat - 3# Blue Green
Elegant navy paisley scarf with tassels draped over a white wool coat in a classic style - 4# Dark Green
+16
Women Paisley Scarf Tassel Long Shawl Wrap Ethnic Style Elegant Soft Pashmina Feeling Winter Accessory
-5%
$4.65
No MOQ
 · 
48 views
Women Vintage Floral Bird Print Satin Square Scarf Elegant Pink Silk Like Neck Scarf Decorative Chinoiserie Fashion Accessory
Women Vintage Floral Bird Print Satin Square Scarf Elegant Pink Silk Like Neck Scarf Decorative Chinoiserie Fashion Accessory
like
Find Similar
90cm silk twill scarf with birds and floral patterns, hanging as elegant wall decor - 90x90cm / Jungle Floral Bird Pink
Women Vintage Floral Bird Print Satin Square Scarf Elegant Pink Silk Like Neck Scarf Decorative Chinoiserie Fashion Accessory
$5.19
No MOQ
 · 
16 views
Elegant Women Chiffon Scarf Gradient Flower Bird Print Lightweight Long Satin Feel Wrap Shawl Vintage Chinese Style
Elegant Women Chiffon Scarf Gradient Flower Bird Print Lightweight Long Satin Feel Wrap Shawl Vintage Chinese Style
like
Find Similar
Chiffon long scarf for women with blue-green gradient and traditional Chinese flower bird print - Blue Green Gradient
Pink chiffon scarf with gradient flower and bird print for women, soft artistic style - Pink
Detail of elegant magpie and floral print on lightweight chiffon silk scarf for women - Violet
Detail of magpie and floral print on lightweight chiffon scarf with elegant draping - Black and White Gradient
+6
Elegant Women Chiffon Scarf Gradient Flower Bird Print Lightweight Long Satin Feel Wrap Shawl Vintage Chinese Style
$1.06
No MOQ
 · 
138 sold recently
Vintage Western Cowboy Bolo Tie Retro Embossed Flower Alloy Pendant Adjustable Braided Artificial Leather Cord Necklace
Vintage Western Cowboy Bolo Tie Retro Embossed Flower Alloy Pendant Adjustable Braided Artificial Leather Cord Necklace
like
Find Similar
Western vintage silver floral bolo tie with black braided leather rope and metal tips - Antique Silver
Vintage western bolo tie with golden floral engraved medallion and black woven cord - Bronze
Vintage Western Cowboy Bolo Tie Retro Embossed Flower Alloy Pendant Adjustable Braided Artificial Leather Cord Necklace
-4%
$2.14
Mix MOQ : 2
 · 
14 sold recently
Floral Print Mulberry Satin Square Scarf Twill Neck Scarf For Women Professional Commuter Elegant Sun Protection Neckerchief
Floral Print Mulberry Satin Square Scarf Twill Neck Scarf For Women Professional Commuter Elegant Sun Protection Neckerchief
like
Find Similar
Floral silk twill square scarf with blue and beige contrast print and dark satin border - 65*65cm / Pink Purple
Floral Print Mulberry Satin Square Scarf Twill Neck Scarf For Women Professional Commuter Elegant Sun Protection Neckerchief
$14.41
No MOQ
 · 
2 reviews
Free Shipping
Mulberry Satin Square Scarf Twill Double Sided Plant Leaf Print Fashion Elegant Office Scarf For Women
Mulberry Satin Square Scarf Twill Double Sided Plant Leaf Print Fashion Elegant Office Scarf For Women
like
Find Similar
Silk twill square scarf with retro green leaf pattern and contrast border - One Size / Retro Bean Green Leaf Print (ZW-18-Black Border)
Mulberry Satin Square Scarf Twill Double Sided Plant Leaf Print Fashion Elegant Office Scarf For Women
$14.41
No MOQ
 · 
2 reviews
Free Shipping
Satin Satin Like Square Scarf Fashion Floral Leopard Geometric Print Neck Head Wrap Hair Accessory For Women
Satin Satin Like Square Scarf Fashion Floral Leopard Geometric Print Neck Head Wrap Hair Accessory For Women
like
Find Similar
Square silk scarf with blue and white geometric patterns tied in an elegant style - 5 3D Geometric Lines Blue
Elegant silk scarf featuring orange and brown geometric patterns tied in a stylish knot - 6 3D Lines Orange Red
Modern geometric silk scarf with navy and yellow color blocking in a knot style - 7 3D Lines Yellow
Light blue and cream square silk scarf with black floral outlines tied in a bow - 23 Sketch Floral Green
+2
Satin Satin Like Square Scarf Fashion Floral Leopard Geometric Print Neck Head Wrap Hair Accessory For Women
$1.44
No MOQ
 · 
23 sold recently
Twilly Scarf Long Skinny Necktie For Women French Style Geometric Print Polyester Twill Bag Handle Ribbon Hair Accessory
Twilly Scarf Long Skinny Necktie For Women French Style Geometric Print Polyester Twill Bag Handle Ribbon Hair Accessory
like
Find Similar
Macro shot of silk-style checkered scarf with France-Paris motif on orange gift box - 5*85cm / Pink (France-Paris Print)
Twilly Scarf Long Skinny Necktie For Women French Style Geometric Print Polyester Twill Bag Handle Ribbon Hair Accessory
$1.18
Mix MOQ : 2
 · 
22 sold recently
Free Shipping
Retro Scarf Necklace Paisley Print Satin Texture Small Square Neck Wrap For Women Vintage Ethnic Style Accessory
Retro Scarf Necklace Paisley Print Satin Texture Small Square Neck Wrap For Women Vintage Ethnic Style Accessory
like
Find Similar
Detailed texture of dark brown paisley silk scarf tied on a vintage English art book - Brown
Retro Scarf Necklace Paisley Print Satin Texture Small Square Neck Wrap For Women Vintage Ethnic Style Accessory
$1.44
No MOQ
 · 
149 sold recently
Free Shipping
Bohemian Paisley Floral Print Satin Square Scarf Large Silk-Like Headwrap Neck Scarf For Women Vintage Fashion Accessory
Bohemian Paisley Floral Print Satin Square Scarf Large Silk-Like Headwrap Neck Scarf For Women Vintage Fashion Accessory
like
Find Similar
Classic paisley and floral 90cm square silk scarf with elegant satin finish in red and black - Red
Elegant square silk scarf with floral paisley print in pink and gold tones hanging softly - Pink
Classic paisley and floral print satin silk square scarf in vibrant green and orange - Orange & Yellow
Deep royal blue square silk scarf featuring vintage paisley and golden vine patterns - Blue
+2
Bohemian Paisley Floral Print Satin Square Scarf Large Silk-Like Headwrap Neck Scarf For Women Vintage Fashion Accessory
-4%
$1.07
No MOQ
 · 
11 sold recently
Medieval Hooded Capelet Cloak Polyester Cosplay Costume Christmas Party Witch Shawl For Women
Medieval Hooded Capelet Cloak Polyester Cosplay Costume Christmas Party Witch Shawl For Women
like
Find Similar
Women's black hooded Christmas capelet with medieval witch cosplay style and long pointed hood - Black
Medieval Hooded Capelet Cloak Polyester Cosplay Costume Christmas Party Witch Shawl For Women
-5%
$9.03
No MOQ
 · 
50 views
Women Elegant Floral Print Satin Square Scarf Vintage Silk-Like Neck Head Scarf Fashion Accessories Large Flower Pattern Wrap
Women Elegant Floral Print Satin Square Scarf Vintage Silk-Like Neck Head Scarf Fashion Accessories Large Flower Pattern Wrap
like
Find Similar
Elegant imitation silk peony flower scarf for women, 70cm professional square shawl - Khaki
Elegant 70cm square silk scarf with vintage peony flower pattern and yellow borders - Gold Yellow
Elegant purple silk-like square scarf with orange peony floral print design 70cm - Light Purple
Women Elegant Floral Print Satin Square Scarf Vintage Silk-Like Neck Head Scarf Fashion Accessories Large Flower Pattern Wrap
$1.35
No MOQ
 · 
36 sold recently
Solid Color Narrow Skinny Scarf Polyester Satin Ribbon For Bag Handle Hair Tie Neck Decoration Multipurpose Women
Solid Color Narrow Skinny Scarf Polyester Satin Ribbon For Bag Handle Hair Tie Neck Decoration Multipurpose Women
like
Find Similar
Detailed view of the sky blue satin skinny scarf tied around a handbag handle - 100x4cm / Sky Blue
Detail of navy blue satin skinny scarf for bag handle decoration in a sleek X-fold layout - 100x4cm / Navy Blue
Detail shot of khaki silk narrow scarf with pointed ends for bag handle decoration - 100x4cm / Khaki
Macro shot of royal blue satin ribbon accessory with silky finish and clean edges - 100x4cm / Sapphire Blue
+26
Solid Color Narrow Skinny Scarf Polyester Satin Ribbon For Bag Handle Hair Tie Neck Decoration Multipurpose Women
-5%
$0.37
No MOQ
 · 
678 sold recently
Vintage Satin Large Square Scarf For Women Floral Paisley Horse Bit Print Hijab Headscarf Fashion Shawl Wrap Accessory
Vintage Satin Large Square Scarf For Women Floral Paisley Horse Bit Print Hijab Headscarf Fashion Shawl Wrap Accessory
like
Find Similar
Pink satin square scarf with shell and seaweed print on a minimalist black display stand - Shell Flower Print / Pink Shell Flower
Bohemian paisley satin silk scarf in peacock green and red draped on a metal frame - Paisley Print / Peacock Blue Paisley
Bohemian paisley printed 90x90cm satin silk scarf with black base and colorful patterns - Paisley Print / Black Paisley
Detail of silk-like satin scarf featuring white magnolia print on deep blue fabric - Floral Print / Emerald Green Floral
+17
NewVintage Satin Large Square Scarf For Women Floral Paisley Horse Bit Print Hijab Headscarf Fashion Shawl Wrap Accessory
$1.39
No MOQ
 · 
12 views
Floral Embroidery Chiffon Shawl Cardigan Women Lightweight Tulle Sun Protection Beach Cover Up Ruffle Cuff Elegant
Floral Embroidery Chiffon Shawl Cardigan Women Lightweight Tulle Sun Protection Beach Cover Up Ruffle Cuff Elegant
like
Find Similar
Green chiffon beach shawl with floral embroidery and white lace trim detail - 60*160CM / Two-color Flower Style Fruit Green
Yellow floral chiffon sun protection shawl with ruffle sleeves and elegant embroidery - 60*160CM / Two-color Flower Style Yellow
Purple chiffon sunscreen shawl with floral embroidery and elegant ruffled sleeves - 60*160CM / Peach Blossom Style Rose Purple
Yellow chiffon sun protection shawl with floral embroidery and ruffle sleeves - 60*160CM / Peach Blossom Style Yellow
+2
Floral Embroidery Chiffon Shawl Cardigan Women Lightweight Tulle Sun Protection Beach Cover Up Ruffle Cuff Elegant
-5%
$2.05
Mix MOQ : 2
 · 
53 views
Elegant Solid Color Bubble Chiffon Hijab Scarf For Women Lightweight Polyester Shawl Plain Wrap Muslim Headscarf Commuter Accessories
Elegant Solid Color Bubble Chiffon Hijab Scarf For Women Lightweight Polyester Shawl Plain Wrap Muslim Headscarf Commuter Accessories
like
Find Similar
Solid color light purple pearl chiffon hijab scarf wrap for women in desert setting - Lavender
Vibrant bright green pearl chiffon long scarf draped on mannequin for elegant display - Sea Green
Breathable 75D pearl chiffon headscarf in vibrant yellow color for women - Yellow
Brown long pearl chiffon headscarf for women elegantly draped on a white mannequin - Coffee
+33
Elegant Solid Color Bubble Chiffon Hijab Scarf For Women Lightweight Polyester Shawl Plain Wrap Muslim Headscarf Commuter Accessories
$1.84
No MOQ
 · 
50 views
Square Scarf Satin Polyester Cartoon Cat Print Large Headscarf Fashionable Elegant For Women
Square Scarf Satin Polyester Cartoon Cat Print Large Headscarf Fashionable Elegant For Women
like
Find Similar
Detailed view of 90cm square satin silk scarf with artistic pink abstract cat patterns - 90x90cm / Pink
Detailed shot of satin scarf featuring colorful cartoon cat prints and blue polka dot edges - 90x90cm / Blue
Satin square silk scarf featuring artistic cat illustrations and gold dot borders - 90x90cm / Dark Green
Detailed view of 90cm satin silk scarf with colorful artistic cat prints and burgundy borders - 90x90cm / Purplish Red
+2
Square Scarf Satin Polyester Cartoon Cat Print Large Headscarf Fashionable Elegant For Women
$1.30
No MOQ
 · 
10 sold recently
Solid Color Red Scarf Luxury Cashmere-Like Shawl With Fringed Tassels Minimalist Woven Polyester Scarf For Wedding Party Celebration Women Accessories
Solid Color Red Scarf Luxury Cashmere-Like Shawl With Fringed Tassels Minimalist Woven Polyester Scarf For Wedding Party Celebration Women Accessories
like
Find Similar
Elegant Chinese red wool scarf for Year of the Horse featuring fine fringe tassels - 68-195 / Red (Wide)
Solid red festive scarf and shawl with tassels for Year of the Horse celebrations - 35-195 / Red (Narrow)
Detail of red celebratory scarf featuring soft fringe and woven brand label on surface - 70-200 / Red (With Label)
Classic Year of the Horse red scarf with soft cashmere texture and elegant long fringe - 70-200 / Red (No Label)
+1
Solid Color Red Scarf Luxury Cashmere-Like Shawl With Fringed Tassels Minimalist Woven Polyester Scarf For Wedding Party Celebration Women Accessories
$1.99-4.01
Mix MOQ : 2
 · 
51 sold recently
Women Paisley Jacquard Scarf Acrylic Ethnic Style Long Tassel Fringe Shawl Warm Wrap Elegant Fashion Accessory
Women Paisley Jacquard Scarf Acrylic Ethnic Style Long Tassel Fringe Shawl Warm Wrap Elegant Fashion Accessory
like
Find Similar
Elegant black paisley jacquard scarf with tassels displayed on a wooden mannequin - Black
Dark grey paisley pattern scarf with long black tassels on a professional mannequin - Dark Gray
Detail of dark blue paisley scarf with elegant fringe trim on a wooden mannequin - Grey Blue
Detail of brown paisley acrylic scarf featuring soft fabric texture and fringe tassels - Brown
Women Paisley Jacquard Scarf Acrylic Ethnic Style Long Tassel Fringe Shawl Warm Wrap Elegant Fashion Accessory
-5%
$4.73
No MOQ
 · 
10 sold recently
Narrow Long Satin Scarf Double Sided Printed Satin Ribbon For Hair Neck Bag Decoration Elegant French Retro Women
Narrow Long Satin Scarf Double Sided Printed Satin Ribbon For Hair Neck Bag Decoration Elegant French Retro Women
like
Find Similar
Floral print and yellow satin bow hair tie with long ribbons on a wooden tray - 8*110cm / Yellow Floral
Purple plaid and solid patchwork satin bow hair accessory with long ribbon tail - 8*110cm / Purple Checkerboard
Narrow satin hair scarf with purple floral print and solid reverse on a wooden tray - 8*110cm / Purple Floral
Narrow silk scarf headband with black and white checkerboard pattern and bow design - 8*110cm / Black Checkerboard
+16
Narrow Long Satin Scarf Double Sided Printed Satin Ribbon For Hair Neck Bag Decoration Elegant French Retro Women
$1.59
No MOQ
 · 
18 sold recently
Free Shipping
Square Scarf Printed Polyester Satin Fashion Neck Hair Band Lightweight Accessories Elegant Soft Smooth Head Wrap
Square Scarf Printed Polyester Satin Fashion Neck Hair Band Lightweight Accessories Elegant Soft Smooth Head Wrap
like
Find Similar
Silk square scarf with cartoon cat prints in orange and pink hues, knotted in a frame - 14 Pink Polka Dot Cat
Elegant 70cm silk square scarf featuring floral prints and geometric yellow accents - 18 Grey Geometric Leaf
Silk square scarf in orange and dark green color block with a delicate grid pattern - 3 Green Grid Box
Silk-textured scarf with green borders and hand-drawn cartoon cat prints for women - 13 Green Polka Dot Cat
+10
Square Scarf Printed Polyester Satin Fashion Neck Hair Band Lightweight Accessories Elegant Soft Smooth Head Wrap
$1.44
No MOQ
Women Vintage Chain Print Satin Square Scarf Retro Equestrian Pattern Silk Feeling Headscarf Bandana For Beach Holiday
Women Vintage Chain Print Satin Square Scarf Retro Equestrian Pattern Silk Feeling Headscarf Bandana For Beach Holiday
like
Find Similar
Macro detail of silk satin scarf featuring vintage gold chains and belt patterns - Blue (Large Style)
Vintage chain print silk scarf in green and ivory featuring elegant equestrian motifs - Cyan (90cm Long And Wide) / One Size
Detailed close-up of vintage chain print silk scarf with equestrian heraldic patterns - White (90cm Long And 90cm Wide) / One Size
Detail of red and cream square scarf with vintage gold chain and leather belt patterns - Red (90cm Long And 90cm Wide) / One Size
+2
Women Vintage Chain Print Satin Square Scarf Retro Equestrian Pattern Silk Feeling Headscarf Bandana For Beach Holiday
$0.40-1.10
No MOQ
 · 
422 sold recently
Women Solid Color Tassel Scarf Thick Imitation Cashmere Warm Pashmina Wrap Winter Elegant Soft Polyester Scarf For Women
Women Solid Color Tassel Scarf Thick Imitation Cashmere Warm Pashmina Wrap Winter Elegant Soft Polyester Scarf For Women
like
Find Similar
Solid red cashmere scarf with fringe and embroidery label for autumn winter warmth - 70×200cm / Wine Red
Thick warm camel faux cashmere scarf for women with elegant tassel and embroidery finish - 70×200cm / Camel
Elegant blue cashmere scarf with fringe details and woven brand label on white lace - 70×200cm / Sapphire Blue
Solid red cashmere scarf for women featuring tassels and classic embroidery for winter - 70×200cm / Red
+28
Women Solid Color Tassel Scarf Thick Imitation Cashmere Warm Pashmina Wrap Winter Elegant Soft Polyester Scarf For Women
-4%
$1.92
No MOQ
 · 
59 sold recently
Rainbow Plaid Winter Scarf Polyester Thick Warm Long Shawl With Colorful Pom-pom Tassels For Women
Rainbow Plaid Winter Scarf Polyester Thick Warm Long Shawl With Colorful Pom-pom Tassels For Women
like
Find Similar
Rainbow plaid scarf for women featuring colorful pom-poms and a soft knit texture - Rainbow Plaid
Colorful plaid winter scarf for women featuring plush pom-pom trim and a thick fringe design - Neon Plaid
Rainbow plaid scarf in yellow and brown tones with colorful pom-pom tassels on display - Earth Yellow Plaid
Grey gradient knit scarf with colorful pompom tassels and wool blend texture - Black and White Plaid
+1
Rainbow Plaid Winter Scarf Polyester Thick Warm Long Shawl With Colorful Pom-pom Tassels For Women
-4%
$5.48
Mix MOQ : 2
 · 
16 sold recently
Women Pleated Square Scarf Wrinkled Solid Color Bandana Fashion Elegant Large Headscarf Neck Scarf
Women Pleated Square Scarf Wrinkled Solid Color Bandana Fashion Elegant Large Headscarf Neck Scarf
like
Find Similar
Elegant white pleated square scarf made of soft linen-imitation silk fabric for women - White
Elegant black pleated faux linen square scarf with premium crinkle texture on white base - Black
Detailed macro view of deep blue pleated fabric texture on a minimalist white cube pedestal - Navy Blue
Deep green pleated square scarf in premium cotton-linen imitation with elegant drape - Green
+16
Women Pleated Square Scarf Wrinkled Solid Color Bandana Fashion Elegant Large Headscarf Neck Scarf
$2.88
No MOQ
 · 
32 sold recently
Ombre Scarf For Women Gradient Cotton Linen Lightweight Sun Protection Shawl Thin Breathable Tie Dye Wrap
Ombre Scarf For Women Gradient Cotton Linen Lightweight Sun Protection Shawl Thin Breathable Tie Dye Wrap
like
Find Similar
Detail of gradient blue to beige lightweight shawl with smooth fabric texture transition - Deep Blue to Beige Gradient (Color 2)
Detail of gradient olive green to beige lightweight cotton-feel scarf fabric - Olive Green to Beige Gradient (Color 3)
Detail of gradient lightweight shawl scarf showing soft sky blue and magenta color transitions - Rose Red to Deep Blue Gradient (Color 4)
Detail of soft gradient shawl featuring peach to sky blue transition on lightweight fabric - Pink Orange to Sky Blue Gradient (Color 5)
+3
Ombre Scarf For Women Gradient Cotton Linen Lightweight Sun Protection Shawl Thin Breathable Tie Dye Wrap
$3.03
Mix MOQ : 3
Lace Shawl Wrap For Women Elegant Floral Hollow Out Tassels Evening Party Wedding Dress Accessory Polyester
Lace Shawl Wrap For Women Elegant Floral Hollow Out Tassels Evening Party Wedding Dress Accessory Polyester
like
Find Similar
Close-up of black floral lace shawl featuring delicate embroidery and long tassel fringe - Black
Close-up of silver lace shawl with floral embroidery and elegant long fringe trim - Gray
Elegant hollow lace shawl with paisley patterns and fringe tassels for evening parties - Camel
Detail of beige lace shawl featuring intricate hollow embroidery and delicate tassels - Beige
+3
Lace Shawl Wrap For Women Elegant Floral Hollow Out Tassels Evening Party Wedding Dress Accessory Polyester
-4%
$1.59
No MOQ
 · 
17 sold recently
Solid Color Winter Scarf Warm Imitation Cashmere Long Pashmina Wrap With Tassels For Women Elegant Casual Fashion
Solid Color Winter Scarf Warm Imitation Cashmere Long Pashmina Wrap With Tassels For Women Elegant Casual Fashion
like
Find Similar
Thick grey fringe scarf made of soft cashmere-like fabric with a leather brand label - 70*200cm / No.28 Medium Gray
Pale pink solid color fringed scarf in thick faux cashmere with brand tag on a black tray - 70*200cm / No.4 Maple Red
Red thick cashmere-like knitted scarf with tassels and leather label for winter - 70*200cm / No.2 Jujube Red
Thick lavender tassel scarf made of soft cashmere-like fabric for winter warmth - 70*200cm / No.17 Grape Purple
+46
Solid Color Winter Scarf Warm Imitation Cashmere Long Pashmina Wrap With Tassels For Women Elegant Casual Fashion
-4%
$5.48
Mix MOQ : 2
Women Bohemian Ethnic Paisley Print Shawl Scarf Polyester Tassel Sunscreen Large Wrap For Seaside Beach Travel
Women Bohemian Ethnic Paisley Print Shawl Scarf Polyester Tassel Sunscreen Large Wrap For Seaside Beach Travel
like
Find Similar
Long cotton linen scarf for women with colorful floral patterns and fringe details - 180*90CM / 37111-Orange Red Mixed
Cotton-linen beach shawl with black and white artistic animal hand-drawn patterns - 180*90CM / 37101-Animal Typography Black White
Close-up of lightweight silk scarf with colorful geometric patterns in a lifestyle setting - 180*90CM / 37132-Colorful Blocks
Women's cotton linen shawl with red vintage geometric print and fringe tassels - 180*90CM / 37133-Red White Retro
+41
Women Bohemian Ethnic Paisley Print Shawl Scarf Polyester Tassel Sunscreen Large Wrap For Seaside Beach Travel
$3.31
Mix MOQ : 2
 · 
33 sold recently
Metallic Luster Square Scarf Women Y2K Retro Hip Hop Bandana Liquid Silver Black Gold Leopard Print Headwrap Fashion Scarf
Metallic Luster Square Scarf Women Y2K Retro Hip Hop Bandana Liquid Silver Black Gold Leopard Print Headwrap Fashion Scarf
like
Find Similar
Close-up of a black metallic silk scarf with glossy texture on an aesthetic book - Approx 60*60cm / Black
Close-up of knotted black square scarf with silver metallic marble texture on silk satin - Approx 60*60cm / Black Silver
Detail of a chic black and gold satin headscarf with an abstract leopard pattern - Approx 60*60cm / Black & Gold
Macro shot of silver metallic bandana with knot design for Y2K street style outfit - Approx 60*60cm / Liquid Silver
+5
Metallic Luster Square Scarf Women Y2K Retro Hip Hop Bandana Liquid Silver Black Gold Leopard Print Headwrap Fashion Scarf
$2.25
No MOQ
Women Small Square Satin Scarf Satin Faux Satin Printed Neckerchief Hair Band Bag Accessory Vintage Elegant Fashion
Women Small Square Satin Scarf Satin Faux Satin Printed Neckerchief Hair Band Bag Accessory Vintage Elegant Fashion
like
Find Similar
Floral satin square scarf in Tiffany blue and burnt orange with fine purple stitching - Geometric Flower (FX-25)
Yellow silk square scarf with dark blue heart patterns tied in a stylish knot - Large Heart Yellow (FX-13)
Square satin scarf with yellow chain print for hair or neck stylish fashion accessory - Chain Yellow (FX-15) / 【product Attributes】this Product Is A 【yellow Printed Silk Scarf】 Visually Estimated To Be 【real Silk Or Imitation Silk】 With A 【pattern】printed With Vintage-style Chains Belts And Jewelry Elements. The Scarf Is Displayed Tied In A Loop Showcasing The Fine 【rolled/bound Edges】. 【visual Presentation】the Image Uses A Single-item Posed Style Placed On A White Textured Background With A Magazine And Pink Flowers On The Left As 【props】 Creating An Elegant And Sophisticated French Fashion Atmosphere. The Image Quality Is 【high】 With Clear Details And Soft Lighting. The Aesthetic Appeal Is 【high】 With An Overall Score Of 【8.5】. The Props And Product Have A Unified Color Scheme And A Strong Sense Of Unity. 【text Content】only Includes 【prop_text】printed Text From The Background Magazine Considered Part Of The Prop Requiring No Processing. 【logistics Label】none. 【infringement Risk】the Product's Pattern Uses Common Fashion Elements And Has No Obvious Logo Therefore It Is 【none】 With A Probability Of 【0.0】. 【product Parameters】the Main Color Is Yellow And The Pattern Is A Combination Of Chains And Belts.
Peacock blue silk neckerchief with equestrian horse carriage print in bow shape - Wheel Green (FX-19)
+18
Women Small Square Satin Scarf Satin Faux Satin Printed Neckerchief Hair Band Bag Accessory Vintage Elegant Fashion
$1.01
Mix MOQ : 2
 · 
16 sold recently
Ginkgo Leaf Embroidered Imitation Cashmere Shawl Long Thick Tassel Scarf For Women Elegant Vintage Winter Pashmina Wrap
Ginkgo Leaf Embroidered Imitation Cashmere Shawl Long Thick Tassel Scarf For Women Elegant Vintage Winter Pashmina Wrap
like
Find Similar
Blue cashmere-feel shawl with elegant floral ginkgo embroidery and stylish fringe trim - 200*70cm / Ginkgo Leaf Embroidery-Peacock Blue
Elegant black cashmere wool scarf for women with ginkgo embroidery and long tassels - 200*70cm / Ginkgo Leaf Embroidery-Black
Beige cashmere wool shawl featuring embroidered ginkgo leaves and elegant tassels - 200*70cm / Ginkgo Leaf Embroidery-Beige
Elegant red cashmere shawl with ginkgo embroidery and tassels worn by a model - 200*70cm / Ginkgo Leaf Embroidery-Jujube Red
+19
Ginkgo Leaf Embroidered Imitation Cashmere Shawl Long Thick Tassel Scarf For Women Elegant Vintage Winter Pashmina Wrap
$6.77
No MOQ
 · 
113 sold recently
Women Long Scarf Shawl Solid Color Soft Faux Satin Satin Large Lightweight Wrap Elegant Fashion Summer Beach
Women Long Scarf Shawl Solid Color Soft Faux Satin Satin Large Lightweight Wrap Elegant Fashion Summer Beach
like
Find Similar
Close-up of grey satin silk scarf hanging on a hanger with stylish minimalist props - Silver
Detailed texture of a white satin scarf draped elegantly over a leather sofa setting - White
Elegant off-white satin scarf draped on a leather sofa with chic lifestyle accessories - Beige
Elegant solid pink silk scarf draped over a black top with stylish fashion accessories - Light Pink
+16
Women Long Scarf Shawl Solid Color Soft Faux Satin Satin Large Lightweight Wrap Elegant Fashion Summer Beach
-4%
$3.43
Mix MOQ : 2
 · 
18 sold recently
Women Chiffon Scarf Hijab With Artificial Pearls And Rhinestones Elegant Solid Color Long Wrap Muslim Fashion Accessories
Women Chiffon Scarf Hijab With Artificial Pearls And Rhinestones Elegant Solid Color Long Wrap Muslim Fashion Accessories
like
Find Similar
Detail of burgundy chiffon hijab featuring elegant white pearl beadwork and light texture - 2# Bright Wine Red
Light grey pearl chiffon long scarf with rhinestones for elegant sun protection - Light Gray
Elegant black premium chiffon scarf featuring white pearl dots in a gradient pattern - 12# Black
Women Chiffon Scarf Hijab With Artificial Pearls And Rhinestones Elegant Solid Color Long Wrap Muslim Fashion Accessories
-5%
$3.88
No MOQ
 · 
53 sold recently
Women Ethnic Paisley Cotton Scarf Vintage Jacquard Tassel Shawl Soft Warm Autumn Winter Wrap Multicolor Patterned Large Scarf
Women Ethnic Paisley Cotton Scarf Vintage Jacquard Tassel Shawl Soft Warm Autumn Winter Wrap Multicolor Patterned Large Scarf
like
Find Similar
Ethnic paisley cashmere feel pashmina shawl with tassel fringe in blue and brown colors - 70*180cm / T130-04 Blue Brown Beige
Detail of red paisley cashmere-feel scarf with intricate patterns and elegant fringe trim - 70*180cm / T139-01 Brown Red
Detail of orange and grey paisley pattern scarf with fringes hanging on wood bar - 70*180cm / T139-02 Orange Grey
Detail of black cashmere-feel pashmina with blue paisley patterns and fringe tassels - 70*180cm / T139-03 Black Blue Beige
+20
Women Ethnic Paisley Cotton Scarf Vintage Jacquard Tassel Shawl Soft Warm Autumn Winter Wrap Multicolor Patterned Large Scarf
$8.07
No MOQ
 · 
23 sold recently
Pure Australian Wool Scarf For Women Men Winter Thermal Soft Solid Color Long Neck Wrap With Tassel Fashion Elegant
Pure Australian Wool Scarf For Women Men Winter Thermal Soft Solid Color Long Neck Wrap With Tassel Fashion Elegant
like
Find Similar
Off-white pure Australian wool scarf with long tassels and 100 percent wool label - Oatmeal
Pink pure Australian wool scarf with tassels, soft winter neck warmer for women - Light Pink
Creamy white 100% Australian wool scarf featuring long fringe tassels and soft texture - White
Beige pure Australian wool scarf with tassels and 100% wool material label - Beige
+49
Pure Australian Wool Scarf For Women Men Winter Thermal Soft Solid Color Long Neck Wrap With Tassel Fashion Elegant
$8.93
Mix MOQ : 2
 · 
22 sold recently
Bowknot Ring And Scarf Clip Titanium Steel 18K Gold Plated Glossy Elegant Fashion Accessory For Women
Bowknot Ring And Scarf Clip Titanium Steel 18K Gold Plated Glossy Elegant Fashion Accessory For Women
like
Find Similar
Macro shot of 18K gold bow-shaped ring with polished texture on a stone background - Bow Scarf Buckle/Ring / Bright Gold
Bowknot Ring And Scarf Clip Titanium Steel 18K Gold Plated Glossy Elegant Fashion Accessory For Women
-9%
$3.48
No MOQ
 · 
13 views
Free Shipping
Elegant Sheer Chiffon Shawl Scarf Solid Color Lightweight Transparent Wrap For Wedding Evening Party Bride Bridesmaid
Elegant Sheer Chiffon Shawl Scarf Solid Color Lightweight Transparent Wrap For Wedding Evening Party Bride Bridesmaid
like
Find Similar
Elegant dark coffee satin shawl for evening dresses with smooth silk glossy finish - Coffee
Detailed back view of a sheer blue bridal shawl draped over a black evening dress - Lake Blue
Silver-grey lightweight sheer shawl draped elegantly over a black dress on studio model - Light Silver
Elegant mauve chiffon wedding shawl scarf for bridesmaids paired with black dress - Dusty Pink
+19
Elegant Sheer Chiffon Shawl Scarf Solid Color Lightweight Transparent Wrap For Wedding Evening Party Bride Bridesmaid
-4%
$3.26
No MOQ
 · 
21 views
Bohemian Scarf Shawl Polyester Voile Abstract Leaf Print Tassels Lightweight Sun Protection Breathable For Women
Bohemian Scarf Shawl Polyester Voile Abstract Leaf Print Tassels Lightweight Sun Protection Breathable For Women
like
Find Similar
Linen-feel printed scarf with bohemian leaf patterns and decorative fringed edges - Pink
Blue printed scarf with leaf patterns and tassels for women, lightweight cotton feel shawl - Blue
Linen feel printed scarf with leaf patterns and tassels in light green and yellow - Green
Bohemian printed scarf with abstract leaves and orange blue tassels on white background - Colorful
+1
Bohemian Scarf Shawl Polyester Voile Abstract Leaf Print Tassels Lightweight Sun Protection Breathable For Women
$3.31
Mix MOQ : 5
 · 
10 sold recently
Floral Cotton Square Scarf Breathable Headscarf Necktie With Crochet Lace Trim Vintage Decorative Accessory For Women
Floral Cotton Square Scarf Breathable Headscarf Necktie With Crochet Lace Trim Vintage Decorative Accessory For Women
like
Find Similar
Beige cotton linen small square scarf featuring green leaf print and lace trim edges - Three-color Dense Leaves - Beige
Floral cotton linen neck scarf in light blue with crochet edge and leaf print - Three-color Dense Leaves - Blue
Cotton linen neck scarf with beige leaf pattern and brown crochet lace trim - Three-color Dense Leaves - Brown
Lace-trimmed cotton linen neck scarf featuring purple rose floral patterns - Rose Pink
+33
Floral Cotton Square Scarf Breathable Headscarf Necktie With Crochet Lace Trim Vintage Decorative Accessory For Women
$2.74
No MOQ
Free Shipping
Square Satin Scarf Elegant Geometric Floral Print Faux Satin Satin Headscarf Neck Scarf For Women Fashion Accessories
Square Satin Scarf Elegant Geometric Floral Print Faux Satin Satin Headscarf Neck Scarf For Women Fashion Accessories
like
Find Similar
Detailed view of square silk scarf with geometric patterns laid on a beige sweater - Champagne Gold Border Black White (FJ598-2)
Detail of silk square scarf with navy geometric patterns on beige fabric background - Navy Blue Geometric Cream (FJ598-3)
Close-up of elegant silk square scarf with geometric patterns and pink border on a white desk - Pink Border Abstract Floral (FJ598-4)
Square Satin Scarf Elegant Geometric Floral Print Faux Satin Satin Headscarf Neck Scarf For Women Fashion Accessories
$1.44
Mix MOQ : 2
 · 
22 sold recently
Women Scarf Shawl Cotton Twill Sun Protection Beach Holiday Ethnic Paisley Print Large Lightweight Accessory
Women Scarf Shawl Cotton Twill Sun Protection Beach Holiday Ethnic Paisley Print Large Lightweight Accessory
like
Find Similar
Ethnic summer sun protection beach shawl with brown paisley pattern and turquoise border - Style 20-Turquoise Border Paisley
Ethnic oversized beach shawl featuring geometric patterns and vibrant violet blue floral center - Beige-Radial Pattern
Ethnic style summer beach shawl with nautical pattern featuring fish and anchors - Space Grey-Ocean Theme
Ethnic floral print beach shawl in white lightweight fabric for summer vacation styling - Lotus-White Multicolor Ethnic Flower
+99
Women Scarf Shawl Cotton Twill Sun Protection Beach Holiday Ethnic Paisley Print Large Lightweight Accessory
$3.17
Mix MOQ : 2
 · 
19 views
Free Shipping
Satin Square Scarf Carriage Chain Print Luxury Head Wrap For Women
Satin Square Scarf Carriage Chain Print Luxury Head Wrap For Women
like
Find Similar
Elegant 90x90cm satin silk scarf with vintage carriage and chain print on a handbag - 90*90cm / Burgundy
Blue and cream carriage chain print satin silk scarf draped over a leather bag - 90*90cm / Sky Blue
Carriage chain print satin square scarf with pink and navy patterns for women 90x90cm - 90*90cm / Navy Blue
Detail of satin scarf featuring orange horse carriage and chain print styled with a handbag - 90*90cm / Orange
+2
Satin Square Scarf Carriage Chain Print Luxury Head Wrap For Women
$1.15
No MOQ
 · 
40 sold recently
Winter Warm Butterfly Print Scarf For Women Double Sided Tassel Long Shawl Pashmina Cashmere Like Thick Soft Wrap Accessories
Winter Warm Butterfly Print Scarf For Women Double Sided Tassel Long Shawl Pashmina Cashmere Like Thick Soft Wrap Accessories
like
Find Similar
Thick cashmere scarf with red butterfly pattern and elegant fringe tassels on the edges - Red
Close-up of double-sided cashmere scarf with butterfly patterns and fringed edges - Purple
Flat lay detail of beige and terracotta butterfly scarf with tassels on wood background - Khaki
Close-up of beige and black scarf with elegant butterfly print and fringe details - Black
Winter Warm Butterfly Print Scarf For Women Double Sided Tassel Long Shawl Pashmina Cashmere Like Thick Soft Wrap Accessories
-5%
$6.02
No MOQ
Fashionable Pleated Satin Square Scarf For Women Korean Style Geometric Stripe Printed Decorative Soft Neck Scarf For Daily Wear
Fashionable Pleated Satin Square Scarf For Women Korean Style Geometric Stripe Printed Decorative Soft Neck Scarf For Daily Wear
like
Find Similar
Close-up of pleated silk scarf with yellow and blue zig-zag pattern on plaid blazer - Yellow
Detail of accordion pleated silk scarf with colorful striped geometric patterns - Green
Pleated striped square scarf in orange and blue tied on a stylish plaid blazer - Caramel
Detail showing a pleated striped silk scarf styled with a brown checked blazer jacket - Pink
Fashionable Pleated Satin Square Scarf For Women Korean Style Geometric Stripe Printed Decorative Soft Neck Scarf For Daily Wear
$2.88
Mix MOQ : 2
 · 
27 sold recently
Elegant Floral Print Polyester Satin Square Scarf Korean Style Lightweight Headscarf Neckerchief For Women Shawl Accessory
Elegant Floral Print Polyester Satin Square Scarf Korean Style Lightweight Headscarf Neckerchief For Women Shawl Accessory
like
Find Similar
Floral print silk square scarf in light blue and purple draped on a leather sofa - Blue
Elegant yellow floral silk scarf for women displayed on a leather sofa with luxury props - Yellow
Floral print silk scarf styled on beige handbag with elegant fashion lifestyle aesthetic - Purple
Artistic floral printed silk scarf with vibrant orange and green patterns on handbag - Orange
Elegant Floral Print Polyester Satin Square Scarf Korean Style Lightweight Headscarf Neckerchief For Women Shawl Accessory
-5%
$1.51
No MOQ
 · 
12 sold recently
Vibrant Butterfly Print Women Faux Satin Satin Square Scarf Elegant Smooth Decorative Head Neck Wrap Fashion Accessory
Vibrant Butterfly Print Women Faux Satin Satin Square Scarf Elegant Smooth Decorative Head Neck Wrap Fashion Accessory
like
Find Similar
Elegant satin scarf with vibrant butterfly prints and smooth silk-like finish, 90cm square - 90x90cm / Pink Orange/Champagne
Vibrant pink silk-like scarf with colorful butterfly patterns hanging on a black frame - 90x90cm / Rose Pink
Elegant emerald green silk scarf with vibrant butterfly patterns on a minimalist black frame - 90x90cm / Emerald Green
Luxurious butterfly print silk satin square scarf with vibrant colors on grey background - 90x90cm / Grey
+2
Vibrant Butterfly Print Women Faux Satin Satin Square Scarf Elegant Smooth Decorative Head Neck Wrap Fashion Accessory
$1.79
No MOQ
 · 
28 sold recently
Vintage Jungle Print Square Scarf For Women Polyester Silk Feel Neck Scarf Retro Tropical Leopard Architecture Pattern Kerchief
Vintage Jungle Print Square Scarf For Women Polyester Silk Feel Neck Scarf Retro Tropical Leopard Architecture Pattern Kerchief
like
Find Similar
Elegant cotton linen scarf with tropical animal prints and floral illustration patterns - Pink & Beige (68RZW104-1)
Linen cotton scarf with vintage jungle leopard print hanging on a black rail - Yellow & Green (68RZW104-2)
Black and white square silk scarf with leopard and tropical plant prints for women - Black & Gray (68RZW104-3)
Detailed view of square silk scarf with French Toile de Jouy leopard and palm tree prints - Coffee & Orange (68RZW104-4)
Vintage Jungle Print Square Scarf For Women Polyester Silk Feel Neck Scarf Retro Tropical Leopard Architecture Pattern Kerchief
-4%
$2.33
Mix MOQ : 2
Go to

More in accessories

Explore more in scarves & wraps

squarelongstyletasseldailygeometrictravelwearkerchieftassel scarf
colorpolyesterbanddecorativetassel shawlscarf shawlhip hopsmallfaceparty

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access