Everful

Wholesale woven patches

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Woven Patches

Find the perfect pieces: handbags, shoulder bags, crossbody bags and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Woven Faux Rattan Laundry Basket Large Capacity Storage Bin With Leather Straps And Cute Cartoon Puppy Patch Organizer
Woven Faux Rattan Laundry Basket Large Capacity Storage Bin With Leather Straps And Cute Cartoon Puppy Patch Organizer
like
Find Similar
Brown woven storage baskets with cute puppy patches and sturdy leather handles - Puppy with Scarf / Large
Woven Faux Rattan Laundry Basket Large Capacity Storage Bin With Leather Straps And Cute Cartoon Puppy Patch Organizer
$6.05
No MOQ
Woven Webbing Luggage Tag DIY Embroidery Patch Keychain Bag Charm Decorative Strap With Metal Buckle For Travel Suitcase
Woven Webbing Luggage Tag DIY Embroidery Patch Keychain Bag Charm Decorative Strap With Metal Buckle For Travel Suitcase
like
Find Similar
Orange woven cotton luggage strap keychain with yellow button and metal end caps - 01 Orange Folded Strap
Blue woven canvas strap with 2.5cm width and 40cm length featuring a snap button - 02 Blue Folded Strap
Purple canvas keyring strap with bronze metal tips and snap button, 40cm length - 03 Purple Folded Strap
DIY red cotton canvas luggage strap with snap button and metal tips, 2.5cm width - Red Folded Strap (04)
+14
Woven Webbing Luggage Tag DIY Embroidery Patch Keychain Bag Charm Decorative Strap With Metal Buckle For Travel Suitcase
$0.20-0.58
No MOQ
 · 
27 views
Free Shipping
Handmade Woven Flower Patch Accessory With Real Fur And Glass Beads For DIY Headwear Clothing Decoration Winter Jewelry Women
Handmade Woven Flower Patch Accessory With Real Fur And Glass Beads For DIY Headwear Clothing Decoration Winter Jewelry Women
like
Find Similar
Close-up of handmade plush flower accessory with pink crystal beads for DIY jewelry - Pink Flower Beige Plush
Detailed close-up of handmade plush winter flower with crystal beads and soft white faux fur - Deep Purple Flower Beige Plush
Detailed view of handmade black fur flower patch with sparkling crystal beaded center - White Flower Black Plush
Handmade Woven Flower Patch Accessory With Real Fur And Glass Beads For DIY Headwear Clothing Decoration Winter Jewelry Women
-9%
$1.24
Mix MOQ : 10
Free Shipping
Embroidered Iron On Patches For Clothing DIY Cactus Feather Pineapple Decorative Applique Badges Repair Patches For T-Shirt Jeans Bags
Embroidered Iron On Patches For Clothing DIY Cactus Feather Pineapple Decorative Applique Badges Repair Patches For T-Shirt Jeans Bags
like
Find Similar
Detailed view of pink hibiscus flower embroidery patch with size dimensions 5cm by 4.6cm - 5#-Pink Hibiscus Flower
Multicolor feather embroidery patch with 8.9x3.3 cm dimensions for clothing repair - 19#-Multicolor Long Feather
Detailed embroidery patch featuring a blue cactus in a pink pot with size dimensions - 2#-Indigo Cactus Bonsai
Detail view of colorful feather embroidery patch with 7.8cm height and 2.1cm width - 11#-Colorful Striped Feather
+17
Embroidered Iron On Patches For Clothing DIY Cactus Feather Pineapple Decorative Applique Badges Repair Patches For T-Shirt Jeans Bags
$0.17-4.72
No MOQ
 · 
67 sold recently
Free Shipping
Cartoon Dog Animal Embroidered Patches Set For DIY Clothing Jackets Bags Cute Corgi Husky Shiba Inu Embroidery Applique Badges
Cartoon Dog Animal Embroidered Patches Set For DIY Clothing Jackets Bags Cute Corgi Husky Shiba Inu Embroidery Applique Badges
like
Find Similar
Embroidered Corgi dog patch for DIY clothing decoration, size 4cm by 7cm on white background - Corgi Dog Style (10715)
Pink and brown paw print embroidery patch with dimensions 3cm width and 4.1cm height - Pink Paw Print Style (10719)
Calico cat embroidered iron-on patch measuring 5.2x4.9cm for DIY clothing decor - Calico Cat Head Style (10707)
French Bulldog dog embroidery patch with golden lightning detail and dimensions 6x6.4cm - Black and White Frenchie Style (10708)
+15
Cartoon Dog Animal Embroidered Patches Set For DIY Clothing Jackets Bags Cute Corgi Husky Shiba Inu Embroidery Applique Badges
-9%
$0.16-3.78
Mix MOQ : 10
 · 
250 sold recently
Free Shipping
Western Cowgirl Embroidery Patches Pink Cowboy Boots Hat Cactus Iron On Applique For Clothing DIY Retro Style Embroidered Decor
Western Cowgirl Embroidery Patches Pink Cowboy Boots Hat Cactus Iron On Applique For Clothing DIY Retro Style Embroidered Decor
like
Find Similar
Coastal Cowgirl square embroidered patch with surfboard design 8cm x 8cm for DIY clothing - Coastal Cowgirl Surfboard Style (PE15428CT) / 8x8cm
Pink Howdy Darlin' embroidered patch with mint green border for denim jackets - Howdy Darlin Pink Letter Style (PE15458CT) / 8.7x5cm
Pink Cupid Cowgirl embroidered patch with heart and cowboy hat design for DIY clothing - Cupid Find Me A Cowboy Pink Style (PE15459CT) / 8x6.3cm
Pink cowgirl embroidery patch with Long Live Cowgirls text, size 7.5cm x 7.5cm - Long Live Cowgirls Square Pink Style (PE15461CT) / 7.5x7.5cm
+15
Western Cowgirl Embroidery Patches Pink Cowboy Boots Hat Cactus Iron On Applique For Clothing DIY Retro Style Embroidered Decor
$0.23-1.07
Mix MOQ : 10
 · 
134 sold recently
Free Shipping
Cartoon Embroidery Patches For Clothing DIY Iron On Patch Cute Decorative Appliques Polyester Fabric For Shoes Hats Bags
Cartoon Embroidery Patches For Clothing DIY Iron On Patch Cute Decorative Appliques Polyester Fabric For Shoes Hats Bags
like
Find Similar
Pink flip-flop embroidery patch for shoes and hats with silver star detail, 4.5x4.0cm size - Pink Flip Flops (8)
Blue flip-flop cartoon embroidery patch with orange starfish, size 4.5x4.0cm, style 9 - Blue Starfish Flip Flops (9)
Pink flip-flop embroidery patch with yellow dots and daisy detail, size 6.0 x 2.5 cm - Pink Daisy Flip Flops (11)
Lollipop embroidered patch in red and purple with size dimensions 12.0cm x 6.7cm - Red Lollipop (6)
+15
Cartoon Embroidery Patches For Clothing DIY Iron On Patch Cute Decorative Appliques Polyester Fabric For Shoes Hats Bags
-6%
$0.14-0.19
No MOQ
 · 
82 sold recently
Floral Embroidered Letter Patches For Clothing Alphabet Fabric Appliques Self Adhesive DIY Patch Decoration For Hats Bags
Floral Embroidered Letter Patches For Clothing Alphabet Fabric Appliques Self Adhesive DIY Patch Decoration For Hats Bags
like
Find Similar
Detailed grid view of 26 pink floral embroidery letter patches for DIY clothing and bags - Size 5cm Self-Adhesive / Rose Red
Detail of 26 alphabet floral embroidery patches with orange borders and floral patterns - Size 5cm Self-Adhesive / Orange
Detailed close-up showing all 26 floral alphabet embroidery patches with blue borders - Size 5cm Self-Adhesive / Blue
Floral Embroidered Letter Patches For Clothing Alphabet Fabric Appliques Self Adhesive DIY Patch Decoration For Hats Bags
$0.20
Mix MOQ : 2
 · 
390 sold recently
Free Shipping
Round Outdoor Adventure Embroidered Patches For Clothing Backpack Iron On Sew On Decorative Hiking Camping Badge Applique
Round Outdoor Adventure Embroidered Patches For Clothing Backpack Iron On Sew On Decorative Hiking Camping Badge Applique
like
Find Similar
Round embroidered animal paw patch with brown footprints and green grass detail - Animal Tracks Style (AZ2507E5-2-1#)
Outdoor Warriors campfire round embroidery patch 4.4x4.3cm for clothing accessories - Campfire Outdoor Warriors Style (AZ2507E5-2-2#)
Round expert troublemaker patch with slingshot embroidery and turquoise border - Slingshot Expert Style (AZ2507E5-2-3#)
Embroidered round patch featuring a rowing expert theme for outdoor apparel - Rowing Expert Style (AZ2507E5-2-4#)
+21
Round Outdoor Adventure Embroidered Patches For Clothing Backpack Iron On Sew On Decorative Hiking Camping Badge Applique
$0.22-5.19
No MOQ
 · 
900 sold recently
Free Shipping
Cartoon Food Embroidery Patches Candy Popcorn Pizza Iron On Appliques For Clothes DIY Bags Hats Jackets Sweet Applique
Cartoon Food Embroidery Patches Candy Popcorn Pizza Iron On Appliques For Clothes DIY Bags Hats Jackets Sweet Applique
like
Find Similar
Cartoon food embroidery patch set with colorful pizza, popcorn, and candy designs - Complete Food Collection
Pink lollipop embroidered patch with white border, size 5.2x3cm for DIY clothing repair - Pink Lollipop (11682-A)
Popcorn patch embroidery with red stripes, diy garment decoration, 4.1x6.1cm size detail - Red and White Popcorn Bucket (11668)
Embroidered pizza patch for DIY clothing with 5.6cm by 3.4cm size specifications - Pepperoni Pizza (11675)
+20
Cartoon Food Embroidery Patches Candy Popcorn Pizza Iron On Appliques For Clothes DIY Bags Hats Jackets Sweet Applique
$0.09-3.58
Mix MOQ : 10
 · 
163 sold recently
Free Shipping
Zodiac Signs Embroidery Patches Circular Cartoon Iron On Sew On Applique DIY Decorative Badge For Clothes Jacket Bag Hat Accessories
Zodiac Signs Embroidery Patches Circular Cartoon Iron On Sew On Applique DIY Decorative Badge For Clothes Jacket Bag Hat Accessories
like
Find Similar
Detail of an 8cm Aquarius zodiac embroidered patch featuring blue and gold thread patterns - Aquarius (PE9114CT)
Detailed embroidery of 8cm circular Pisces zodiac patch with blue and purple thread - Pisces (PE9115CT)
Detail of 8cm Cancer zodiac embroidered patch with moon and stars for clothing DIY - Cancer (PE9116CT)
Detailed embroidery of Libra zodiac patch featuring pink fabric and 8cm diameter - Libra (PE9117CT)
+8
Zodiac Signs Embroidery Patches Circular Cartoon Iron On Sew On Applique DIY Decorative Badge For Clothes Jacket Bag Hat Accessories
-4%
$0.88
No MOQ
 · 
166 sold recently
Free Shipping
Cartoon Animal Food Embroidered Patches For Clothing Decoration Polyester Iron On Sew On DIY Applique Patches For Bags Jackets
Cartoon Animal Food Embroidered Patches For Clothing Decoration Polyester Iron On Sew On DIY Applique Patches For Bags Jackets
like
Find Similar
Embroidered fish patch in light blue silk thread, measuring 2.2 cm by 1.0 cm for DIY crafts - Blue Fish Style (1*)
Embroidered yellow wine bottle patch variant measuring 4.4 cm by 1.8 cm on white background - Yellow Bottle Style (2*)
Cat head embroidery patch in yellow and blue colors with size 2.8x2.4 cm - Blue Yellow Cat Head Style (3*)
Cartoon black cat head embroidered self-adhesive patch, size 2.1x2.4 cm, for clothing repair - Black Cat Head Style (4*)
+11
Cartoon Animal Food Embroidered Patches For Clothing Decoration Polyester Iron On Sew On DIY Applique Patches For Bags Jackets
-6%
$0.15
No MOQ
 · 
453 sold recently
Pink Cartoon Embroidered Patches Inspirational English Quotes Iron On Applique For DIY Clothing Bags Accessories Decor
Pink Cartoon Embroidered Patches Inspirational English Quotes Iron On Applique For DIY Clothing Bags Accessories Decor
like
Find Similar
Pink heart shaped embroidery patch featuring white ribbon and FIGHT lettering motif - Pink Heart "FIGHT" Style (1#)
Embroidered daisy flower patch with BE KIND text, 6.6x5.9cm size detail. - Daisy "BE KIND" Style (2#)
Pink circular embroidered patch with cherry design, Literally Just a Girl text, 7.6cm - Cherry "I'M LITERALLY JUST A GIRL" Style (3#)
Sun shaped embroidered patch featuring 'God is Good' text for clothes and crafts - Sun "God is Good" Style (4#)
+9
Pink Cartoon Embroidered Patches Inspirational English Quotes Iron On Applique For DIY Clothing Bags Accessories Decor
$0.20-3.37
No MOQ
 · 
27 sold recently
Free Shipping
Bohemian Cartoon Embroidered Patches Polyester Flower Rainbow Butterfly Iron On Sew On Patches For Clothing DIY Decoration
Bohemian Cartoon Embroidered Patches Polyester Flower Rainbow Butterfly Iron On Sew On Patches For Clothing DIY Decoration
like
Find Similar
Rainbow Groovy flower embroidery patch, colorful iron-on badge for clothes, 6.9x6.2cm - Bohemian Style 1#
Bohemian embroidered roller skate patch with rainbow stripes and hearts for clothing - Bohemian Style 2#
Bohemian floral embroidery patch in orange and purple tones, measuring 7cm and weighing 2.6g - Bohemian Style 3#
Bohemian round embroidered patch with retro colorful waves and small daisy floral design - Bohemian Style 4#
+12
Bohemian Cartoon Embroidered Patches Polyester Flower Rainbow Butterfly Iron On Sew On Patches For Clothing DIY Decoration
$0.14-4.16
No MOQ
Free Shipping
Musical Instrument Embroidery Patches Set Music Note Guitar Headphones Saxophone Cassette Iron On Patches For Clothing DIY Decoration Accessories
Musical Instrument Embroidery Patches Set Music Note Guitar Headphones Saxophone Cassette Iron On Patches For Clothing DIY Decoration Accessories
like
Find Similar
Red and blue trumpet musical instrument embroidered patch with dimensions 10cm x 3.3cm - Gz-2685* Minimum Order Of 10 Pieces Per Style. Thank You For Your Cooperation.
Yellow embroidered musical instrument patch with size markers for DIY clothing decor - Yellow Musical Instrument Shape (GZ-2684)
Blue headphone embroidered patch with red and yellow accents for DIY clothing decor - Blue Headphones Shape (GZ-2683)
Black guitar embroidered patch with golden patterns for DIY clothing decor - Gz-2686* Minimum Order Of 10 Pieces Per Style. Thank You For Your Cooperation.
+23
Musical Instrument Embroidery Patches Set Music Note Guitar Headphones Saxophone Cassette Iron On Patches For Clothing DIY Decoration Accessories
-8%
$0.10-7.51
Mix MOQ : 10
 · 
74 sold recently
Free Shipping
Pink Cartoon Inspirational Slogan Embroidery Patches Iron On Badges For Clothing Bag Hat DIY Decoration Flower Hearts Applique
Pink Cartoon Inspirational Slogan Embroidery Patches Iron On Badges For Clothing Bag Hat DIY Decoration Flower Hearts Applique
like
Find Similar
Pink embroidery patch with motivational stars quote and golden border on white background - Starry Quote Style (PE15404CT)
Pink FAITH Can Move Mountains embroidered patch with colorful mountain sunrise design - Mountain Faith Style (PE15407CT)
Embroidered yellow school bus patch with Hop In Bestie text for DIY bags - School Bus Bestie Style (PE15426CT)
Square White SUV Mom Social Club embroidered patch with pink bow and laurel leaves - White SUV Mom Style (PE15430CT)
+21
Pink Cartoon Inspirational Slogan Embroidery Patches Iron On Badges For Clothing Bag Hat DIY Decoration Flower Hearts Applique
$0.23-0.86
Mix MOQ : 10
 · 
183 sold recently
Free Shipping
Cartoon Cartoon Embroidered Patches For Clothing DIY Heart Animal Flower Applique Polyester Embroidery Sewing Supplies Patch
Cartoon Cartoon Embroidered Patches For Clothing DIY Heart Animal Flower Applique Polyester Embroidery Sewing Supplies Patch
like
Find Similar
Self-adhesive rose red heart patch with HUGS embroidery and premium stitched borders - Rose Red Heart-HUGS
Round floral embroidery patch with pink flowers and silver thread on white felt - Round Flower
Creative milk carton embroidery patch with blue thread and cow motif on white background - Blue Milk Box
Classic red heart embroidered patch with white LOVE text for clothing decoration - Red Heart-LOVE
+37
Cartoon Cartoon Embroidered Patches For Clothing DIY Heart Animal Flower Applique Polyester Embroidery Sewing Supplies Patch
-9%
$0.10-0.22
No MOQ
 · 
320 sold recently
Colorful Embroidery Patches Iron On Butterfly Flower Hippie Style Fabric Badges For Clothes Bags DIY Decor
Colorful Embroidery Patches Iron On Butterfly Flower Hippie Style Fabric Badges For Clothes Bags DIY Decor
like
Find Similar
Detailed embroidery texture of pink cartoon bus iron-on patch with size measurements - Style 1 (Pink Bus)
Detail view of 5cm flower embroidery patch with colorful threads and precise dimensions - Style 2 (Multicolor Flower)
Pink and yellow floral embroidered patch with 4.8cm size measurement on white background - Style 5 (Pink Peace Flower)
Detail view of pink lip and daisy embroidery patch with 5.5cm measurement scale - Style 7 (Pink Lips Daisy)
+18
Colorful Embroidery Patches Iron On Butterfly Flower Hippie Style Fabric Badges For Clothes Bags DIY Decor
$0.20-4.99
No MOQ
 · 
158 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Forest Fresh Green Embroidery Cloth Patches Iron On Appliques For Clothes Bag DIY Decoration Cartoon Flower Plant Patches
Forest Fresh Green Embroidery Cloth Patches Iron On Appliques For Clothes Bag DIY Decoration Cartoon Flower Plant Patches
like
Find Similar
Green gradient rainbow embroidery patch for clothing with dimensions and weight info - Rainbow (Cartoon Forest Patch 1#)
Green cactus embroidered iron-on patch with orange flower detail and 6.3cm size measurements - Cactus (Cartoon Forest Patch 2#)
Green leaf embroidered patch 6.5x3cm for clothes, fairy style floral decorative iron on - Green Leaf (Cartoon Forest Patch 3#)
Embroidered stacked books patch in green and pink with iron-on backing, 6.3x6cm size - Stacked Books (Cartoon Forest Patch 4#)
+20
Forest Fresh Green Embroidery Cloth Patches Iron On Appliques For Clothes Bag DIY Decoration Cartoon Flower Plant Patches
$0.20-6.31
No MOQ
 · 
310 sold recently
Free Shipping
Vintage Computer Embroidered Number Patches For DIY Clothing Bags Hats Multi Colored Sporty Appliques Embroidery Badges
Vintage Computer Embroidered Number Patches For DIY Clothing Bags Hats Multi Colored Sporty Appliques Embroidery Badges
like
Find Similar
Pink number 69 embroidery patch for clothing DIY, 5x5.4cm size with black border - Pink Number 69 Style (GZ-0236)
Embroidered 1988 CLUB patch for DIY clothes and bags with size measurements - Gz-0251
Colorful embroidered number 23 patch for clothes DIY with size dimensions - Gz-0239
Embroidered black letter B patch with white borders for DIY clothing decoration - Black and White Script Letter B Style (GZ-0241)
+15
Vintage Computer Embroidered Number Patches For DIY Clothing Bags Hats Multi Colored Sporty Appliques Embroidery Badges
$0.07-2.54
Mix MOQ : 10
 · 
10 sold recently
Free Shipping
Pink Retro Embroidered Iron On Patches For Clothing Bag Shoes DIY Decoration Pink Cowgirl Hat Heart Dice Game Controller Embroidery Patch Applique
Pink Retro Embroidered Iron On Patches For Clothing Bag Shoes DIY Decoration Pink Cowgirl Hat Heart Dice Game Controller Embroidery Patch Applique
like
Find Similar
Pink and purple cartoon dinosaur embroidered patch for DIY clothing, size 6.5x5.5cm - Pink Dinosaur / Pink Dinosaur (PE5336CT)
Pink circular embroidered feminist patch with black lettering and 7.1cm diameter size - Round Slogan / PE5513CT
Detailed embroidery of a pink game controller patch with FONY text and 7x5cm scale - FONY Game Controller / PE5958CT
Pink I Can Do Hard Things floral embroidery patch for cowgirl hats and denim jackets - I CAN DO HARD THINGS / PE6103CT
+12
Pink Retro Embroidered Iron On Patches For Clothing Bag Shoes DIY Decoration Pink Cowgirl Hat Heart Dice Game Controller Embroidery Patch Applique
$0.24-0.81
Mix MOQ : 10
 · 
31 sold recently
Cartoon Fruit Embroidery Patches Iron On Sew On Watermelon Cherry Appliques For DIY Clothing Backpack Decoration Accessories
Cartoon Fruit Embroidery Patches Iron On Sew On Watermelon Cherry Appliques For DIY Clothing Backpack Decoration Accessories
like
Find Similar
Watermelon slice embroidered patch with size dimensions 7.8cm width and 3.6cm height - Watermelon 1
Vibrant watermelon slice embroidery patch measuring 4.5 cm by 4.7 cm with dense stitching - Watermelon 2
Pink and purple double cherry embroidered patch with green leaves, size 4.5cm x 4.5cm - Cherry 1
Watermelon slice embroidered patch with iron-on backing, dimensions 5.2 cm by 2.8 cm - Watermelon 3
+21
Cartoon Fruit Embroidery Patches Iron On Sew On Watermelon Cherry Appliques For DIY Clothing Backpack Decoration Accessories
-9%
$0.10-0.33
No MOQ
 · 
118 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Colorful Embroidery Patches Iron On Sew On Appliques For Clothing Decoration Cartoon Wave Rainbow Decorative Motifs
Colorful Embroidery Patches Iron On Sew On Appliques For Clothing Decoration Cartoon Wave Rainbow Decorative Motifs
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - One Sheet Strong Adhesive 20*10CM
16-piece retro hippie embroidery patch set with colorful rainbow and flower designs - 16Pcs Set-B
Close-up of French Bulldog embroidery patch showing precise dimensions and stitching details - No.1 French Bulldog (X10HL-07-01)
Detailed size chart for the embroidered bicycle flower basket patch showing 6x6.5cm dimensions - No.3 Bicycle (X10HL-086-03)
+17
Colorful Embroidery Patches Iron On Sew On Appliques For Clothing Decoration Cartoon Wave Rainbow Decorative Motifs
$0.20-4.88
No MOQ
 · 
1K+ sold recently
Top 1% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Coastal Cowgirl Embroidered Patches Blue Decorative Iron On Applique For Clothing Bags Jackets Summer Beach DIY Accessories
Coastal Cowgirl Embroidered Patches Blue Decorative Iron On Applique For Clothing Bags Jackets Summer Beach DIY Accessories
like
Find Similar
Blue coastal cowgirl hat embroidery patch with orange horseshoe and star details - Cowboy Hat Style (1#)
Blue Tide Ride surfing cowgirl embroidery patch iron-on clothing applique 5.3x6.8cm - Surfing Typography Style (2#)
Coastal Cowgirl embroidered blue hat patch, iron-on clothing decal, 6.7x4.7cm size - Cowgirl Typography Style (3#)
Coastal cowgirl embroidery patch with a girl holding a blue surfboard and dimensions - Surfboard Girl Style (4#)
+21
Coastal Cowgirl Embroidered Patches Blue Decorative Iron On Applique For Clothing Bags Jackets Summer Beach DIY Accessories
$0.23-7.75
No MOQ
 · 
133 sold recently
Free Shipping
Comic Style Embroidered Patches Pop Art Iron On Appliques For Clothing DIY Decoration Badges WOW POW OMG Letter Patches
Comic Style Embroidered Patches Pop Art Iron On Appliques For Clothing DIY Decoration Badges WOW POW OMG Letter Patches
like
Find Similar
Comic style POW and WOW embroidered iron-on patches for DIY clothing decoration - Complete Collection 22 Pieces
Comic Style Embroidered Patches Pop Art Iron On Appliques For Clothing DIY Decoration Badges WOW POW OMG Letter Patches
-4%
$3.81
No MOQ
 · 
10 sold recently
Free Shipping
Embroidered Patch Iron On Applique Decorative Mushroom Butterfly Sun Heart Landscape For Jacket Bag Clothing Accessory
Embroidered Patch Iron On Applique Decorative Mushroom Butterfly Sun Heart Landscape For Jacket Bag Clothing Accessory
like
Find Similar
Tropical beach sunset embroidered patch with palm trees and rainbow design, 7.5cm diameter - Beach Sunset Style (PE9641CT)
Detail of embroidered patch showing colorful butterflies and Embrace Change text - Embrace Change Butterfly Style (PE9646CT)
Pink crystal ball embroidery patch with funny slogan for clothing 8.1x7cm size - Crystal Ball Slogan Style (PE9650CT)
Detail of round flower patch with Survive Out Of Spite text and 7cm diameter mark - Survive Flower Style (PE9674CT)
+2
Embroidered Patch Iron On Applique Decorative Mushroom Butterfly Sun Heart Landscape For Jacket Bag Clothing Accessory
-5%
$0.34-0.96
No MOQ
 · 
10 sold recently
Free Shipping
Cartoon Animal Flower Embroidery Patches DIY Clothing Accessories Polyester Sew On Iron On Embroidered Decorative Repair Patches
Cartoon Animal Flower Embroidery Patches DIY Clothing Accessories Polyester Sew On Iron On Embroidered Decorative Repair Patches
like
Find Similar
Cute blue rabbit embroidered patch variant 8 for DIY clothing, 5.8 CM height - Blue Rabbit (8)
Pink flamingo sequin embroidery patch for DIY clothing, size 7.1 cm by 4.3 cm - Flamingo (9)
Cartoon green dinosaur embroidery patch with size details for DIY clothing decor - Green Dinosaur (11)
Pink heart embroidered patch with yellow stitched border for DIY clothing 3.0x2.5cm - Pink Yellow Heart (6)
+34
Cartoon Animal Flower Embroidery Patches DIY Clothing Accessories Polyester Sew On Iron On Embroidered Decorative Repair Patches
-8%
$0.11-0.38
No MOQ
 · 
20 views
Free Shipping
Pink Embroidered Patches For DIY Clothing Jackets Bags Cute Girl Power Hearts Stars Iron On Fabric Applique
Pink Embroidered Patches For DIY Clothing Jackets Bags Cute Girl Power Hearts Stars Iron On Fabric Applique
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Sheet (One Sheet 20x10cm)
Detailed view of pink checkered heart embroidery patch with 5.5cm size dimensions - No.1-Plaid Heart
Pink checkered star embroidery patch measuring 5.5cm for jackets and bags decoration - No.2-Plaid Star
Macro detail of butterfly embroidery patch showing 8cm x 5cm size measurements - No.5-Pink Black Butterfly
+41
Pink Embroidered Patches For DIY Clothing Jackets Bags Cute Girl Power Hearts Stars Iron On Fabric Applique
$0.12-9.40
No MOQ
 · 
647 sold recently
Top 3% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Indian Henna Style Paisley Embroidered Patches For Clothing Ethnic Hollow Out Floral Iron On Applique Decorative Fabric Patch
Indian Henna Style Paisley Embroidered Patches For Clothing Ethnic Hollow Out Floral Iron On Applique Decorative Fabric Patch
like
Find Similar
Green paisley henna embroidery patch for clothing decoration measuring 12.8cm by 7.1cm - Paisley Patch 1# / Green
Black and white Paisley embroidery patch with precise dimensions 12.7cm by 7.1cm - Paisley Patch 2# / Black
Blue Paisley embroidered patch detail showing dimensions of 13.1cm height and 10cm width - Paisley Patch 3# / Cyan Blue
Red paisley embroidered patch with intricate white floral patterns for garment sewing - Paisley Patch 4# / Red
Indian Henna Style Paisley Embroidered Patches For Clothing Ethnic Hollow Out Floral Iron On Applique Decorative Fabric Patch
$0.58-0.72
No MOQ
 · 
20 sold recently
Outdoor Camping Theme Embroidery Patches Mountains Forest Tent Design Iron On Sew On Decorative Patches For Backpack Clothes DIY Decor
Outdoor Camping Theme Embroidery Patches Mountains Forest Tent Design Iron On Sew On Decorative Patches For Backpack Clothes DIY Decor
like
Find Similar
Adventure mountain embroidery patch with purple sunset sunset for DIY bag and hat - Adventure Mountain Style (11711)
Brown diamond-shaped Wilderness patch with orange mountain embroidery for DIY camping gear - Wilderness Rhombus Style (11712)
Embroidered camping patch featuring mountain scenery and tent for DIY clothing decor - Camping Tent Style (11707)
Outdoor landscape embroidery patch with mountains and forest, size 5.2cm x 7cm - Outdoor Nature Style (11709)
+6
Outdoor Camping Theme Embroidery Patches Mountains Forest Tent Design Iron On Sew On Decorative Patches For Backpack Clothes DIY Decor
-5%
$0.19-2.54
Mix MOQ : 10
 · 
225 sold recently
Free Shipping
Cartoon Slogan Embroidery Cloth Patches Creative Animal Letter Iron On Sew On Appliques For DIY Clothes Bags Decoration
Cartoon Slogan Embroidery Cloth Patches Creative Animal Letter Iron On Sew On Appliques For DIY Clothes Bags Decoration
like
Find Similar
Camera embroidered iron on patch with pink heart detail measuring 5.7x3.9cm - Camera Style (PE0688CT)
Detail of embroidered patch showing purple ribbon with text You Are Safe With Me - Purple Pin Slogan Style (PE5145CT)
7cm round embroidered patch featuring Have Courage & Be Kind quote with floral details - Round Inspirational Quote Style (PE5460CT)
Macro view of She Is Fierce heart embroidery patch with gold border, size 6.3x6cm - Gold Edged Heart Slogan Style (PE6463CT)
+4
Cartoon Slogan Embroidery Cloth Patches Creative Animal Letter Iron On Sew On Appliques For DIY Clothes Bags Decoration
-5%
$0.21-0.62
No MOQ
 · 
56 sold recently
Free Shipping
Astronaut Space Theme Embroidery Patches Galaxy Universe Star Planet Iron On Applique DIY Clothing Repair Decor Patches
Astronaut Space Theme Embroidery Patches Galaxy Universe Star Planet Iron On Applique DIY Clothing Repair Decor Patches
like
Find Similar
Silver star embroidery patch 5.2cm galaxy themed iron on badge for clothes bags - Silver Gray Octagonal Star (8)
Silver North Star embroidered patch with 3.2cm size and metallic silk thread details - Silver North Star (9)
Blue planet galaxy embroidered patch with brown rings measuring 4.7 x 3.7 cm - Blue Ringed Planet (11)
Pink and blue galaxy planet embroidery patch for clothing decoration, size 6.5x4.0 cm - Pink Textured Planet (6)
+34
Astronaut Space Theme Embroidery Patches Galaxy Universe Star Planet Iron On Applique DIY Clothing Repair Decor Patches
-9%
$0.11-0.27
No MOQ
 · 
173 sold recently
Chenille Letter Patches Iron On Embroidery Appliques Alphabet For Clothing Bags Decoration Varsity Style
Chenille Letter Patches Iron On Embroidery Appliques Alphabet For Clothing Bags Decoration Varsity Style
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - One Sheet Strong Adhesive 20*10CM
26 Light blue chenille letter patches A-Z with silver glitter borders for DIY bags - Light Blue on White 26pcs/Full Set
Set of 26 black and white chenille letter patches A-Z for bags and clothing decoration - Black on White 26pcs/Full Set
Pink chenille towel embroidered alphabet patch set A-Z for DIY garment decor - Pink on White 26pcs/Full Set
+36
Chenille Letter Patches Iron On Embroidery Appliques Alphabet For Clothing Bags Decoration Varsity Style
$0.20-6.74
No MOQ
 · 
250 sold recently
Top 3% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Assorted Football Theme Embroidery Patch For Clothing Leopard Print Mama Mom Letter Iron On Patches Decorative Badge Applique For DIY Jackets Bags Hats
Assorted Football Theme Embroidery Patch For Clothing Leopard Print Mama Mom Letter Iron On Patches Decorative Badge Applique For DIY Jackets Bags Hats
like
Find Similar
Rectangular black and white GAME DAY vibes embroidered patch, size 8x4.7cm for clothing - Game Day Vibes Text Style (6118516502501)
Brown bow-shaped leopard rugby embroidery patch for clothing DIY decoration - Rugby Patch #2
Rugby football patch with leopard pattern embroidery and bow detail decoration - Rugby Patch #3
Embroidered Mama patch with leopard lightning bolt design for clothing iron-on decoration - Leopard Lightning Mama Letter Style (6118516502504)
+29
Assorted Football Theme Embroidery Patch For Clothing Leopard Print Mama Mom Letter Iron On Patches Decorative Badge Applique For DIY Jackets Bags Hats
$0.05-0.43
No MOQ
 · 
121 sold recently
Free Shipping
Chenille Embroidery Letter Patches Gold Glitter Border Iron On Self Adhesive For Clothing Bag Hat DIY Crafts
Chenille Embroidery Letter Patches Gold Glitter Border Iron On Self Adhesive For Clothing Bag Hat DIY Crafts
like
Find Similar
Golden chenille iron-on patches with A-Z letters and emoji shapes on white background - 49 Styles Combo * Letters Iron-on
Set of 26 white chenille letter patches A-Z with gold glitter border 5.5cm tall - 5.5cm White Chenille Alphabet Set 26pcs
Pink chenille 26 alphabet patches with gold glitter borders at 5.5cm height - 5.5cm Pink Chenille Alphabet Set 26pcs
5.5cm black chenille letter patches with gold glitter border A-Z embroidery set - 5.5cm Black Chenille Alphabet Set 26pcs
+31
Chenille Embroidery Letter Patches Gold Glitter Border Iron On Self Adhesive For Clothing Bag Hat DIY Crafts
$0.29-14.27
No MOQ
 · 
202 sold recently
Top 1% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Cartoon Letter Slogan Embroidery Patch Humorous Sarcastic Badges DIY Iron-on Sew-on For Clothes Bags Hats Jackets Accessory
Cartoon Letter Slogan Embroidery Patch Humorous Sarcastic Badges DIY Iron-on Sew-on For Clothes Bags Hats Jackets Accessory
like
Find Similar
Embroidered floral patch with Kind Over Cool slogan and dimensions for clothing repair - Pink Kind Over Cool Style (PE10749CT)
Embroidered mountain patch with colorful landscape and trees, size 7.5cm x 4.5cm - Goggles Mountain Landscape Style (PE10781CT)
Detailed view of square cartoon coffee patch with COFFEE ME embroidery and dimensions - Sunglasses Coffee Cup Character Style (PE11417CT)
Embroidered 'Just a GIRL who LOVES Dance' patch with size guide 9x7cm for clothing decor - Oval Dance Text Style (PE11420CT)
+15
Cartoon Letter Slogan Embroidery Patch Humorous Sarcastic Badges DIY Iron-on Sew-on For Clothes Bags Hats Jackets Accessory
$0.20-0.72
Mix MOQ : 10
 · 
230 sold recently
Free Shipping
Exquisite Embroidery Butterfly Patches For Clothing Bags DIY Decor Colorful Gradient Polyester Sew On Applique Patches
Exquisite Embroidery Butterfly Patches For Clothing Bags DIY Decor Colorful Gradient Polyester Sew On Applique Patches
like
Find Similar
Golden and silver butterfly embroidery patch with metallic thread, style A, 3.9cm width - Gold and Silver Butterfly Style (A)
Exquisite orange gradient butterfly embroidery patch with gold metallic edging, size 3x3.9cm - Orange-red Gradient Style (B)
Detailed butterfly embroidery patch in light purple and gold silk thread, 3.9cm wide - Light Purple Butterfly Style (C)
Silver butterfly embroidery patch with metallic thread detail, size 3.0x3.9cm, style D - Silver White Metallic Style (D)
+10
Exquisite Embroidery Butterfly Patches For Clothing Bags DIY Decor Colorful Gradient Polyester Sew On Applique Patches
-3%
$0.31
No MOQ
Chenille Letter Patches A-Z Alphabet Embroidered Applique Iron On Fabric For Clothes Bags Jackets DIY Decoration
Chenille Letter Patches A-Z Alphabet Embroidered Applique Iron On Fabric For Clothes Bags Jackets DIY Decoration
like
Find Similar
Detailed size view of blue chenille letter A patch measuring 7cm in height on white background - Blue-Letter A
Blue chenille letter R patch showing height 7cm and width 6.2cm dimensions - Blue-Letter R
Detail of chenille towel embroidered letter Y patch in royal blue on white felt background - Blue-Letter Y
Detailed size chart of blue chenille letter N embroidery patch with dimensions in inches - Blue-Letter N
+36
Chenille Letter Patches A-Z Alphabet Embroidered Applique Iron On Fabric For Clothes Bags Jackets DIY Decoration
$0.20-6.74
No MOQ
 · 
453 sold recently
Top 5% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Cartoon Strawberry Snail Embroidered Patches For Clothing DIY Iron On Applique Badge Decorative Sewing Accessories Kids Bags
Cartoon Strawberry Snail Embroidered Patches For Clothing DIY Iron On Applique Badge Decorative Sewing Accessories Kids Bags
like
Find Similar
Close-up of strawberry heart embroidery patch with size measurements 5.6cm and 6.4cm - Strawberry Heart
Close-up of strawberry snail embroidery patch with fine needlework and vibrant colors - Strawberry Snail
Detail showing red strawberry embroidered patch with exact 6.4cm by 5.2cm dimensions - Standard Strawberry
Embroidered strawberry snail girl patch for clothing accessories with dimensions - Strawberry Girl
+9
Cartoon Strawberry Snail Embroidered Patches For Clothing DIY Iron On Applique Badge Decorative Sewing Accessories Kids Bags
$0.26-3.69
No MOQ
 · 
11 sold recently
Free Shipping
Chenille Rainbow Cloud And Lightning Embroidery Patches Self Adhesive Glitter Border DIY Decorative Repair Appliques For Clothing Bags Hats Shoes Cute Cartoon Patch
Chenille Rainbow Cloud And Lightning Embroidery Patches Self Adhesive Glitter Border DIY Decorative Repair Appliques For Clothing Bags Hats Shoes Cute Cartoon Patch
like
Find Similar
Rainbow cloud embroidered patch with gold sequins for DIY clothing decoration, 6.4x4.5cm - Cloud
Chenille Rainbow Cloud And Lightning Embroidery Patches Self Adhesive Glitter Border DIY Decorative Repair Appliques For Clothing Bags Hats Shoes Cute Cartoon Patch
$0.35
Mix MOQ : 5
 · 
45 sold recently
Embroidered Cartoon Animal Patches For Clothing DIY Outdoor Adventure Landscape Iron On Patch For Bags Hats Decorative Accessories
Embroidered Cartoon Animal Patches For Clothing DIY Outdoor Adventure Landscape Iron On Patch For Bags Hats Decorative Accessories
like
Find Similar
Square motivational patch with 'HUMBLE BUT I'M STILL that girl' text and pink stars - Humble Girl Slogan Style (PE15427CT)
Embroidered Mexican patch with cactus, guitar and cocktail, 7.5cm x 5.7cm iron-on badge - Mexico Elements Style (PE15473CT)
Embroidered iced coffee patch with text COFFEE IS THE WD-40 OF ADULTHOOD 8.3cm - Coffee Slogan Style (PE15477CT)
Pink Play Ball baseball embroidery patch with 8cm checkered design for DIY clothing - Baseball Sports Style (PE15480CT)
+11
Embroidered Cartoon Animal Patches For Clothing DIY Outdoor Adventure Landscape Iron On Patch For Bags Hats Decorative Accessories
$0.36-0.98
Mix MOQ : 10
 · 
35 sold recently
Cute Cartoon Animal Buttocks Embroidery Patch Iron On Decorative Applique For Clothes Bag DIY Craft Accessory Embroidered
Cute Cartoon Animal Buttocks Embroidery Patch Iron On Decorative Applique For Clothes Bag DIY Craft Accessory Embroidered
like
Find Similar
Embroidered iron-on patch featuring an orange tabby cat back design in 4.5 x 3.3 cm size - Orange Striped Cat Back Style (D)
Corgi butt dog embroidery patch size 3.8x3.4cm style F for clothing and DIY bags - Corgi Buttocks Style (F)
Cat back silhouette embroidery patch in grey with pink paw detail style E 4.2x3.5cm - Gray Cat Back Style (E)
Yellow and white cat back embroidery patch, iron-on animal sticker, size 4.2x3.2 cm - Yellow Cat Back Style (C)
+4
Cute Cartoon Animal Buttocks Embroidery Patch Iron On Decorative Applique For Clothes Bag DIY Craft Accessory Embroidered
-3%
$0.29
No MOQ
Free Shipping
Handmade Woven Polyester Labels Multi-Color Embroidery Sewing Tags For DIY Crafts Bag Hat Clothing Decoration Accessories
Handmade Woven Polyester Labels Multi-Color Embroidery Sewing Tags For DIY Crafts Bag Hat Clothing Decoration Accessories
like
Find Similar
Pink handmade woven clothing label with blue bow and 1.8cm by 1.15cm size specs - Pink Bow Style (Hand Made) / 1.15cm*1.8cm
Handmade embroidery sewing labels in black with brown text size 1.95cm x 1.5cm - Black Classic Style (Hand Made) / 1.5cm*1.95cm
Pink garment label with golden crown and Haney embroidery, 2cm x 1.3cm size - Pink Crown Style (Haney) / 1.3cm*2cm
Beige cotton woven handmade garment label featuring black text, 2.7x1.0cm dimension - Beige Artistic Font Style (Handmade) / 1cm*2.7cm
+5
Handmade Woven Polyester Labels Multi-Color Embroidery Sewing Tags For DIY Crafts Bag Hat Clothing Decoration Accessories
$0.01-0.04
No MOQ
 · 
10 views
Cute Cartoon Food Embroidery Patch Iron On Patches Burger Fries Coffee Bread Applique For Clothing Bags DIY Decoration
Cute Cartoon Food Embroidery Patch Iron On Patches Burger Fries Coffee Bread Applique For Clothing Bags DIY Decoration
like
Find Similar
Cartoon cheese embroidery patch with measurements 3.6x2.9cm for clothing decor - Cheese Style (Delicious Food Patch 1#)
Cartoon coffee cup embroidered patch in beige and brown with smiling face, size 3.4x2.6cm - Squinting Coffee Cup Style (Delicious Food Patch 2#)
Cute cartoon hot dog embroidered patch with funny facial expression for clothing - Hotdog Style (Delicious Food Patch 3#)
Cartoon coffee cup embroidered patch for DIY clothing with detailed size and weight specs - Big-eyed Coffee Cup Style (Delicious Food Patch 4#)
+7
Cute Cartoon Food Embroidery Patch Iron On Patches Burger Fries Coffee Bread Applique For Clothing Bags DIY Decoration
$0.14-1.63
No MOQ
 · 
1K+ sold recently
Free Shipping
DIY Embroidered Sequin Bowknot Patches For Clothing Bags Hats Decoration Shiny Bow Knot Applique Craft Accessories For Women Kids
DIY Embroidered Sequin Bowknot Patches For Clothing Bags Hats Decoration Shiny Bow Knot Applique Craft Accessories For Women Kids
like
Find Similar
Black sequin bow embroidery patch for clothing DIY, size 4.5x3.2cm decorative sticker - Bowknot A / Black
Blue sequin bow embroidery patch for DIY crafts with 4.5cm x 3.2cm size measurements - Bowknot B / Blue
Pink sequin bow embroidery patch for clothing decoration 4.5cm width variant - Bowknot C / Pink
Magenta sequin bow embroidery patch with precise dimensions 4.5cm and weight 0.78g - Bowknot D / Rose Red
+7
DIY Embroidered Sequin Bowknot Patches For Clothing Bags Hats Decoration Shiny Bow Knot Applique Craft Accessories For Women Kids
-5%
$0.19-1.93
Mix MOQ : 5
Free Shipping
Punk Gorilla Embroidery Patch Crown Skull Dog Bear Embroidered Patches For Clothing Bag Hat DIY Decoration Accessory
Punk Gorilla Embroidery Patch Crown Skull Dog Bear Embroidered Patches For Clothing Bag Hat DIY Decoration Accessory
like
Find Similar
Punk gorilla embroidery patch wearing camo helmet and cigar, size 8.2x6.5cm - Pe5536ct
Detailed embroidery of a bulldog patch with golden crown and spiked collar, 6.5x8.7cm - Crown Collar Bulldog (PE5537CT)
Punk gorilla embroidery patch with sunglasses and cigar, 6.7x8.7cm clothing applique - Pe5538ct
Punk gorilla embroidery patch with cigar and bandana design, size 7x8.7cm - Pe5542ct
+5
Punk Gorilla Embroidery Patch Crown Skull Dog Bear Embroidered Patches For Clothing Bag Hat DIY Decoration Accessory
-6%
$0.55-1.43
Mix MOQ : 10
 · 
16 sold recently
Free Shipping
Cartoon Animal Food Embroidery Patches Polyester Iron On Sew On Patches For Clothing Bag DIY Decoration Colorful Cute Patch
Cartoon Animal Food Embroidery Patches Polyester Iron On Sew On Patches For Clothing Bag DIY Decoration Colorful Cute Patch
like
Find Similar
Tropical coconut tree embroidered patch in tiffany blue and white, 5.0 cm height - Coconut Tree Style (1)
Embroidered double-scoop ice cream patch in pink and green with size 5.0x2.7cm - Ice Cream Style (2)
Embroidered conch shell patch with pink purple holographic glitter and silver trim - Conch Style (3)
Blue and green shell embroidered patch for clothes with 4.5cm width dimension - Shell Style (4)
+7
Cartoon Animal Food Embroidery Patches Polyester Iron On Sew On Patches For Clothing Bag DIY Decoration Colorful Cute Patch
-8%
$0.11-0.14
No MOQ
 · 
26 sold recently
Colorful Embroidered Patches With Inspirational Quotes Polyester Thread Iron On Sew On Apparel Decoration DIY Accessories
Colorful Embroidered Patches With Inspirational Quotes Polyester Thread Iron On Sew On Apparel Decoration DIY Accessories
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Sheet
Detailed view of embroidered patches featuring rainbow, sun, and motivational quotes - Set of 30
Collection of 17 colorful embroidered motivational phrase patches for clothes - Embroidered Patch Set
Set of 20 colorful inspirational embroidered patches with quotes for clothing and bags - 19Pcs Set
+39
Colorful Embroidered Patches With Inspirational Quotes Polyester Thread Iron On Sew On Apparel Decoration DIY Accessories
$0.14-6.23
No MOQ
 · 
455 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Cute Cartoon Black Cat Embroidered Patches Fun Animal Iron On Patch For Clothing Decoration DIY Apparel Sewing Accessories
Cute Cartoon Black Cat Embroidered Patches Fun Animal Iron On Patch For Clothing Decoration DIY Apparel Sewing Accessories
like
Find Similar
Detail of black cat embroidery patch in basket with precise 6cm x 5.6cm measurements - Black Cat Patch 1#
Embroidered black cat in box patch with size measurements 4x6.3cm and 1.4g weight - Black Cat Patch 2#
Detailed view of black cat embroidery patch with knife, showing size and dimension measurements - Black Cat Patch 3#
Detail view of cartoon black cat embroidery patch with dimensions 6cm by 3.9cm - Black Cat Patch 4#
+7
Cute Cartoon Black Cat Embroidered Patches Fun Animal Iron On Patch For Clothing Decoration DIY Apparel Sewing Accessories
$0.17-2.00
No MOQ
 · 
116 sold recently
Free Shipping
Flamingo Embroidery Patch Pink Bird Animal Sewing Applique For Clothing DIY Decoration Jacket Pants Repair Accessories
Flamingo Embroidery Patch Pink Bird Animal Sewing Applique For Clothing DIY Decoration Jacket Pants Repair Accessories
like
Find Similar
Pink flamingo embroidery patch with green grass detail, 13.1cm height DIY badge - Flamingo Facing Left (GZ-1330)
Pink flamingo embroidered patch with detailed stitching and size measurements - Pink and White Flamingo (GZ-1332)
Pink flamingo embroidered patches with size dimensions 9.5cm by 14.3cm for DIY clothing decor - Symmetrical Large Flamingo Pair (GZ-1322AB)
Pink flamingo embroidery patch showing dimensions 4.4x7cm and detailed needlework - Small Colored Flamingo (GZ-1331)
+23
Flamingo Embroidery Patch Pink Bird Animal Sewing Applique For Clothing DIY Decoration Jacket Pants Repair Accessories
-7%
$0.07-7.97
Mix MOQ : 10
 · 
15 views
Free Shipping
Cartoon Animal Frog Cat Goose Embroidered Patches Iron On Patch For Clothing Bag DIY Decoration Flower Slogan Applique Sewing Accessory
Cartoon Animal Frog Cat Goose Embroidered Patches Iron On Patch For Clothing Bag DIY Decoration Flower Slogan Applique Sewing Accessory
like
Find Similar
Detailed Highland cow embroidery patch showing 7cm height dimensions and black white fur - Highland Cow Style (PE15495CT)
Cartoon goose and daisy embroidery patch, 8.5x7.5cm decorative sew-on iron-on applique - Daisy White Goose Style (PE15507CT)
Embroidered Dog Mama patch with floral patterns and paw print design, 7x8cm size - Dog Mama Style (PE15508CT)
Detail of embroidered goose patch with ON MY WAY TO STIR THE POT text and size labels - Goose Stir The Pot Style (PE15510CT)
+6
Cartoon Animal Frog Cat Goose Embroidered Patches Iron On Patch For Clothing Bag DIY Decoration Flower Slogan Applique Sewing Accessory
$0.43-0.62
Mix MOQ : 10
 · 
110 sold recently
Free Shipping
DIY Self-adhesive Embroidered Patch Cartoon Lemon Cake Dinosaur Pattern Cloth Sticker For Clothing Decoration Repair Patch
DIY Self-adhesive Embroidered Patch Cartoon Lemon Cake Dinosaur Pattern Cloth Sticker For Clothing Decoration Repair Patch
like
Find Similar
Ice cream cone embroidery patch in pink and purple with 3.6cm by 2.1cm dimensions - Ice Cream Style (2)
Self-adhesive teardrop yellow embroidery patch with SOUR text and 3.5cm height - SOUR Drop Style (5)
Blue stegosaurus dinosaur embroidery patch for clothing diy craft sticker size 3.6x2.0cm - Stegosaurus Style (14)
Star-shaped yellow smile embroidery patch with 2.9cm dimensions for DIY clothing - Smile Star Style (10)
+11
DIY Self-adhesive Embroidered Patch Cartoon Lemon Cake Dinosaur Pattern Cloth Sticker For Clothing Decoration Repair Patch
-8%
$0.11-0.33
No MOQ
 · 
37 sold recently
Free Shipping
Mini Embroidery Letter Number Patches Polyester Iron On Appliques For DIY Clothing Bag Decoration Colorful Small Alphabet
Mini Embroidery Letter Number Patches Polyester Iron On Appliques For DIY Clothing Bag Decoration Colorful Small Alphabet
like
Find Similar
Mini yellow embroidered letter A patch for clothing decoration, size 1.2cm height - A (Yellow Small)
Mini pink letter R embroidery patch for clothing decoration with 1.1cm height - R (Pink Small)
Mini embroidered letter P patch in navy blue with white border and 2.5cm size mark - P (Blue)
Detailed embroidery texture of small cream and navy letter E patch with 2.5cm size markings - E (Beige)
+116
Mini Embroidery Letter Number Patches Polyester Iron On Appliques For DIY Clothing Bag Decoration Colorful Small Alphabet
$0.12-3.63
No MOQ
 · 
511 sold recently
Top 1% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Blue White Embroidered Patches For Clothing Inspirational English Slogans Iron On Sew On Daisy Butterfly Heart DIY Decor
Blue White Embroidered Patches For Clothing Inspirational English Slogans Iron On Sew On Daisy Butterfly Heart DIY Decor
like
Find Similar
Blue 'Trust Your Visions' embroidery patch with stars and butterfly motif, 6.9x5cm size - Positive Energy English Cloth Patch #1
Blue heart embroidery patch with YOU CAN DO BIG THINGS text and size measurements - Positive Energy English Cloth Patch #2
Embroidered daisy patch with Dream Big text and blue background for clothes and bags - Inspirational Slogan 3#-DREAM BIG NEVER GIVE UP
Inspirational embroidered patch Find The Good In Every Day blue cloud badge 7x5cm - Positive Energy English Cloth Patch #4
+12
Blue White Embroidered Patches For Clothing Inspirational English Slogans Iron On Sew On Daisy Butterfly Heart DIY Decor
$0.22-4.41
No MOQ
 · 
65 sold recently
Free Shipping
Cartoon Fruit Embroidery Patches DIY Iron On Patches For Clothing Shoes Bags Cherry Apple Tomato Tulip Shape Sewing Applique
Cartoon Fruit Embroidery Patches DIY Iron On Patches For Clothing Shoes Bags Cherry Apple Tomato Tulip Shape Sewing Applique
like
Find Similar
Embroidered cherry fruit patch for clothing DIY decoration with 4.1cm x 3.9cm size - Double Cherry Style (11420)
Red apple embroidered patch with black borders for DIY clothing decoration, 3.5cm height - Red Apple Style (11424)
Cartoon red apple embroidery patch for clothing DIY decoration, 3.9cm x 3.9cm size - Red Apple Style (11426)
Embroidered red apple patch with green leaf and flower for DIY clothing decoration - Flower Apple Style (11425)
+13
Cartoon Fruit Embroidery Patches DIY Iron On Patches For Clothing Shoes Bags Cherry Apple Tomato Tulip Shape Sewing Applique
$0.07-1.97
Mix MOQ : 10
 · 
12 views
Free Shipping
Punk Rock Flame Skull Embroidered Patch For Clothing DIY Iron On Applique Decorative Slogan Repair Embroidery Badge For Jackets
Punk Rock Flame Skull Embroidered Patch For Clothing DIY Iron On Applique Decorative Slogan Repair Embroidery Badge For Jackets
like
Find Similar
Detailed close-up of a red flame embroidery patch with white and yellow stitching detail - Flame Pattern (PE1806CT)
6.1x6.1cm red embroidered Empowered Women Feminist patch for DIY clothing and hats - Empowered Women Slogan (PE5519CT)
Punk skeleton hand holding purple heart broken embroidery patch 5.5x7.8cm for jackets - Broken Heart with Skeleton Hand (PE6787CT)
Hello speech bubble embroidery patch in black and white finish for DIY jackets, 5.3x3.8cm - Hello Speech Bubble (PE6802CT)
+8
Punk Rock Flame Skull Embroidered Patch For Clothing DIY Iron On Applique Decorative Slogan Repair Embroidery Badge For Jackets
-7%
$0.12-1.37
Mix MOQ : 10
 · 
132 sold recently
Free Shipping
Embroidered Patch Polyester Flower Butterfly Bee Gourd Shapes Iron On Sew On Patches For Clothing Bag DIY Decoration Applique
Embroidered Patch Polyester Flower Butterfly Bee Gourd Shapes Iron On Sew On Patches For Clothing Bag DIY Decoration Applique
like
Find Similar
Blue and white four-leaf clover flower embroidery patch with gold trim in 3.4x2.9cm size - Blue White Floral
Colorful butterfly embroidered patch for clothing, 5.0x4.8 cm size variant with floral thread - Multicolor Large Butterfly
Pink lotus flower embroidery patch with gold thread details and green stem 5.0x4.6cm - Pink Lotus
Pink gourd-shaped clover floral embroidery patch with yellow tassels for clothing - Pink Auspicious Cloud Gourd
+4
Embroidered Patch Polyester Flower Butterfly Bee Gourd Shapes Iron On Sew On Patches For Clothing Bag DIY Decoration Applique
-6%
$0.20-0.95
No MOQ
DIY Butterfly Cloth Patches Polyester Plaid Gingham Decorative Appliques For Hair Accessories Clothing Shoes Sewing Craft Supplies
DIY Butterfly Cloth Patches Polyester Plaid Gingham Decorative Appliques For Hair Accessories Clothing Shoes Sewing Craft Supplies
like
Find Similar
Detail of a pink checkered fabric butterfly accessory for DIY hair clips and clothing - Pink
Close-up of yellow checkered butterfly fabric patch applique for DIY hair accessories - Pale Green
Light blue checkered butterfly fabric patch for DIY hair accessories and clothing decor - Light Blue
Handmade pink plaid butterfly fabric patch for DIY hair accessories and clothing decor - Light Pink
+1
DIY Butterfly Cloth Patches Polyester Plaid Gingham Decorative Appliques For Hair Accessories Clothing Shoes Sewing Craft Supplies
$0.07
Mix MOQ : 200
Retro Cartoon Camera Embroidered Patches Polyester Iron On Sew On Decorative Badges For Clothing Backpack DIY Accessories
Retro Cartoon Camera Embroidered Patches Polyester Iron On Sew On Decorative Badges For Clothing Backpack DIY Accessories
like
Find Similar
Blue retro camera embroidered patch 6.6x5.3cm for DIY clothing iron-on applique - Cartoon Camera Patch 1
Cartoon camera embroidery patch in yellow and white, size 6.5cm x 5.3cm for clothing - Cartoon Camera Patch 2
Cartoon camera embroidered iron-on patch in orange and white for creative DIY clothing - Cartoon Camera Patch 3
Retro camera embroidered patch for clothing with 6.6cm x 4.6cm dimensions and iron-on backing - Cartoon Camera Patch 4
+11
Retro Cartoon Camera Embroidered Patches Polyester Iron On Sew On Decorative Badges For Clothing Backpack DIY Accessories
$0.29-4.73
No MOQ
 · 
69 sold recently
Free Shipping
Sports Ball Bear Embroidery Patches For Clothing DIY Decorative Iron On Applique For Hats Backpacks Jackets
Sports Ball Bear Embroidery Patches For Clothing DIY Decorative Iron On Applique For Hats Backpacks Jackets
like
Find Similar
Cartoon bear embroidery patch with red top and bear text for clothing DIY projects - Bear In Red Top (GZ-1587)
Embroidered cartoon bear patch wearing a blue sweater and white shorts for DIY decor - Bear In Blue Sweater (GZ-1588)
Embroidered cartoon hand gesture patch for DIY clothing decor showing victory sign - Victory Hand Sign (GZ-1589)
5.5cm round soccer ball embroidered patch with black and white stitching for DIY apparel - Soccer Ball A (GZ-1590)
+12
Sports Ball Bear Embroidery Patches For Clothing DIY Decorative Iron On Applique For Hats Backpacks Jackets
-8%
$0.10-2.02
Mix MOQ : 5
 · 
149 sold recently
Free Shipping
Go to

More in bags

Explore more in woven patches

shoulderbag large capacitystyletravelwidegirlssimpleshoulder bag handbaghandsquare
straplettercolorheartartificialhandmadehollowmobile phonestarparty

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access