Everful

Wholesale gift ornaments

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Gift Ornaments

Find the perfect pieces: christmas supplies, halloween supplies

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Handmade Crochet Positive Doll Knitted Wool Emotional Support Ornament With Motivational Card Desktop Decor Gift
Handmade Crochet Positive Doll Knitted Wool Emotional Support Ornament With Motivational Card Desktop Decor Gift
like
Find Similar
Detail of hand-knitted penguin doll holding a positive message card on white background - Black Penguin P Card
Handmade crochet succulent in brown pot with 'Life would succ without you' card, 11x10cm - Brown Potted Plant L Card
Handmade crochet sunflower with motivational card saying Be Brave on a white base - White Potted Tulip B Card
Handmade crochet pear doll with positive message card, cute knitted fruit ornament - Light Yellow Pear P Card
+77
Handmade Crochet Positive Doll Knitted Wool Emotional Support Ornament With Motivational Card Desktop Decor Gift
$1.01-4.32
Mix MOQ : 2
 · 
1K+ sold recently
Top 3% Best Sellers
in Home Decor
Free Shipping
3D Laser Engraved Crystal Ball Night Light With LED Base Solar System Galaxy Sphere Decorative Desk Ornament Gift
3D Laser Engraved Crystal Ball Night Light With LED Base Solar System Galaxy Sphere Decorative Desk Ornament Gift
like
Find Similar
Solar system 3D laser engraved crystal ball night light with glowing black base - Shooting Star Solar System / 6cm Ball + Round Black Color Light Base
3D laser engraved galaxy crystal ball with LED base as glowing tabletop decor - Milky Way / 6cm Ball Only
3D Solar System inner carving crystal ball night light with a black luminous base - Solar System Print / 6cm Ball Only
3D laser engraved crystal ball night light featuring a luminous blue moon design - Moon / 6cm Ball Only
+68
3D Laser Engraved Crystal Ball Night Light With LED Base Solar System Galaxy Sphere Decorative Desk Ornament Gift
$0.75-3.75
No MOQ
 · 
216 sold recently
Top 3% Best Sellers
in Home Decor
Articulated Chinese Divine Dragon 3D Printed Movable Joints Flexible PLA Plastic Ornament Desk Decor Toy Gift
Articulated Chinese Divine Dragon 3D Printed Movable Joints Flexible PLA Plastic Ornament Desk Decor Toy Gift
like
Find Similar
Detailed close-up of 3D printed articulated dragon with silk gradient purple-blue scales - 30CM Crystal Fantasy Color
Detail of 3D printed articulated dragon toy in laser red color with layered texture - 30CM Laser Red
Detail of 3D printed articulated dragon with laser purple gradient and metallic texture - 30CM Laser Purple
Macro detail of 3D printed dragon scales in fantasy green gradient with flexible joints - 30CM Fantasy Green
+110
Articulated Chinese Divine Dragon 3D Printed Movable Joints Flexible PLA Plastic Ornament Desk Decor Toy Gift
$0.86-3.89
No MOQ
 · 
1K+ sold recently
Positive Emotional Support Knitted Crochet Doll Handmade Ornament Tabletop Decor Healing Gift
Positive Emotional Support Knitted Crochet Doll Handmade Ornament Tabletop Decor Healing Gift
like
Find Similar
Detail of hand-knitted green frog holding an inspirational card on a white background - Frog Autumn Green
Macro detail of pink crochet frog doll holding a white card with English text - Frog Rose Red
Cute green crochet frog doll holding an inspirational card for emotional support - Fruit Green Frog H Card
Detail showing an 8cm handmade crochet cabbage toy with an inspirational card - Cabbage P Card
+97
Positive Emotional Support Knitted Crochet Doll Handmade Ornament Tabletop Decor Healing Gift
$1.15-6.05
Mix MOQ : 5
 · 
359 sold recently
Top 3% Best Sellers
in Home Decor
Free Shipping
Natural Crystal Stone Dragon Head Carving Hand Carved Semi Precious Gemstone Desk Ornament Home Decor Statues Gifts
Natural Crystal Stone Dragon Head Carving Hand Carved Semi Precious Gemstone Desk Ornament Home Decor Statues Gifts
like
Find Similar
Macro detail of hand-carved purple amethyst dragon head statue on a wooden base - Purple Crystal
Macro shot of 4cm opal crystal dragon head figurine on a dark wooden stand - Synthetic Opal
Hand-carved white and purple natural stone dragon head on a wooden display base - Auspicious Jade
Dragon head carving made of natural red and green gemstone on a wood stand - Red Sesame
+21
Natural Crystal Stone Dragon Head Carving Hand Carved Semi Precious Gemstone Desk Ornament Home Decor Statues Gifts
$3.17
Mix MOQ : 2
 · 
238 sold recently
Top 10% Best Sellers
in Home Decor
Free Shipping
Resin Christmas Family Pendant Santa Claus Lady Elves DIY Blank Banner Hanging Ornament For Christmas Tree Home Festival Decor Gift
Resin Christmas Family Pendant Santa Claus Lady Elves DIY Blank Banner Hanging Ornament For Christmas Tree Home Festival Decor Gift
like
Find Similar
Detailed view of hand-painted resin Mrs. Claus and Santa ornament with glitter accents - Couple Style
Customizable resin Christmas ornament featuring Santa, Mrs. Claus, and a festive elf - Triple Figures Style
DIY Resin Mrs. Claus and Elves Christmas Hanging Ornament with Customizable Name Banner - 4 Santa Claus And Lady Pendants
DIY Resin Christmas tree ornament with Santa, Mrs. Claus, and elves on white banner - 5 Santa Claus Charms
+3
Resin Christmas Family Pendant Santa Claus Lady Elves DIY Blank Banner Hanging Ornament For Christmas Tree Home Festival Decor Gift
$1.21-1.44
Mix MOQ : 2
 · 
25 sold recently
Handmade Crochet Knitted Vegetable Fruit Mini Dolls Positive Energy Encouraging Card Desktop Ornaments Cute Funny Gifts
Handmade Crochet Knitted Vegetable Fruit Mini Dolls Positive Energy Encouraging Card Desktop Ornaments Cute Funny Gifts
like
Find Similar
Close-up of handmade crochet emotional support pickle with positive message card - Cucumber 4*12cm with Large Card
Handmade crochet positive potato doll in brown yarn with an encouraging message card - Blushing Potato with Card
Handmade brown crochet poop doll with funny eyes and smiling face, positive gift - Poop
Handmade crochet yellow chick doll plush toy with cute round shape and small wings - Ginger Poop
+15
Handmade Crochet Knitted Vegetable Fruit Mini Dolls Positive Energy Encouraging Card Desktop Ornaments Cute Funny Gifts
$0.29-1.73
Mix MOQ : 10
 · 
267 sold recently
Top 10% Best Sellers
in Home Decor
Free Shipping
Handmade Crochet Positive Potato Broccoli Sunflower Miniature Doll With Encouragement Card Creative Woolen Yarn Desk Ornament Healing Stress Relief Gift
Handmade Crochet Positive Potato Broccoli Sunflower Miniature Doll With Encouragement Card Creative Woolen Yarn Desk Ornament Healing Stress Relief Gift
like
Find Similar
Hand-knitted crochet positive otter doll with inspirational card for stress relief, 9cm - Otter Style
Handmade brown crochet bear holding a positive message card for stress relief - Little Brown Bear (0.6cm Eyes)
Handmade crochet sunflower potted doll with smiling face and motivational card - Sunflower Potted Plant (0.6cm Eyes)
Cute crochet broccoli plush doll holding positive inspirational message card toy - Broccoli (0.6cm Eyes)
+1
Handmade Crochet Positive Potato Broccoli Sunflower Miniature Doll With Encouragement Card Creative Woolen Yarn Desk Ornament Healing Stress Relief Gift
$0.69-1.96
No MOQ
 · 
4K+ sold recently
Top 1% Best Sellers
in Home Decor
Cute Cartoon Panda Bear Blind Box Figure Desktop Ornament Resin Miniature Animal Mystery Toy For Office Home Decoration Gift
Cute Cartoon Panda Bear Blind Box Figure Desktop Ornament Resin Miniature Animal Mystery Toy For Office Home Decoration Gift
like
Find Similar
Cute panda dessert blind box lamp with white plush sphere and green bow base - 8W063 Fluffy Panda Series / End Box (Set of 6)
Cute panda blind box figures with dessert themes and miniature dollhouse accessories - Bear Dessert Series / End Box (Set of 4)
Cartoon panda blind box toy set featuring cute resin figurines in bamboo forest setting - Bamboo Forest Swing Dream Panda Series / End Box (Set of 6)
Cute panda blind box figurine set with 8 standard styles and 1 hidden variant - Energetic Bear Panda Series / Full Box (Set of 8)
+67
Cute Cartoon Panda Bear Blind Box Figure Desktop Ornament Resin Miniature Animal Mystery Toy For Office Home Decoration Gift
-8%
$9.70-47.09
No MOQ
 · 
42 sold recently
Natural Crystal Crescent Moon Stone Ornaments Polished Healing Gemstone For Home Decor DIY Jewelry Accessories Gift
Natural Crystal Crescent Moon Stone Ornaments Polished Healing Gemstone For Home Decor DIY Jewelry Accessories Gift
like
Find Similar
Polished labradorite moon-shaped pendant with natural grey and white stone patterns - Black Flash (Labradorite)
Natural crescent moon pendant in dark brown agate stone for DIY jewelry making - Gold Silk Jade 1
Crescent moon-shaped white howlite stone with natural grey veining for DIY jewelry - White Pine (Howlite)
Moon-shaped natural red jasper stone pendant for DIY jewelry and healing crystal decor - Red Jasper
+27
Natural Crystal Crescent Moon Stone Ornaments Polished Healing Gemstone For Home Decor DIY Jewelry Accessories Gift
$0.86-1.04
No MOQ
 · 
574 sold recently
Top 10% Best Sellers
in Home Decor
Free Shipping
Handmade Crochet Emotional Support Pickle Positive Potato Knitted Doll Motivational Card Cute Desk Decor Ornament Gift
Handmade Crochet Emotional Support Pickle Positive Potato Knitted Doll Motivational Card Cute Desk Decor Ornament Gift
like
Find Similar
Detailed size specifications for handmade crochet potato and tomato desk ornaments - Tomato
Close-up of handmade crochet emotional support pickle with motivational text card - Dark Green Cucumber
Handmade green crochet positive potato plush doll with inspirational card accessory - Green Pear
Handmade crochet emotional support pickle with cute face and inspirational card - Dark Green + Thin Card
+17
Handmade Crochet Emotional Support Pickle Positive Potato Knitted Doll Motivational Card Cute Desk Decor Ornament Gift
$0.29-2.45
Mix MOQ : 6
 · 
845 sold recently
Top 10% Best Sellers
in Home Decor
Free Shipping
Astronaut Crystal Ball Night Light 3D Laser Engraved Galaxy LED Glowing Base Resin Desk Ornament Gift For Kids Friends
Astronaut Crystal Ball Night Light 3D Laser Engraved Galaxy LED Glowing Base Resin Desk Ornament Gift For Kids Friends
like
Find Similar
3D Crystal ball night light featuring astronaut resin figure and warm heart engraving - Sphere / Heart Cloud (Natural Light)
Astronaut night light with 3D laser engraved crystal ball and glowing blue light base - Sphere / Space Travel (Multicolor Light)
Astronaut night light with 3D inner carved crystal ball on luminous base decor - Sphere / Teacher's Appreciation (Multicolor Light)
Astronaut night light with 3D crystal ball and warm glowing base for desktop - Sphere / Teacher's Appreciation (Natural Light)
+38
Astronaut Crystal Ball Night Light 3D Laser Engraved Galaxy LED Glowing Base Resin Desk Ornament Gift For Kids Friends
$4.61
No MOQ
 · 
57 sold recently
Astronaut Planet Night Light Moon Lamp Desktop Decorative Ornament Glowing ABS PVC For Bedroom Home Office Creative Gift
Astronaut Planet Night Light Moon Lamp Desktop Decorative Ornament Glowing ABS PVC For Bedroom Home Office Creative Gift
like
Find Similar
Astronaut planet night light in warm yellow with crater textures, 9.5cm width variant - Planet Lamp (Battery Powered)
Sitting white astronaut ornament with gold visor, 5.2cm mini moon astronaut statue - Gold Astronaut Ornament
White astronaut night light ornament with silver visor, measuring 4.5 x 5.2 x 4.1 cm - Silver Astronaut Ornament
Astronaut night light ornament with blue metallic visor in 4.5x5.2cm compact size - Blue Astronaut Ornament
+9
Astronaut Planet Night Light Moon Lamp Desktop Decorative Ornament Glowing ABS PVC For Bedroom Home Office Creative Gift
$0.52-1.41
No MOQ
 · 
1K+ sold recently
Handmade Crochet Animals Mini Positive Dolls With Inspirational Card Yarn Knitted Desk Ornament Stress Relief Gift Home Decor
Handmade Crochet Animals Mini Positive Dolls With Inspirational Card Yarn Knitted Desk Ornament Stress Relief Gift Home Decor
like
Find Similar
Handmade crochet bean and coffee cup plush dolls in a pink paper gift box set - Coffee Bean
Handmade yellow crochet positive duck holding an inspirational white support card - Yellow Duck
Size chart showing dimensions of the handmade crochet graduation potato penguin doll - Graduation Potato
Handmade pink crochet pig plush doll with motivational card on a clean white background - Little Pig 2
+36
Handmade Crochet Animals Mini Positive Dolls With Inspirational Card Yarn Knitted Desk Ornament Stress Relief Gift Home Decor
$1.73-6.20
Mix MOQ : 3
 · 
530 sold recently
Free Shipping
Cute Capybara Blind Box Ornament Resin Sleepy Desktop Figure Decorative Toy For Office Home Gift
Cute Capybara Blind Box Ornament Resin Sleepy Desktop Figure Decorative Toy For Office Home Gift
like
Find Similar
Creative Capybara mini figures in various cute poses like sitting on a toilet or holding fruit - Little Sweet Bean (1040-203) - Whole Box 8pcs / Whole Set (8pcs)
Cat deity blind box figurine set featuring 8 regular and 2 hidden styles - Ruyi Zodiac Guardian Cat Deity Series - Whole Box 8pcs (-482)
Vegetable Fairy series cat figurines with pumpkin and cabbage themes in farmhouse setting - Vegetable Meow World Series - Whole Box 8pcs (-495)
Cute resin Buddha figurine desk decor for workplace relief and daily office decoration - Little Buddha Working Series / Whole Box (6 Pieces)
+69
Cute Capybara Blind Box Ornament Resin Sleepy Desktop Figure Decorative Toy For Office Home Gift
-38%
$1.59-47.09
No MOQ
 · 
11 sold recently
Cartoon Cat Figurines Resin Wood Carving Style Cute Kitten Miniature Statues Desktop Decor Car Dashboard Ornaments Gift
Cartoon Cat Figurines Resin Wood Carving Style Cute Kitten Miniature Statues Desktop Decor Car Dashboard Ornaments Gift
like
Find Similar
Cute wood-carved style resin cat figurine in orange stripes for desk or car decor - Wood Carving Style Small - Leopard Cat
Cartoon wood carving style resin cat figurine in cream and yellow finish - Wood Carving Style Small - Ragdoll Cat
Modern geometric resin grumpy cat figurine with blue eyes in tricolor grey and white - Wood Carving Style Small - Blue and White Cat
Black cat figurine with wood-carved texture and yellow eyes for desktop decoration - Wood Carving Style Small - Blue Cat
+24
Cartoon Cat Figurines Resin Wood Carving Style Cute Kitten Miniature Statues Desktop Decor Car Dashboard Ornaments Gift
$1.53-1.90
No MOQ
 · 
76 sold recently
Christmas Wooden Money Holder Ornament Hanging Tree Decor Gift Card Clip Reindeer Santa Snowman Creative Holiday Greeting
Christmas Wooden Money Holder Ornament Hanging Tree Decor Gift Card Clip Reindeer Santa Snowman Creative Holiday Greeting
like
Find Similar
Detail of wooden gnome Christmas money holder ornament for gas money on pine tree - Christmas Gnome/Oil Drum (Style 7)
Detail of wooden Christmas coffee money holder ornament hanging on a festive tree branch - Christmas Coffee Cups (Style 10)
Custom wooden Christmas money holder ornament featuring personalized name on a festive tree - Square Reindeer/Personalized (Style 13)
Detail of wooden reindeer money holder ornament with dimension 10cm on Christmas tree - Leopard Bow Reindeer (Style 15)
+37
Christmas Wooden Money Holder Ornament Hanging Tree Decor Gift Card Clip Reindeer Santa Snowman Creative Holiday Greeting
$0.55-4.55
No MOQ
 · 
676 sold recently
Vintage Alloy Fox Figurine Mini Animal Sculpture Antique Brass Look Desktop Ornament For Study Office Home Decor Tea Pet Gift
Vintage Alloy Fox Figurine Mini Animal Sculpture Antique Brass Look Desktop Ornament For Study Office Home Decor Tea Pet Gift
like
Find Similar
Golden seated fox figurine with intricate carved texture on minimalist display stand - Sitting Fox Style
Detailed macro view of retro brass fox figurine with realistic fur textures on wood - Standing Yellow Wolf Style
Close-up of a bronze animal sculpture with realistic fur texture on a mossy wood stump - Weasel Style
Close-up of a 5cm brass wolf figurine with detailed fur texture on natural rock - Fox Standing Style
Vintage Alloy Fox Figurine Mini Animal Sculpture Antique Brass Look Desktop Ornament For Study Office Home Decor Tea Pet Gift
$0.81-1.44
No MOQ
 · 
12 sold recently
Resin Blind Box Figurine Dunhuang Flying Apsaras Ancient Chinese Style Fairy Ornament Desktop Decoration Doll Mystery Gift
Resin Blind Box Figurine Dunhuang Flying Apsaras Ancient Chinese Style Fairy Ornament Desktop Decoration Doll Mystery Gift
like
Find Similar
Forest elf figurine set in matte finish with vibrant colors for desk decoration - Dream Ancient Beast Series / Whole Box
Lucky Cat resin crystal blind box set with six unique figurines and a hidden lucky edition - A Lucky Cat Box 6 / Full Box Set
Panda blind box collection featuring six daily life scenes and one secret figure - -363 Greedy Panda Box 6 / Full Box Set
Kawaii Siamese cat figurines set with colorful crystal stones for desk decoration - A061 Mermaid Cat Series Set of 8 / Full Box Set
+82
Resin Blind Box Figurine Dunhuang Flying Apsaras Ancient Chinese Style Fairy Ornament Desktop Decoration Doll Mystery Gift
-36%
$1.26-40.57
No MOQ
 · 
1 reviews
Vintage Music Box Retro Miniature Model Gramophone Piano Desk Decor Ornament Antique Style Musical Jewelry Box Gift
Vintage Music Box Retro Miniature Model Gramophone Piano Desk Decor Ornament Antique Style Musical Jewelry Box Gift
like
Find Similar
Detailed view of vintage violin music box with wood grain finish and size specifications - Violin Clockwork Music Box
Miniature yellow guitar music box on wood base, dimensions 9.5x21cm for home decor - Guitar Clockwork Music Box
Lute music box with wooden finish, 20.5cm height, 9.5cm diameter on a brown base - Pipa Lute Clockwork Music Box
Vintage gramophone music box in mahogany finish with golden horn, size 13x11x23cm - Brown Classical European Gramophone
+35
Vintage Music Box Retro Miniature Model Gramophone Piano Desk Decor Ornament Antique Style Musical Jewelry Box Gift
$3.80-10.09
No MOQ
 · 
21 sold recently
Crystal Butterfly Figurine Faceted Glass Ornament On Crystal Ball Base For Desktop Home Decor Gift
Crystal Butterfly Figurine Faceted Glass Ornament On Crystal Ball Base For Desktop Home Decor Gift
like
Find Similar
Pink faceted crystal butterfly ornament on a clear glass base for home decoration - Pink
Amber crystal butterfly on clear faceted glass ball decorative desk ornament - Yellow
Elegant green faceted crystal butterfly ornament on a clear faceted crystal ball base - Green
Blue crystal butterfly figurine on faceted clear glass ball for home desktop decoration - Blue
+7
Crystal Butterfly Figurine Faceted Glass Ornament On Crystal Ball Base For Desktop Home Decor Gift
$1.87-2.02
No MOQ
 · 
1K+ sold recently
Top 3% Best Sellers
in Home Decor
Miniature Cat Riding Yellow Duck Figurine Resin Animal Statue Desktop Decor Tiny Garden Landscape Ornament Creative Gift
Miniature Cat Riding Yellow Duck Figurine Resin Animal Statue Desktop Decor Tiny Garden Landscape Ornament Creative Gift
like
Find Similar
Miniature orange cat riding yellow duck figurine, resin gardening landscape decor 3.2cm - Yellow Cat Riding Duck
Miniature figurine featuring a black kitten riding a yellow duck for garden decor - Black Cat Riding Duck
Miniature orange cat riding a yellow duck figurine for landscape gardening, 3.2cm height - Calico Cat Riding Duck
Miniature white cat figurine riding yellow duck, resin garden ornament, 3.2cm tall - White Cat Riding Duck
+2
Miniature Cat Riding Yellow Duck Figurine Resin Animal Statue Desktop Decor Tiny Garden Landscape Ornament Creative Gift
$0.41
No MOQ
 · 
602 sold recently
Top 10% Best Sellers
in Home Decor
Dream Catcher Hanging Ornament Natural Feather Wood Bead Handmade Boho Style Car Home Decor Bag Charm Dreamy Gift
Dream Catcher Hanging Ornament Natural Feather Wood Bead Handmade Boho Style Car Home Decor Bag Charm Dreamy Gift
like
Find Similar
Pink dreamcatcher bag charm with white weaving and purple feather tassel on blue bag - Purple
White dreamcatcher charm with soft feathers and beads hanging on a navy handbag - White
Pink dreamcatcher bag charm with soft feathers and beads on a blue handbag accessory - Pink
Handmade light blue dreamcatcher keychain with white beads and soft feathers for bags - Blue
Dream Catcher Hanging Ornament Natural Feather Wood Bead Handmade Boho Style Car Home Decor Bag Charm Dreamy Gift
$0.63
Mix MOQ : 2
 · 
339 sold recently
Hummingbird Suncatcher Acrylic Colorful Stained Glass Style Hanging Ornament Window Garden Decor Gift
Hummingbird Suncatcher Acrylic Colorful Stained Glass Style Hanging Ornament Window Garden Decor Gift
like
Find Similar
Detail of purple and pink hummingbird suncatcher with stained glass texture and metal chain - Purple/Pink
Colorful hummingbird suncatcher acrylic window hanging ornament for garden decor - Teal & Orange & Green
Stained glass hummingbird suncatcher hanging ornament for windows and garden decor - Yellow & Orange & Red
Stained glass style hummingbird suncatcher with green and yellow acrylic wings for garden decor - Green & Yellow
+1
Hummingbird Suncatcher Acrylic Colorful Stained Glass Style Hanging Ornament Window Garden Decor Gift
$0.72
No MOQ
 · 
489 sold recently
Top 10% Best Sellers
in Home Decor
Handmade Crochet Potted Flower Ornament Yarn Knitted Desk Figurine With Positive Slogan Gift Home Office Table Decor
Handmade Crochet Potted Flower Ornament Yarn Knitted Desk Figurine With Positive Slogan Gift Home Office Table Decor
like
Find Similar
Handmade crochet 2025 graduation flower doll with Thank You card and scholar cap - Graduation Cap Double-head Red Rose
Handmade crochet pink carnation flower in brown pot with positive message card - Positive Potted-Deep Pink Rose
Handmade crochet positive yellow flower in a brown smiling pot with message card - Positive Potted-Yellow Rose
Handmade crochet purple flower potted plant with positive quote and cute face, 13.5cm height - Positive Potted-Gradient Purple Rose
+165
Handmade Crochet Potted Flower Ornament Yarn Knitted Desk Figurine With Positive Slogan Gift Home Office Table Decor
-12%
$0.76-4.82
Mix MOQ : 10
 · 
170 sold recently
Christmas Decoration Bows Handmade Burlap Linen Plaid Fabric For Holiday Tree Wreaths And Gift Wrap Ornaments
Christmas Decoration Bows Handmade Burlap Linen Plaid Fabric For Holiday Tree Wreaths And Gift Wrap Ornaments
like
Find Similar
Close-up of red burlap decorative bow with woven texture for Christmas tree decoration - Red Burlap Bow
Rustic burlap Christmas bow ornament with striped flocking and snowflake elk pattern - Khaki Bowknot
Detailed close-up of orange burlap Christmas bow with rustic woven linen texture - Maple Red Burlap Bow
Close-up of red velvet Christmas bow with gold stitched edges for wreath decoration - Flocked Red Velvet Bow
+3
Christmas Decoration Bows Handmade Burlap Linen Plaid Fabric For Holiday Tree Wreaths And Gift Wrap Ornaments
$0.46
Mix MOQ : 2
 · 
5K+ sold recently
Cute Cartoon Panda Figurine Resin Desktop Ornament Chinese Style Gourmet Blind Surprise Gift Home Office Decor
Cute Cartoon Panda Figurine Resin Desktop Ornament Chinese Style Gourmet Blind Surprise Gift Home Office Decor
like
Find Similar
Cute panda blind box figurine with mahjong motifs and a glowing hidden edition - -458 Panda Hanhan Baba Huhe 6 / Full Box Set
Panda blind box toy set featuring six regular designs and one rare hidden style - -420 Panda Baobao Relaxed Good Luck Box 6 / Full Box Set
Cute Capybara flocked mini figures in pastel colors set on miniature home props - -383 Soft Time Box 8 / Full Box Set
Panda Slow Life series set featuring 8 regular figures and 1 hidden edition mystery box - -407 Flower Rhyme Panda Baobao Box 8 / Full Box Set
+109
Cute Cartoon Panda Figurine Resin Desktop Ornament Chinese Style Gourmet Blind Surprise Gift Home Office Decor
$1.19-31.21
No MOQ
 · 
24 sold recently
Free Shipping
Acrylic Puzzle Shape Desk Ornament Heartfelt Thank You Gift For Mom Grandma Sister Daughter Mother's Day Anniversary Decor
Acrylic Puzzle Shape Desk Ornament Heartfelt Thank You Gift For Mom Grandma Sister Daughter Mother's Day Anniversary Decor
like
Find Similar
Acrylic puzzle-shaped gift plaque for sister on wood table with floral design - E4 Sister / 10.5*10.5*1cm
Acrylic puzzle gift for daughter with heartfelt message on a rustic wooden table - E6 Daughter / 10.5*10.5*1cm
Acrylic puzzle block gift for grandma with floral illustration on wooden desk - E2 Grandma / 10.5*10.5*1cm
Close-up of acrylic puzzle piece for Mom with heartfelt message and floral design - E3 Mom / 10.5*10.5*1cm
+5
Acrylic Puzzle Shape Desk Ornament Heartfelt Thank You Gift For Mom Grandma Sister Daughter Mother's Day Anniversary Decor
-4%
$1.52
Mix MOQ : 2
 · 
649 sold recently
Handmade Resin Koi Fish Figurine With Natural Crystal Stones Gold Foil Clear Desktop Ornament Lucky Healing Gift Decor
Handmade Resin Koi Fish Figurine With Natural Crystal Stones Gold Foil Clear Desktop Ornament Lucky Healing Gift Decor
like
Find Similar
Green crystal gravel and gold foil koi fish resin ornament on a white desk - Aventurine Jade
Transparent resin fish figurine with green pigment and gold foil flakes detail - South African Green Stone
Teal crystal fish figurine with gold foil accents on a clean white surface - Amazonite
Resin koi fish figurine with embedded gold leaf and a translucent amber finish - Ghost
+24
Handmade Resin Koi Fish Figurine With Natural Crystal Stones Gold Foil Clear Desktop Ornament Lucky Healing Gift Decor
$0.58
No MOQ
 · 
347 sold recently
Cute Cartoon Animal LED Night Light Vinyl Desktop Ornament Glowing Rabbit Duck Bear Shape Bedside Lamp For Kids Room Decor Gift
Cute Cartoon Animal LED Night Light Vinyl Desktop Ornament Glowing Rabbit Duck Bear Shape Bedside Lamp For Kids Room Decor Gift
like
Find Similar
Cute yellow moon-shaped LED night light emitting warm glow on a minimalist white desk - Large Cheese Moon - Yellow
Cartoon bear night light in warm yellow glow, cute glowing animal toy on white table - Tulip Bear
Cute bunny night light with warm yellow glow and pink plaid ribbon for home decor - Coco Rabbit - Pink
Cartoon rabbit night light with pink plaid ribbon emitting soft yellow glowing light - Small Coco Rabbit - Pink Ribbon
+70
Cute Cartoon Animal LED Night Light Vinyl Desktop Ornament Glowing Rabbit Duck Bear Shape Bedside Lamp For Kids Room Decor Gift
$0.81-1.96
No MOQ
 · 
87 sold recently
Handmade Crochet Positive Penguin Desk Ornament With Inspirational Message Card Colorful Wool Yarn Animal Figurine Gift
Handmade Crochet Positive Penguin Desk Ornament With Inspirational Message Card Colorful Wool Yarn Animal Figurine Gift
like
Find Similar
Handmade crochet penguin plush toy holding a tiny card with positive energy message - Penguin / Black
Handmade crochet positive penguin doll holding a motivational quote message card - Penguin / Gray
Close-up view of a handmade purple crochet penguin holding a positive message card - Penguin / Purple
Detailed shot of a light blue handmade crochet penguin with an encouraging card - Penguin / Blue
+4
Handmade Crochet Positive Penguin Desk Ornament With Inspirational Message Card Colorful Wool Yarn Animal Figurine Gift
$1.33
Mix MOQ : 5
 · 
757 sold recently
Cartoon Animal Figure Blind Box Resin Panda Cat Desktop Ornament Creative Chinese Style Home Decor Gift
Cartoon Animal Figure Blind Box Resin Panda Cat Desktop Ornament Creative Chinese Style Home Decor Gift
like
Find Similar
Fantasy Island blind box set featuring 9 cute cartoon panda character figurines - Fantasy Island Series-Random
Luminous cat party flower fairy phone stand blind box featuring translucent neon figures - Flower Fairy Magic Light-Random
Bee King series cartoon bee figurines made of PVC for desk decor and gifts - Bee King Arrival-Random
Cute yellow bear crystal ball music box collection with luminous cloud bases - Butter Bear Crystal Ball-Random
+98
Cartoon Animal Figure Blind Box Resin Panda Cat Desktop Ornament Creative Chinese Style Home Decor Gift
-5%
$1.44-48.67
No MOQ
 · 
63 views
Free Shipping
Vintage Wooden Frame Glass Hourglass Sand Timer Retro Desktop Ornament Creative Handcrafted Quicksand Decor For Home Office Gift
Vintage Wooden Frame Glass Hourglass Sand Timer Retro Desktop Ornament Creative Handcrafted Quicksand Decor For Home Office Gift
like
Find Similar
Set of three vintage wooden sand timers with bronze, silver, and colored beads for desk decor - Multicolor Vintage Style / 70*70*120mm
Vintage Wooden Frame Glass Hourglass Sand Timer Retro Desktop Ornament Creative Handcrafted Quicksand Decor For Home Office Gift
$1.73
Mix MOQ : 2
 · 
11 sold recently
Hourglass Sand Timer Retro Vintage Wood Metal Frame Borosilicate Glass Desktop Decorative Ornament Creative Gift
Hourglass Sand Timer Retro Vintage Wood Metal Frame Borosilicate Glass Desktop Decorative Ornament Creative Gift
like
Find Similar
26 options
Hourglass Sand Timer Retro Vintage Wood Metal Frame Borosilicate Glass Desktop Decorative Ornament Creative Gift
$6.92-10.09
Mix MOQ : 2
 · 
45 sold recently
Crystal Apple Decorative Ornament With Rhinestone Filling Golden Metal Leaf Glass Desktop Figurine Christmas Wedding Gift
Crystal Apple Decorative Ornament With Rhinestone Filling Golden Metal Leaf Glass Desktop Figurine Christmas Wedding Gift
like
Find Similar
Detail of crystal apple decor with red internal grains and gold rhinestone leaf - W 8CM H 9.3CM / Red
Transparent crystal apple ornament with red rhinestones on a gold leaf and stem - Width 6cm Height 7.3cm / White
Crystal apple ornament with pink diamond filling and gold leaf detail for home decor - Width 6cm Height 7.3cm / Pink
Elegant transparent crystal apple ornament with blue filler and golden diamond leaf - Width 6cm Height 7.3cm / Blue
+20
Crystal Apple Decorative Ornament With Rhinestone Filling Golden Metal Leaf Glass Desktop Figurine Christmas Wedding Gift
$1.87-3.03
No MOQ
 · 
53 sold recently
Handmade Dreamcatcher With Feather Tree Of Life Crystal Beads Hanging Wall Decor For Bedroom Boho Home Ornament Wedding Gift
Handmade Dreamcatcher With Feather Tree Of Life Crystal Beads Hanging Wall Decor For Bedroom Boho Home Ornament Wedding Gift
like
Find Similar
Rainbow dream catcher with LED lights, 55cm long featuring pink and yellow feathers - Dreamy Rainbow Quality Choice / Default Quality Choice
Pink heart-shaped dreamcatcher with feathers and beads for wall decor, 60cm total length - The Only (light Pink) Quality Choice / Default Quality Choice
Dreamcatcher wall hanging with colorful feathers, 16cm diameter for boho home decor - Dream Candy Quality Selection / Default Quality Choice
Pink and purple crescent moon dreamcatcher with feathers and beads, 16x59cm size - Crescent Moon Elf Quality Selection / Default Quality Choice
+17
Handmade Dreamcatcher With Feather Tree Of Life Crystal Beads Hanging Wall Decor For Bedroom Boho Home Ornament Wedding Gift
$8.24-17.37
No MOQ
 · 
70 views
Free Shipping
Mini Coffin Ornaments Natural Crystal Gemstone Polished Healing Stones Halloween Gothic Home Desk Decor Novelty Gift
Mini Coffin Ornaments Natural Crystal Gemstone Polished Healing Stones Halloween Gothic Home Desk Decor Novelty Gift
like
Find Similar
Polished tiger eye stone coffin ornaments with natural brown and yellow chatoyant stripes - Tiger's Eye
Polished green aventurine crystal mini coffin stones for Halloween decoration - Green Aventurine
Five pieces of polished Dalmatian Jasper stones in unique mini coffin shapes - Dalmatian Jasper
Five-piece set of polished white labradorite crystal coffin ornaments for Halloween decor - White Crystal
+8
Mini Coffin Ornaments Natural Crystal Gemstone Polished Healing Stones Halloween Gothic Home Desk Decor Novelty Gift
-4%
$0.82
No MOQ
 · 
42 sold recently
Free Shipping
Acrylic Heart Hanging Ornament Christmas Tree Decoration Festive Printed Quote Memorial Gift Friendship Sign
Acrylic Heart Hanging Ornament Christmas Tree Decoration Festive Printed Quote Memorial Gift Friendship Sign
like
Find Similar
Heart-shaped ceramic ornament with red ribbon and Christmas message on rustic background - We Wish You Lived Next Door
Close-up of heart-shaped ceramic ornament with friendship quote on a Christmas tree - Friends Are The Family You Choose With Your Heart (2)
Ceramic heart Christmas ornament with red snowflake ribbon on festive holiday tree - Warm Sentimental Phrase
Close-up of heart ceramic ornament with red ribbon on rustic wood background - Robins Appear When Loved Ones Are Near (8)
+4
Acrylic Heart Hanging Ornament Christmas Tree Decoration Festive Printed Quote Memorial Gift Friendship Sign
$0.25
Mix MOQ : 2
 · 
294 sold recently
Natural Crystal Rabbit Figurine Carved Gemstone Animal Totem Pocket Stone Desktop Decor Healing Crystal Ornament Gift
Natural Crystal Rabbit Figurine Carved Gemstone Animal Totem Pocket Stone Desktop Decor Healing Crystal Ornament Gift
like
Find Similar
Polished green natural crystal Peter Rabbit figurine with smooth stone texture - Green Aventurine
Hand-carved natural crystal rabbit figurine with decorative black spots and beige finish - Spotted Stone
Pink natural rhodonite rabbit crystal carving figurine with grey marble texture - Rhodochrosite
Hand-carved rabbit figurine made of natural purple amethyst crystal with polished finish - Purple Crystal
+15
Natural Crystal Rabbit Figurine Carved Gemstone Animal Totem Pocket Stone Desktop Decor Healing Crystal Ornament Gift
$3.46-4.32
Mix MOQ : 5
 · 
205 sold recently
Free Shipping
3D Printed Poseable Sports Ball Action Figure Desk Ornaments Basketball Soccer Baseball Football Volleyball Golf Bowling Pin Decoration Gift
3D Printed Poseable Sports Ball Action Figure Desk Ornaments Basketball Soccer Baseball Football Volleyball Golf Bowling Pin Decoration Gift
like
Find Similar
3D printed poseable soccer ball figure with movable black and white limbs, 7cm tall - Soccer Style
Articulated basketball figure poseable toy ornament in orange, size 9cm x 7cm - Basketball Style
Creative 7cm 3D printed brown American football figurine in sitting pose - Rugby Football Style
Creative sitting baseball figurine with movable limbs and red stitching details - Baseball Style
+4
3D Printed Poseable Sports Ball Action Figure Desk Ornaments Basketball Soccer Baseball Football Volleyball Golf Bowling Pin Decoration Gift
$1.96
Mix MOQ : 3
 · 
54 sold recently
Free Shipping
Chinese Style Hanfu Girl Figurine Blind Box Toy Resin Q Version Ancient Fairy Miniature Desktop Ornament Collectible Gift
Chinese Style Hanfu Girl Figurine Blind Box Toy Resin Q Version Ancient Fairy Miniature Desktop Ornament Collectible Gift
like
Find Similar
Cute resin Buddha figurine desk decor for workplace relief and daily office decoration - -50 Small Buddha Work Box 6 / Full Box Set
Pink Nine-Tailed Fox glowing figurine from the mythological animal blind box collection - Nine-Tailed Fox Crystal Stone Box 8 / Full Box Set
Nine-tailed fox figurines blind box set in 10 unique colors with soft flocking finish - -480 Nine-tailed Fox Flocked Box 9 / Full Box Set
Nine-tailed fox cartoon blind box figurines set in various colors with a fantasy forest theme - -464 Mountain And Sea Nine-tailed Smart Fox Box 6 / Full Box Set
+82
Chinese Style Hanfu Girl Figurine Blind Box Toy Resin Q Version Ancient Fairy Miniature Desktop Ornament Collectible Gift
-5%
$1.26-48.62
No MOQ
 · 
62 views
Free Shipping
Hamsa Hand Carved Natural Crystal Gemstone Evil Eye Fatima Hand Desk Ornament Healing Spiritual Decor Meditation Gift
Hamsa Hand Carved Natural Crystal Gemstone Evil Eye Fatima Hand Desk Ornament Healing Spiritual Decor Meditation Gift
like
Find Similar
Hamsa Hand pendant carved in green and orange natural stone held in palm - Unakite
Hamsa Hand carving in pink and black rhodonite stone held in hand on black background - Rhodonite
Hamsa Hand natural stone pendant carved with orange and yellow striped agate textures - Crazy Agate
Green natural jade stone Hand of Fatima pendant with carved eye motif in palm - Green Aventurine
+11
Hamsa Hand Carved Natural Crystal Gemstone Evil Eye Fatima Hand Desk Ornament Healing Spiritual Decor Meditation Gift
$3.03
Mix MOQ : 2
 · 
48 sold recently
Free Shipping
Christmas Rooster Chicken Ornaments Acrylic Cartoon Animal Pendants For Christmas Tree Home Car Decor Holiday Party Gift
Christmas Rooster Chicken Ornaments Acrylic Cartoon Animal Pendants For Christmas Tree Home Car Decor Holiday Party Gift
like
Find Similar
Christmas yellow chicken acrylic ornament wearing a red festive hat and glasses - Yellow Chick with Glasses
Christmas chicken ornament with red hat and blue feathers on a clean white background - Gold Brown Rooster
Christmas chicken ornament with red Santa hat and cape on a clean white background - Red Cloak Bird
Blue and gold rooster Christmas tree ornament with resin finish and golden hanging cord - Blue and Gold Feather Rooster
+8
Christmas Rooster Chicken Ornaments Acrylic Cartoon Animal Pendants For Christmas Tree Home Car Decor Holiday Party Gift
$0.25
Mix MOQ : 2
 · 
359 sold recently
Christmas Family Resin Pendant Red Polka Dot Pajamas Hanging Ornament Xmas Tree Home Holiday Decor Figurine Gift
Christmas Family Resin Pendant Red Polka Dot Pajamas Hanging Ornament Xmas Tree Home Holiday Decor Figurine Gift
like
Find Similar
Christmas tree ornament with 7 family members in red polka dot pajamas on resin resin - 7 People
Resin couple Christmas ornament with glitter hats and polar bear slippers hanging by red ribbon - 2 Members
Custom resin Christmas tree ornament featuring a family of three in red pajamas - 3 Members
Custom resin family Christmas tree ornament featuring four members in red polka dot pajamas - 4 Members
+2
Christmas Family Resin Pendant Red Polka Dot Pajamas Hanging Ornament Xmas Tree Home Holiday Decor Figurine Gift
$2.02
Mix MOQ : 2
 · 
28 sold recently
Natural Crystal Gravel Sleeping Dragon Handcrafted Resin Statue With Gold Foil Mythical Home Decor Desktop Ornament Gift
Natural Crystal Gravel Sleeping Dragon Handcrafted Resin Statue With Gold Foil Mythical Home Decor Desktop Ornament Gift
like
Find Similar
Sleeping black dragon crystal resin figurine with gold leaf accents for home decor - Obsidian
Artistic sleeping dragon figurine made of resin with natural crystals and sea shells - Ocean Jasper
Close-up of reddish-brown dragon figurine with detailed scales and crystal stone accents - Red Jasper
Detail of purple crystal resin dragon figurine with gold foil flakes on wings - Amethyst
+3
Natural Crystal Gravel Sleeping Dragon Handcrafted Resin Statue With Gold Foil Mythical Home Decor Desktop Ornament Gift
$2.60
No MOQ
 · 
25 sold recently
Cute Animal Blind Box Ornaments Set Synthetic Resin Natural Crystal Ore Aromatherapy Diffuser Stone Home Desk Decor Gift
Cute Animal Blind Box Ornaments Set Synthetic Resin Natural Crystal Ore Aromatherapy Diffuser Stone Home Desk Decor Gift
like
Find Similar
Cute animal crystal figurines collection featuring 13 different cat styles and gems - Meow Meow Little Bean (A032) / Random (Single Box)
Miniature Siamese cat resin figure with pink crystal stone and emotional energy theme - Emotional Siamese (A033) / Random (Single Box)
Lucky Buddha resin figurine with energy crystal stone sitting on lotus base - Ruyi Buddha ( -356) / Random (Single Box)
Cat theme crystal mineral set with resin bases including amethyst and rose quartz stones - Cat Crystal Box (1244-2) / Random (Single Box)
+108
Cute Animal Blind Box Ornaments Set Synthetic Resin Natural Crystal Ore Aromatherapy Diffuser Stone Home Desk Decor Gift
-5%
$1.53-25.63
No MOQ
 · 
1 reviews
Christmas Stocking Knitted Acrylic Cable Knit Holiday Decor Hanging Gift Candy Bag Classic Festive Home Ornament
Christmas Stocking Knitted Acrylic Cable Knit Holiday Decor Hanging Gift Candy Bag Classic Festive Home Ornament
like
Find Similar
Classic wine red cable knit Christmas stocking with hanging loop for holiday decor - Red
Knitted ivory Christmas stocking with cable pattern and hanging loop for holiday decor - White
Classic dark green cable knit Christmas stocking gift bag for festive holiday decoration - Green
Christmas Stocking Knitted Acrylic Cable Knit Holiday Decor Hanging Gift Candy Bag Classic Festive Home Ornament
$2.19
No MOQ
 · 
423 sold recently
Crystal Suncatcher Hanging Ornament With Metal Paw Print Rainbow Beads Faceted Prism For Window Garden Home Decor Gift
Crystal Suncatcher Hanging Ornament With Metal Paw Print Rainbow Beads Faceted Prism For Window Garden Home Decor Gift
like
Find Similar
Rainbow crystal suncatcher with metal paw print pendant and clear faceted prism ball - Style 9 - 30mm Crystal Ball
Rainbow crystal suncatcher with butterfly accent and teardrop prism for window hanging - Style 2 - 30mm K9 Diamond
Rainbow crystal paw suncatcher with metal chain and large teardrop prism pendant - Style 7 - 50mm Round Bead
Rainbow crystal suncatcher with paw print charm and faceted teardrop pendant hanging - Style 1 - 50mm Tear Drop
+5
Crystal Suncatcher Hanging Ornament With Metal Paw Print Rainbow Beads Faceted Prism For Window Garden Home Decor Gift
$1.12-1.59
No MOQ
 · 
161 sold recently
Newtons Cradle Balance Balls Pendulum Metal Plastic Stress Relief Desk Ornament Home Office Educational Decor Gift
Newtons Cradle Balance Balls Pendulum Metal Plastic Stress Relief Desk Ornament Home Office Educational Decor Gift
like
Find Similar
Small square Newton's cradle physics desk toy with metal balls, size 9x7.5x9cm - Small Square
Small T-shaped Newton's cradle balance balls desk toy with mahogany finish base - Small T-shape
Small sail shape Newton's cradle balance balls with wooden base 13x17.5x11cm - Small Sail-shape
Medium square Newton's cradle with five silver metal balls on a mahogany finish wood base - Medium Square
+8
Newtons Cradle Balance Balls Pendulum Metal Plastic Stress Relief Desk Ornament Home Office Educational Decor Gift
$1.24-3.46
Mix MOQ : 2
 · 
44 sold recently
Tree Of Life Dream Catcher Handmade Crystal Stone Feather Beads Hanging Ornament Bohemian Home Wall Decor Bedroom Gift
Tree Of Life Dream Catcher Handmade Crystal Stone Feather Beads Hanging Ornament Bohemian Home Wall Decor Bedroom Gift
like
Find Similar
Detail of tree of life dream catcher featuring blue feathers and crystal stone accents - Pearl Blue Pattern
Detail of life tree crystal dreamcatcher with black feathers and pink stones decor - Pearl Black Feather
Yellow crystal tree of life dream catcher with soft white and yellow feathers decor - Yellow Feather
Detail of life tree dream catcher with black feathers and crystal stones for wall decor - Pearl Black Crystal
+4
Tree Of Life Dream Catcher Handmade Crystal Stone Feather Beads Hanging Ornament Bohemian Home Wall Decor Bedroom Gift
-5%
$7.39
No MOQ
 · 
16 sold recently
French Bulldog Figurine Natural Crystal Gemstone Carved Dog Statue Desk Ornament Home Decor Gift
French Bulldog Figurine Natural Crystal Gemstone Carved Dog Statue Desk Ornament Home Decor Gift
like
Find Similar
Macro detail of blue translucent crystal French Bulldog figurine on dark wood surface - Blue Opalite
Macro shot of a 3cm white semi-transparent crystal French bulldog figurine on wood - Afghan Jade
Macro shot of 3cm green semi-precious stone french bulldog carving on wooden surface - Green Aventurine
Green semi-precious gemstone carving of a French Bulldog figurine with natural mineral texture - Ruby Zoisite
+17
French Bulldog Figurine Natural Crystal Gemstone Carved Dog Statue Desk Ornament Home Decor Gift
$3.46
Mix MOQ : 2
 · 
37 sold recently
Free Shipping
Handmade Crochet Turtle Positive Doll Emotional Support Gift Mini Yarn Animal Desktop Ornament With Inspirational Card
Handmade Crochet Turtle Positive Doll Emotional Support Gift Mini Yarn Animal Desktop Ornament With Inspirational Card
like
Find Similar
Handmade crochet positive turtle doll with inspirational card on white background - Positive Doll + Card / Green
Macro shot of a handmade crochet turtle coaster holding a textured glass on a shelf - Knitted Coaster / Brown Green
Handmade pink and white crochet turtle doll with positive affirmation gift card - Positive Doll + Card / Pink
Handmade green and brown crochet turtle doll held with positive quote card - Positive Doll + Card / Brown Green
+4
Handmade Crochet Turtle Positive Doll Emotional Support Gift Mini Yarn Animal Desktop Ornament With Inspirational Card
$1.73-2.16
No MOQ
 · 
156 sold recently
Free Shipping
Mini Crystal Globe Desktop Ornament Rotatable Transparent Glass Earth Model Metal Stand Office Study Decoration Gift
Mini Crystal Globe Desktop Ornament Rotatable Transparent Glass Earth Model Metal Stand Office Study Decoration Gift
like
Find Similar
Mini crystal globe desk ornament with golden metal stand for creative table decoration - Gold
Mini rotating crystal globe with metal stand for modern desk decor and student gift - Silver
Mini Crystal Globe Desktop Ornament Rotatable Transparent Glass Earth Model Metal Stand Office Study Decoration Gift
-4%
$0.88
No MOQ
 · 
77 sold recently
Acrylic Heart Hugging Hanging Ornament Romantic Modern Art Heart Shaped Decoration For Valentine's Day Christmas Tree Home Decor Party Gift
Acrylic Heart Hugging Hanging Ornament Romantic Modern Art Heart Shaped Decoration For Valentine's Day Christmas Tree Home Decor Party Gift
like
Find Similar
Wooden heart hug pendant with red and natural wood tones hanging on a Christmas tree - Heart Hug Style 3
Handcrafted wooden heart pendant with red and natural wood grain for Valentine decor - Heart Hug Style 2
Close-up of interlocking heart-shaped wooden charm with grain texture and red silk ribbon - Heart Hug Style 4
8cm heart-shaped wooden pendant featuring two-tone embracing hands design for decor - Heart Hug Style 1
Acrylic Heart Hugging Hanging Ornament Romantic Modern Art Heart Shaped Decoration For Valentine's Day Christmas Tree Home Decor Party Gift
$0.26
No MOQ
 · 
247 sold recently
Ganesha Statue Resin Elephant God Figurine Southeast Asian Style Religious Zen Home Office Desktop Buddha Ornament Gift
Ganesha Statue Resin Elephant God Figurine Southeast Asian Style Religious Zen Home Office Desktop Buddha Ornament Gift
like
Find Similar
Sandstone Ganesh statue ornament with dimensions 9cm height for home decor - Small / Sandstone Color
Detailed dimensions of white Ganesha resin statue with 12cm height and Om symbol detail - Medium / White
Sandstone Ganesha Buddha statue in meditation pose, dimensions 13x10x9cm, high detail - Medium / Sandstone Color
Sandstone finish Lord Ganesha statue in sitting pose, dimensions 21x16x13cm home decor - Large / Sandstone Color
+2
Ganesha Statue Resin Elephant God Figurine Southeast Asian Style Religious Zen Home Office Desktop Buddha Ornament Gift
-5%
$3.01-9.86
No MOQ
 · 
13 views
Animal Blind Box Figurine Natural Crystal Stone Resin Desktop Ornament Cute Cartoon Mini Diffuser Decoration Gift
Animal Blind Box Figurine Natural Crystal Stone Resin Desktop Ornament Cute Cartoon Mini Diffuser Decoration Gift
like
Find Similar
Cat theme crystal mineral set with resin bases including amethyst and rose quartz stones - Cat Crystal Series-Whole Box of 6PCS
Cute animal crystal blind box figurines with natural gemstones for home desk decor - Fun Animals Series-Whole Box of 6PCS
Animal PA Crystal blind box set with nine cute resin animals on raw gemstones - Crystal Stone 2.0 Series-Whole Box of 9PCS
Miniature Siamese cat resin figure with pink crystal stone and emotional energy theme - Emotional Siamese Series-Whole Box of 8PCS
+87
Animal Blind Box Figurine Natural Crystal Stone Resin Desktop Ornament Cute Cartoon Mini Diffuser Decoration Gift
-5%
$1.44-21.77
No MOQ
 · 
41 views
Free Shipping
Crystal Suncatcher Hanging Ornament Moon Sun Star Prism Rainbow Maker Bohemian Home Garden Window Decor Aesthetic Gift
Crystal Suncatcher Hanging Ornament Moon Sun Star Prism Rainbow Maker Bohemian Home Garden Window Decor Aesthetic Gift
like
Find Similar
Detail of golden moon suncatcher with multifaceted crystal ball reflecting aurora light - No. 1
Close-up of golden suncatcher with multi-faceted crystal prism in geometric pink scene - US 7
Macro detail of iridescent teardrop crystal pendant on gold metal ring with light prisms - US 8
Bohemian crystal sun catcher with gold sun moon charms and colorful faceted beads - US 9
+6
Crystal Suncatcher Hanging Ornament Moon Sun Star Prism Rainbow Maker Bohemian Home Garden Window Decor Aesthetic Gift
-5%
$0.99-1.15
No MOQ
 · 
65 sold recently
Snowman Family Tree Hanging Ornament Resin Hand Painted Festive Christmas Decoration Blue Hat Heart Style Holiday Gift
Snowman Family Tree Hanging Ornament Resin Hand Painted Festive Christmas Decoration Blue Hat Heart Style Holiday Gift
like
Find Similar
Personalized Christmas snowman family ornament with 3 snowmen and DIY banner - 3 Snowmen Family Style
Christmas snowman ornament featuring four snowmen in blue hats for tree decoration - 4 Snowmen Family Style
Christmas snowman family of five ornament with silver base for personalized DIY names - 5 Snowmen Family Style
Custom snowman couple Christmas ornament with blue hats on festive golden background - 2 Snowmen Family Style
+2
Snowman Family Tree Hanging Ornament Resin Hand Painted Festive Christmas Decoration Blue Hat Heart Style Holiday Gift
$2.16
Mix MOQ : 2
 · 
38 sold recently
Vintage Retro Hourglass Pencil Holder With LED Street Lamp Eiffel Tower Ferris Wheel Desktop Ornament Office Gift
Vintage Retro Hourglass Pencil Holder With LED Street Lamp Eiffel Tower Ferris Wheel Desktop Ornament Office Gift
like
Find Similar
Vintage Eiffel Tower night light with hourglass and bronze finish on wooden surface - Glowing Eiffel Tower Hourglass - Gold
Vintage ferris wheel hourglass with white sand on wooden base and bronze finish decor - Retro Ferris Wheel Hourglass
Retro black and silver street lamp pen holder with hourglass and sand ornament - Street Light Pen Holder Hourglass - Silver
Vintage bronze lighthouse hourglass pen holder with desk lamp ornament decoration - Street Light Pen Holder Hourglass - Gold
+4
Vintage Retro Hourglass Pencil Holder With LED Street Lamp Eiffel Tower Ferris Wheel Desktop Ornament Office Gift
$2.65-3.17
Mix MOQ : 2
 · 
55 views
Horse Statue Resin Figurine Rhinestone Ornaments Lucky Success Home Office Desktop Decoration Housewarming Gift Luxury
Horse Statue Resin Figurine Rhinestone Ornaments Lucky Success Home Office Desktop Decoration Housewarming Gift Luxury
like
Find Similar
Golden rearing horse statue modern luxury home decor sculpture L22cm W7.5cm H29.5cm - Success Horse (7128J-01) / Gold
Modern black and silver jumping horse statue for luxury home or office cabinet decor - Success Horse (7130L-02) / Large / Black
Modern turquoise and gold horse statue figurine for home and office luxury decor - Success Horse (7130L-01) / Large / Bronze
Success Rearing Horse resin statue in matte black and gold finish, size 22x7.5x29.5cm - Success Horse (7128J-03) / Black & Gold
+5
Horse Statue Resin Figurine Rhinestone Ornaments Lucky Success Home Office Desktop Decoration Housewarming Gift Luxury
-5%
$7.39-13.28
No MOQ
 · 
92 views
Go to

More in home & kitchen

Explore more in gift ornaments

homehangingstylewallkidsplastichome ornamentpartytablesteel
desktopresindecorativeheartgoldwindowpolishedgirlsdesktop ornamentsartificial

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access